Citrus Sinensis ID: 041736
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 500 | ||||||
| 359484368 | 752 | PREDICTED: uncharacterized protein LOC10 | 0.782 | 0.519 | 0.675 | 1e-154 | |
| 224143492 | 509 | predicted protein [Populus trichocarpa] | 0.782 | 0.768 | 0.662 | 1e-150 | |
| 449533433 | 451 | PREDICTED: leucine-rich repeat extensin- | 0.72 | 0.798 | 0.706 | 1e-150 | |
| 449443321 | 608 | PREDICTED: leucine-rich repeat extensin- | 0.724 | 0.595 | 0.705 | 1e-149 | |
| 449461987 | 740 | PREDICTED: leucine-rich repeat extensin- | 0.738 | 0.498 | 0.686 | 1e-147 | |
| 224089084 | 403 | predicted protein [Populus trichocarpa] | 0.694 | 0.861 | 0.731 | 1e-147 | |
| 449526636 | 785 | PREDICTED: leucine-rich repeat extensin- | 0.73 | 0.464 | 0.693 | 1e-147 | |
| 224117332 | 420 | predicted protein [Populus trichocarpa] | 0.71 | 0.845 | 0.702 | 1e-146 | |
| 15230120 | 494 | leucine-rich repeat extensin-like protei | 0.76 | 0.769 | 0.657 | 1e-146 | |
| 224141819 | 496 | predicted protein [Populus trichocarpa] | 0.794 | 0.800 | 0.67 | 1e-145 |
| >gi|359484368|ref|XP_002281292.2| PREDICTED: uncharacterized protein LOC100259389 [Vitis vinifera] | Back alignment and taxonomy information |
|---|
Score = 550 bits (1418), Expect = e-154, Method: Compositional matrix adjust.
Identities = 264/391 (67%), Positives = 312/391 (79%)
Query: 7 IILPLFAILTLITLVTAEKLSVSNNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPS 66
++L L + L +AE++S+S++G +AE +IK+RQLLYYR+ +G RGE + PS
Sbjct: 11 VLLHSLLFLGCLALCSAEQISISSHGHLTDAEVMYIKRRQLLYYRDEFGDRGEDVTVDPS 70
Query: 67 FKFENSRIRSAYIALQAWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAG 126
FEN R R+AYIALQAWK+AI+SDP NLT NWVG VCNYTGV+CAQA DN SIRTVAG
Sbjct: 71 LVFENPRQRNAYIALQAWKQAILSDPLNLTLNWVGSNVCNYTGVYCAQAPDNSSIRTVAG 130
Query: 127 IDLNHGDIASYLPEELGLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKF 186
IDLNHGDIA YLPEELGLL D+ALFH+N+NRFCGT+P F KLK+LFELDLSNNRFAGKF
Sbjct: 131 IDLNHGDIAGYLPEELGLLTDLALFHINSNRFCGTVPHKFAKLKILFELDLSNNRFAGKF 190
Query: 187 PYVVLGLPKLKFLDLRYNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLV 246
P VVL LP LKFLDLR+NEFEG +PK LFDKDLDA+FIN+NRF+F+LPDN GNSPVSV+V
Sbjct: 191 PEVVLHLPTLKFLDLRFNEFEGTVPKELFDKDLDAIFINHNRFAFDLPDNFGNSPVSVIV 250
Query: 247 LANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELP 306
+ANNK HGC+P S GNM+ TLNE+IL NN SCLP EIGLLKN+TV DVSYN L+G LP
Sbjct: 251 VANNKLHGCVPASLGNMADTLNEIILMNNQFRSCLPVEIGLLKNLTVLDVSYNGLLGPLP 310
Query: 307 DTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFDDKR 366
I M L+QLNVAHNMLSG++P S+C LPNL NF+F YNFFTGE P CL L F+D+R
Sbjct: 311 KEIGGMVELEQLNVAHNMLSGSIPASICKLPNLENFTFSYNFFTGEPPACLGLADFEDRR 370
Query: 367 NCLRDKPRQRSTLQCRMFLSRLVYCNTLKCQ 397
NCL +P QRS QC FLSR V C++ +C
Sbjct: 371 NCLPGRPEQRSAGQCNSFLSRPVDCSSFRCS 401
|
Source: Vitis vinifera Species: Vitis vinifera Genus: Vitis Family: Vitaceae Order: Vitales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224143492|ref|XP_002324974.1| predicted protein [Populus trichocarpa] gi|222866408|gb|EEF03539.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449533433|ref|XP_004173680.1| PREDICTED: leucine-rich repeat extensin-like protein 5-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449443321|ref|XP_004139428.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|449461987|ref|XP_004148723.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like, partial [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224089084|ref|XP_002308630.1| predicted protein [Populus trichocarpa] gi|222854606|gb|EEE92153.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|449526636|ref|XP_004170319.1| PREDICTED: leucine-rich repeat extensin-like protein 4-like [Cucumis sativus] | Back alignment and taxonomy information |
|---|
