Citrus Sinensis ID: 041698

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-----

MPAVGGFDKGNGKEYPGNLTPYVLVTCIVAAMGGLIFGYDIGISGGVTSMPSFLKKFFPSVYRKQQANESTNQYCQYDSETLTMFTSSLYLAALLSSLVASRVTRQFGRKLSMFFGGILFLAGALLNGFAQAIWMLIVGRLLLGFGIGFANQSVPLYLSEMAPYRFRGALNIGFQLSITVGILIANVLNYFFNKIHGGWGWRLSLGGAMVPALIITVGSMILPDTPNSIIERGRHEEAREELRKVRGVNDVEEEFNDLVAASEASRQVEHPWKNLLQKKYRPHLTMAVLIPFFQQFTGINVIMFYAPVLFNTIGFGSDASLMSAVITGIVNVVATMVSIYGVDKWGRRFLFLEGG

ccccccccccccccccccccHHHHHHHHHHHHHHHcccccccccccccccHHHHHHHcHHHHHHHccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHccccccccccHHHHcccHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHcccccHHHHHcccccHHHHHHHHHHHHHHHHcHHHHHHcHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccHHHHccc

**************YPGNLTPYVLVTCIVAAMGGLIFGYDIGISGGVTSMPSFLKKFFPSVYRKQQANESTNQYCQYDSETLTMFTSSLYLAALLSSLVASRVTRQFGRKLSMFFGGILFLAGALLNGFAQAIWMLIVGRLLLGFGIGFANQSVPLYLSEMAPYRFRGALNIGFQLSITVGILIANVLNYFFNKIHGGWGWRLSLGGAMVPALIITVGSMILPDTPNSIIERGRHEEAREELRKVRGVNDVEEEFNDLVA*******VEHPWKNLLQKKYRPHLTMAVLIPFFQQFTGINVIMFYAPVLFNTIGFGSDASLMSAVITGIVNVVATMVSIYGVDKWGRRFLFLEGG

xxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Sugar transport protein 1	Major hexose transporter. Mediates an active uptake of hexoses, by sugar/hydrogen symport. Can transport glucose, 3-O-methylglucose, fructose, xylose, mannose, galactose, fucose, 2-deoxyglucose and arabinose. Confers sensitivity to galactose in seedlings.	probable	P23586
Sugar carrier protein C		probable	Q41144

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 4GC0, chain A
Confidence level:very confident
Coverage over the Query: 21-61,72-353
View the alignment between query and template
View the model in PyMOL