Citrus Sinensis ID: 041736

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500
MRPKINIILPLFAILTLITLVTAEKLSVSNNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFDDKRNCLRDKPRQRSTLQCRMFLSRLVYCNTLKCQSSPQPPVYSLPPPVRPPPPPPPVPVSLPPPPTYCIHSPRPPPLFSPTPTPILPPPPPNLRLQPLPPPSPIPCEKQPPPSPPPYGPLPSITAIPYPYPPPPLFY
cccccccccHHHHHHHHHccccccEEEcccccccccHHHHHHHcccccccHHcccccccccccccccccccccHHHHHHHHHHHHHccccccccccccccccccccEEEEEccccccccccccEEEEEcccccccccccccccccccccEEccccccccccccHHHHccccccEEEccccCCcccccccccccccccEEEcccccccccccHHHccccccEEEccccCEECcccccccccccccEEEccccccccccHHHHHHHHHccHHccccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEEcccccccccccHHHcccccccEEECccccccccccccccccEEEcccccccccccccccHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccc
****INIILPLFAILTLITLVTAEKLSVSNNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFDDKRNCLRDKPRQRSTLQCRMFLSRLVYCNTLKC****************************************************************************PPP*PPPYGPLPSITAI*Y*Y*******
xxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRPKINIILPLFAILTLITLVTAEKLSVSNNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQAWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFDDKRNCLRDKPRQRSTLQCRMFLSRLVYCNTLKCQSSPQPPVYSLPPPVRPPPPPPPVPVSLPPPPTYCIHSPRPPPLFSPTPTPILPPPPPNLRLQPLPPPSPIPCEKQPPPSPPPYGPLPSITAIPYPYPPPPLFY

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Leucine-rich repeat extensin-like protein 4 Modulates cell morphogenesis by regulating cell wall formation and assembly, and/or growth polarization.probableQ9LHF1

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2Z63, chain A
Confidence level:very confident
Coverage over the Query: 122-372
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 74-374
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 121-393
View the alignment between query and template
View the model in PyMOL
Template: 2GRX, chain C
Confidence level:probable
Coverage over the Query: 465-478
View the alignment between query and template
View the model in PyMOL