| >gi|224117332|ref|XP_002331736.1| predicted protein [Populus trichocarpa] gi|222874139|gb|EEF11270.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|15230120|ref|NP_189091.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana] gi|75334999|sp|Q9LHF1.1|LRX4_ARATH RecName: Full=Leucine-rich repeat extensin-like protein 4; Short=AtLRX4; Short=LRR/EXTENSIN4; AltName: Full=Cell wall hydroxyproline-rich glycoprotein; Flags: Precursor gi|9294099|dbj|BAB01951.1| extensin-like protein [Arabidopsis thaliana] gi|332643381|gb|AEE76902.1| leucine-rich repeat extensin-like protein 4 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224141819|ref|XP_002324259.1| predicted protein [Populus trichocarpa] gi|222865693|gb|EEF02824.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 500 | ||||||
| TAIR|locus:2094854 | 494 | AT3G24480 [Arabidopsis thalian | 0.746 | 0.755 | 0.664 | 8.3e-138 | |
| TAIR|locus:2142105 | 760 | LRX3 "AT4G13340" [Arabidopsis | 0.774 | 0.509 | 0.644 | 3.7e-135 | |
| TAIR|locus:2124142 | 857 | AT4G18670 "AT4G18670" [Arabido | 0.788 | 0.459 | 0.622 | 4.8e-133 | |
| TAIR|locus:2179449 | 433 | AT5G25550 "AT5G25550" [Arabido | 0.692 | 0.799 | 0.613 | 6.7e-120 | |
| TAIR|locus:2094389 | 470 | AT3G22800 "AT3G22800" [Arabido | 0.662 | 0.704 | 0.597 | 4.9e-108 | |
| TAIR|locus:2010247 | 847 | AT1G49490 [Arabidopsis thalian | 0.668 | 0.394 | 0.563 | 1.9e-106 | |
| TAIR|locus:2008895 | 744 | LRX1 "AT1G12040" [Arabidopsis | 0.67 | 0.450 | 0.560 | 1.2e-104 | |
| TAIR|locus:2085889 | 956 | AT3G19020 [Arabidopsis thalian | 0.72 | 0.376 | 0.521 | 6.7e-104 | |
| TAIR|locus:2044576 | 727 | AT2G15880 [Arabidopsis thalian | 0.718 | 0.493 | 0.506 | 1.3e-100 | |
| TAIR|locus:2118949 | 699 | AT4G33970 [Arabidopsis thalian | 0.718 | 0.513 | 0.505 | 2.7e-100 |
| TAIR|locus:2094854 AT3G24480 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 1349 (479.9 bits), Expect = 8.3e-138, P = 8.3e-138
Identities = 249/375 (66%), Positives = 300/375 (80%)
Query: 23 AEKLSVSNNGVFLEAEAAFIKQRQLLYYRNRYGGRGEFGRIPPSFKFENSRIRSAYIALQ 82
+ LS+S+N + E FI++RQLLYYR+ +G RGE + PS FEN R+RSAYIALQ
Sbjct: 23 SHSLSISSNAPLSDTEVRFIQRRQLLYYRDEFGDRGENVTVDPSLIFENPRLRSAYIALQ 82
Query: 83 AWKKAIISDPWNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEEL 142
AWK+AI+SDP N+T NW+G VCNYTGVFC++ALDN IRTVAGIDLNH DIA YLPEEL
Sbjct: 83 AWKQAILSDPNNITVNWIGSNVCNYTGVFCSKALDNRKIRTVAGIDLNHADIAGYLPEEL 142
Query: 143 GLLADIALFHVNTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLR 202
GLL D+ALFHVN+NRFCGT+P F +LKLLFELDLSNNRFAGKFP VVL LP LKFLDLR
Sbjct: 143 GLLTDLALFHVNSNRFCGTVPHKFKQLKLLFELDLSNNRFAGKFPTVVLHLPSLKFLDLR 202
Query: 203 YNEFEGKIPKALFDKDLDAVFINNNRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGN 262
+NEFEG +PK LF K+LDA+FIN+NRF FELP+N G+SPVSV+VLANN FHGC+P S
Sbjct: 203 FNEFEGTVPKELFSKNLDAIFINHNRFRFELPENFGDSPVSVIVLANNHFHGCIPTSLVE 262
Query: 263 MSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAH 322
M + LNE+I NNGL+SCLP +IG LKNVTVFDVS+N+L+G LP+++ M ++QLNVAH
Sbjct: 263 M-KNLNEIIFMNNGLNSCLPADIGRLKNVTVFDVSFNELVGPLPESVGGMVEVEQLNVAH 321
Query: 323 NMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFDDKRNCLRDKPRQRSTLQCR 382
N+LSG +P S+C LP L NF++ YNFFTGE+PVCL L FDD+RNCL +P QRS+ QC
Sbjct: 322 NLLSGKIPASICQLPKLENFTYSYNFFTGEAPVCLRLSEFDDRRNCLPGRPAQRSSRQCS 381
Query: 383 MFLSR-LVYCNTLKC 396
FLSR V C + C
Sbjct: 382 AFLSRPSVDCGSFGC 396
|
|
| TAIR|locus:2142105 LRX3 "AT4G13340" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2124142 AT4G18670 "AT4G18670" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2179449 AT5G25550 "AT5G25550" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2094389 AT3G22800 "AT3G22800" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2010247 AT1G49490 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2008895 LRX1 "AT1G12040" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2085889 AT3G19020 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2044576 AT2G15880 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2118949 AT4G33970 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 500 | |||
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 4e-29 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 8e-27 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 3e-26 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 1e-18 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-17 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 4e-12 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 1e-10 | |
| PLN00113 | 968 | PLN00113, PLN00113, leucine-rich repeat receptor-l | 2e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-10 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-08 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 2e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-08 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-08 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 9e-08 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 1e-07 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 1e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 2e-07 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-07 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 3e-07 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 4e-07 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 4e-07 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 4e-07 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 7e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 8e-07 | |
| PLN03150 | 623 | PLN03150, PLN03150, hypothetical protein; Provisio | 9e-07 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 1e-06 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 1e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-06 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-06 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-06 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 3e-06 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 3e-06 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 4e-06 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-06 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 6e-06 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 1e-05 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 1e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 2e-05 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 2e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 2e-05 | |
| pfam07174 | 297 | pfam07174, FAP, Fibronectin-attachment protein (FA | 2e-05 | |
| pfam04652 | 315 | pfam04652, DUF605, Vta1 like | 3e-05 | |
| PRK12323 | 700 | PRK12323, PRK12323, DNA polymerase III subunits ga | 3e-05 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 3e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 4e-05 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 4e-05 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 5e-05 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 5e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 6e-05 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-05 | |
| pfam03251 | 458 | pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd prote | 6e-05 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 6e-05 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 7e-05 | |
| PHA02682 | 280 | PHA02682, PHA02682, ORF080 virion core protein; Pr | 8e-05 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 9e-05 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 1e-04 | |
| PHA02682 | 280 | PHA02682, PHA02682, ORF080 virion core protein; Pr | 1e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 1e-04 | |
| pfam03153 | 332 | pfam03153, TFIIA, Transcription factor IIA, alpha/ | 1e-04 | |
| pfam02993 | 238 | pfam02993, MCPVI, Minor capsid protein VI | 1e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 2e-04 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 2e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 2e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-04 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 2e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 2e-04 | |
| smart00818 | 165 | smart00818, Amelogenin, Amelogenins, cell adhesion | 2e-04 | |
| PRK07994 | 647 | PRK07994, PRK07994, DNA polymerase III subunits ga | 2e-04 | |
| PRK10819 | 246 | PRK10819, PRK10819, transport protein TonB; Provis | 2e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 3e-04 | |
| COG4886 | 394 | COG4886, COG4886, Leucine-rich repeat (LRR) protei | 3e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 3e-04 | |
| PHA03378 | 991 | PHA03378, PHA03378, EBNA-3B; Provisional | 3e-04 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 3e-04 | |
| pfam08347 | 200 | pfam08347, CTNNB1_binding, N-terminal CTNNB1 bindi | 4e-04 | |
| pfam13388 | 422 | pfam13388, DUF4106, Protein of unknown function (D | 4e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 5e-04 | |
| PRK06995 | 484 | PRK06995, flhF, flagellar biosynthesis regulator F | 5e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 6e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 6e-04 | |
| PHA03307 | 1352 | PHA03307, PHA03307, transcriptional regulator ICP4 | 6e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 6e-04 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 6e-04 | |
| PHA03247 | 3151 | PHA03247, PHA03247, large tegument protein UL36; P | 7e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 7e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 7e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 7e-04 | |
| pfam12868 | 135 | pfam12868, DUF3824, Domain of unknwon function (DU | 7e-04 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 8e-04 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 8e-04 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 9e-04 | |
| pfam09770 | 804 | pfam09770, PAT1, Topoisomerase II-associated prote | 9e-04 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 9e-04 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 9e-04 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 9e-04 | |
| PRK14951 | 618 | PRK14951, PRK14951, DNA polymerase III subunits ga | 0.001 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.001 | |
| pfam07223 | 357 | pfam07223, DUF1421, Protein of unknown function (D | 0.001 | |
| pfam12526 | 115 | pfam12526, DUF3729, Protein of unknown function (D | 0.001 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 0.001 | |
| PRK14950 | 585 | PRK14950, PRK14950, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK07764 | 824 | PRK07764, PRK07764, DNA polymerase III subunits ga | 0.002 | |
| PRK03427 | 333 | PRK03427, PRK03427, cell division protein ZipA; Pr | 0.002 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.002 | |
| pfam03276 | 582 | pfam03276, Gag_spuma, Spumavirus gag protein | 0.002 | |
| PRK11633 | 226 | PRK11633, PRK11633, cell division protein DedD; Pr | 0.002 | |
| PRK10263 | 1355 | PRK10263, PRK10263, DNA translocase FtsK; Provisio | 0.002 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.002 | |
| PRK14971 | 614 | PRK14971, PRK14971, DNA polymerase III subunits ga | 0.002 | |
| pfam03154 | 979 | pfam03154, Atrophin-1, Atrophin-1 family | 0.003 | |
| PRK00404 | 141 | PRK00404, tatB, sec-independent translocase; Provi | 0.003 | |
| PRK14965 | 576 | PRK14965, PRK14965, DNA polymerase III subunits ga | 0.003 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.003 | |
| pfam13855 | 60 | pfam13855, LRR_8, Leucine rich repeat | 0.003 | |
| pfam06346 | 160 | pfam06346, Drf_FH1, Formin Homology Region 1 | 0.003 | |
| COG0810 | 244 | COG0810, TonB, Periplasmic protein TonB, links inn | 0.003 | |
| PRK09111 | 598 | PRK09111, PRK09111, DNA polymerase III subunits ga | 0.003 | |
| PRK14086 | 617 | PRK14086, dnaA, chromosomal replication initiation | 0.003 | |
| COG5178 | 2365 | COG5178, PRP8, U5 snRNP spliceosome subunit [RNA p | 0.003 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 0.003 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.004 | |
| PRK14948 | 620 | PRK14948, PRK14948, DNA polymerase III subunits ga | 0.004 | |
| PLN02983 | 274 | PLN02983, PLN02983, biotin carboxyl carrier protei | 0.004 | |
| pfam10349 | 111 | pfam10349, WWbp, WW-domain ligand protein | 0.004 | |
| pfam08263 | 42 | pfam08263, LRRNT_2, Leucine rich repeat N-terminal | 0.004 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Score = 121 bits (305), Expect = 4e-29
Identities = 86/273 (31%), Positives = 135/273 (49%), Gaps = 13/273 (4%)
Query: 86 KAIISDPWNLTSNW-VGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGL 144
K+ I+DP SNW VC + G+ C N+S R V IDL+ +I+ + +
Sbjct: 38 KSSINDPLKYLSNWNSSADVCLWQGITC-----NNSSR-VVSIDLSGKNISGKISSAIFR 91
Query: 145 LADIALFHVNTNRFCGTLPRS-FNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRY 203
L I +++ N+ G +P F L L+LSNN F G P +P L+ LDL
Sbjct: 92 LPYIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRG--SIPNLETLDLSN 149
Query: 204 NEFEGKIPKAL-FDKDLDAVFINNNRFSFELPDNIGN-SPVSVLVLANNKFHGCLPLSFG 261
N G+IP + L + + N ++P+++ N + + L LA+N+ G +P G
Sbjct: 150 NMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASNQLVGQIPRELG 209
Query: 262 NMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVA 321
M ++L + L N L +P EIG L ++ D+ YN L G +P ++ + +LQ L +
Sbjct: 210 QM-KSLKWIYLGYNNLSGEIPYEIGGLTSLNHLDLVYNNLTGPIPSSLGNLKNLQYLFLY 268
Query: 322 HNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESP 354
N LSG +P S+ SL L + N +GE P
Sbjct: 269 QNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIP 301
|
Length = 968 |
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|219321 pfam07174, FAP, Fibronectin-attachment protein (FAP) | Back alignment and domain information |
|---|
| >gnl|CDD|218191 pfam04652, DUF605, Vta1 like | Back alignment and domain information |
|---|
| >gnl|CDD|237057 PRK12323, PRK12323, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217453 pfam03251, Tymo_45kd_70kd, Tymovirus 45/70Kd protein | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177464 PHA02682, PHA02682, ORF080 virion core protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217392 pfam03153, TFIIA, Transcription factor IIA, alpha/beta subunit | Back alignment and domain information |
|---|
| >gnl|CDD|217310 pfam02993, MCPVI, Minor capsid protein VI | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|197891 smart00818, Amelogenin, Amelogenins, cell adhesion proteins, play a role in the biomineralisation of teeth | Back alignment and domain information |
|---|
| >gnl|CDD|236138 PRK07994, PRK07994, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236768 PRK10819, PRK10819, transport protein TonB; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223065 PHA03378, PHA03378, EBNA-3B; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219805 pfam08347, CTNNB1_binding, N-terminal CTNNB1 binding | Back alignment and domain information |
|---|
| >gnl|CDD|222095 pfam13388, DUF4106, Protein of unknown function (DUF4106) | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|235904 PRK06995, flhF, flagellar biosynthesis regulator FlhF; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|223039 PHA03307, PHA03307, transcriptional regulator ICP4; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|223021 PHA03247, PHA03247, large tegument protein UL36; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|221818 pfam12868, DUF3824, Domain of unknwon function (DUF3824) | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|220392 pfam09770, PAT1, Topoisomerase II-associated protein PAT1 | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|237865 PRK14951, PRK14951, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|219339 pfam07223, DUF1421, Protein of unknown function (DUF1421) | Back alignment and domain information |
|---|
| >gnl|CDD|152960 pfam12526, DUF3729, Protein of unknown function (DUF3729) | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|237864 PRK14950, PRK14950, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|236090 PRK07764, PRK07764, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|235124 PRK03427, PRK03427, cell division protein ZipA; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217469 pfam03276, Gag_spuma, Spumavirus gag protein | Back alignment and domain information |
|---|
| >gnl|CDD|236940 PRK11633, PRK11633, cell division protein DedD; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|236669 PRK10263, PRK10263, DNA translocase FtsK; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|237874 PRK14971, PRK14971, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|217393 pfam03154, Atrophin-1, Atrophin-1 family | Back alignment and domain information |
|---|
| >gnl|CDD|166942 PRK00404, tatB, sec-independent translocase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237871 PRK14965, PRK14965, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat | Back alignment and domain information |
|---|
| >gnl|CDD|148139 pfam06346, Drf_FH1, Formin Homology Region 1 | Back alignment and domain information |
|---|
| >gnl|CDD|223880 COG0810, TonB, Periplasmic protein TonB, links inner and outer membranes [Cell envelope biogenesis, outer membrane] | Back alignment and domain information |
|---|
| >gnl|CDD|236382 PRK09111, PRK09111, DNA polymerase III subunits gamma and tau; Validated | Back alignment and domain information |
|---|
| >gnl|CDD|237605 PRK14086, dnaA, chromosomal replication initiation protein; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|227505 COG5178, PRP8, U5 snRNP spliceosome subunit [RNA processing and modification] | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|237862 PRK14948, PRK14948, DNA polymerase III subunits gamma and tau; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215533 PLN02983, PLN02983, biotin carboxyl carrier protein of acetyl-CoA carboxylase | Back alignment and domain information |
|---|
| >gnl|CDD|220708 pfam10349, WWbp, WW-domain ligand protein | Back alignment and domain information |
|---|
| >gnl|CDD|219766 pfam08263, LRRNT_2, Leucine rich repeat N-terminal domain | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 500 | |||
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 100.0 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 99.96 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.9 | |
| KOG4194 | 873 | consensus Membrane glycoprotein LIG-1 [Signal tran | 99.9 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.87 | |
| KOG0444 | 1255 | consensus Cytoskeletal regulator Flightless-I (con | 99.84 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.84 | |
| KOG0472 | 565 | consensus Leucine-rich repeat protein [Function un | 99.82 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.82 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.78 | |
| PRK15370 | 754 | E3 ubiquitin-protein ligase SlrP; Provisional | 99.77 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.75 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.75 | |
| PLN03210 | 1153 | Resistant to P. syringae 6; Provisional | 99.74 | |
| PRK15387 | 788 | E3 ubiquitin-protein ligase SspH2; Provisional | 99.73 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.72 | |
| cd00116 | 319 | LRR_RI Leucine-rich repeats (LRRs), ribonuclease i | 99.72 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.7 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.68 | |
| KOG0617 | 264 | consensus Ras suppressor protein (contains leucine | 99.68 | |
| KOG0618 | 1081 | consensus Serine/threonine phosphatase 2C containi | 99.64 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.62 | |
| KOG4237 | 498 | consensus Extracellular matrix protein slit, conta | 99.62 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.41 | |
| KOG0532 | 722 | consensus Leucine-rich repeat (LRR) protein, conta | 99.35 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.34 | |
| PLN03150 | 623 | hypothetical protein; Provisional | 99.25 | |
| COG4886 | 394 | Leucine-rich repeat (LRR) protein [Function unknow | 99.22 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.17 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.16 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.07 | |
| KOG1909 | 382 | consensus Ran GTPase-activating protein [RNA proce | 99.05 | |
| KOG1259 | 490 | consensus Nischarin, modulator of integrin alpha5 | 99.02 | |
| KOG3207 | 505 | consensus Beta-tubulin folding cofactor E [Posttra | 99.01 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.94 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.92 | |
| KOG0531 | 414 | consensus Protein phosphatase 1, regulatory subuni | 98.87 | |
| PF14580 | 175 | LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ | 98.87 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.77 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.76 | |
| PF13855 | 61 | LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF | 98.69 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.57 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.52 | |
| KOG4658 | 889 | consensus Apoptotic ATPase [Signal transduction me | 98.49 | |
| COG5238 | 388 | RNA1 Ran GTPase-activating protein (RanGAP) involv | 98.42 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.41 | |
| KOG2120 | 419 | consensus SCF ubiquitin ligase, Skp2 component [Po | 98.39 | |
| KOG1859 | 1096 | consensus Leucine-rich repeat proteins [General fu | 98.34 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 98.18 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.15 | |
| KOG4579 | 177 | consensus Leucine-rich repeat (LRR) protein associ | 98.13 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.96 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.94 | |
| KOG2982 | 418 | consensus Uncharacterized conserved protein [Funct | 97.93 | |
| PF08263 | 43 | LRRNT_2: Leucine rich repeat N-terminal domain; In | 97.87 | |
| PF12799 | 44 | LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ | 97.82 | |
| PRK15386 | 426 | type III secretion protein GogB; Provisional | 97.68 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.49 | |
| KOG1644 | 233 | consensus U2-associated snRNP A' protein [RNA proc | 97.31 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.29 | |
| KOG3665 | 699 | consensus ZYG-1-like serine/threonine protein kina | 97.03 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 96.64 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.59 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.35 | |
| KOG2739 | 260 | consensus Leucine-rich acidic nuclear protein [Cel | 96.31 | |
| KOG3671 | 569 | consensus Actin regulatory protein (Wiskott-Aldric | 96.27 | |
| KOG2123 | 388 | consensus Uncharacterized conserved protein [Funct | 96.15 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 95.83 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.82 | |
| KOG4308 | 478 | consensus LRR-containing protein [Function unknown | 95.38 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.25 | |
| PF00560 | 22 | LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le | 95.14 | |
| PF13306 | 129 | LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ | 94.82 | |
| KOG4341 | 483 | consensus F-box protein containing LRR [General fu | 94.37 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 93.54 | |
| PF13504 | 17 | LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO | 91.64 | |
| KOG0473 | 326 | consensus Leucine-rich repeat protein [Function un | 91.38 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 91.11 | |
| KOG1947 | 482 | consensus Leucine rich repeat proteins, some prote | 90.78 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 89.98 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 89.98 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 87.76 | |
| smart00369 | 26 | LRR_TYP Leucine-rich repeats, typical (most popula | 85.93 | |
| smart00370 | 26 | LRR Leucine-rich repeats, outliers. | 85.93 | |
| KOG4242 | 553 | consensus Predicted myosin-I-binding protein [Cell | 84.32 | |
| PF13516 | 24 | LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI | 84.02 | |
| KOG4242 | 553 | consensus Predicted myosin-I-binding protein [Cell | 81.62 | |
| KOG3864 | 221 | consensus Uncharacterized conserved protein [Funct | 81.16 |
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
Probab=100.00 E-value=8.2e-36 Score=337.87 Aligned_cols=274 Identities=30% Similarity=0.481 Sum_probs=172.6
Q ss_pred CCCCCCCC-CCCCCCcCceecCCCCCCCCcCcEEEEECCCCCCcccCchhhcCCCCCCEEEcCCCCCCccCCcccc-CCC
Q 041736 93 WNLTSNWV-GCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIASYLPEELGLLADIALFHVNTNRFCGTLPRSFN-KLK 170 (500)
Q Consensus 93 ~~~~~~w~-~~~~c~~~gv~c~~~~~~~~~~~l~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~-~l~ 170 (500)
.....+|. ..+||.|.||.|+.. .+|+.|||++|++.+.++..|..+++|++|+|++|.+++.+|..+. .+.
T Consensus 45 ~~~~~~w~~~~~~c~w~gv~c~~~------~~v~~L~L~~~~i~~~~~~~~~~l~~L~~L~Ls~n~~~~~ip~~~~~~l~ 118 (968)
T PLN00113 45 LKYLSNWNSSADVCLWQGITCNNS------SRVVSIDLSGKNISGKISSAIFRLPYIQTINLSNNQLSGPIPDDIFTTSS 118 (968)
T ss_pred cccCCCCCCCCCCCcCcceecCCC------CcEEEEEecCCCccccCChHHhCCCCCCEEECCCCccCCcCChHHhccCC
Confidence 34456675 468999999999632 4677777777777777777777777777777777777766665543 566
Q ss_pred CCCEEeCcCCcCCC----------------------cCchhccCCCCCcEEeccCCcCCCCCchhhcC-CCCCeEEccCC
Q 041736 171 LLFELDLSNNRFAG----------------------KFPYVVLGLPKLKFLDLRYNEFEGKIPKALFD-KDLDAVFINNN 227 (500)
Q Consensus 171 ~L~~L~Ls~n~l~~----------------------~~p~~l~~l~~L~~L~Ls~N~l~g~~p~~~~~-~~L~~L~l~~n 227 (500)
+|++|+|++|++++ .+|..++++++|++|+|++|.+.+.+|..+.. .+|++|++++|
T Consensus 119 ~L~~L~Ls~n~l~~~~p~~~l~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~n 198 (968)
T PLN00113 119 SLRYLNLSNNNFTGSIPRGSIPNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPNSLTNLTSLEFLTLASN 198 (968)
T ss_pred CCCEEECcCCccccccCccccCCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCChhhhhCcCCCeeeccCC
Confidence 66666666665554 44444555555555555555555555544433 45555555555
Q ss_pred CccCCCCCccCC-CCcceEEeccccccccCchhhhcccccCcEEEeccCCCCCCCccccccCCCccEEeccCcccCCCCh
Q 041736 228 RFSFELPDNIGN-SPVSVLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELP 306 (500)
Q Consensus 228 ~l~~~~p~~~~~-~~L~~L~l~~n~l~~~~p~~l~~l~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~~~p 306 (500)
++++.+|..++. .+|++|++++|.+.+.+|..++++.+ |++|++++|++.+.+|..++++++|++|+|++|++++.+|
T Consensus 199 ~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l~~l~~-L~~L~L~~n~l~~~~p~~l~~l~~L~~L~L~~n~l~~~~p 277 (968)
T PLN00113 199 QLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGGLTS-LNHLDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIP 277 (968)
T ss_pred CCcCcCChHHcCcCCccEEECcCCccCCcCChhHhcCCC-CCEEECcCceeccccChhHhCCCCCCEEECcCCeeeccCc
Confidence 555555554443 45666666666666666666666654 6666666666666666666666666666666666666666
Q ss_pred hhhhCCCCCcEEEcccCCCCCCCchhhcCCCCCcEEEccCCcCccCCCCC----ccCCEEEcCCCCCCCCC
Q 041736 307 DTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVC----LDLQGFDDKRNCLRDKP 373 (500)
Q Consensus 307 ~~l~~l~~L~~L~L~~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~~p~~----~~L~~l~l~~N~l~~~~ 373 (500)
..+.++.+|++|+|++|.+.+.+|..+.++++|++|++++|.+++.++.. .+|+.|++++|.+.+..
T Consensus 278 ~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~~ 348 (968)
T PLN00113 278 PSIFSLQKLISLDLSDNSLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI 348 (968)
T ss_pred hhHhhccCcCEEECcCCeeccCCChhHcCCCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCcC
Confidence 66666666666666666666666666666666666666666666665542 35667777777766543
|
|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG0472 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >PLN03210 Resistant to P | Back alignment and domain information |
|---|
| >PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >PLN03150 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >COG4886 Leucine-rich repeat (LRR) protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] | Back alignment and domain information |
|---|
| >KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >KOG2982 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF08263 LRRNT_2: Leucine rich repeat N-terminal domain; InterPro: IPR013210 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B | Back alignment and domain information |
|---|
| >PRK15386 type III secretion protein GogB; Provisional | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] | Back alignment and domain information |
|---|
| >KOG3671 consensus Actin regulatory protein (Wiskott-Aldrich syndrome protein) [Signal transduction mechanisms; Cytoskeleton] | Back alignment and domain information |
|---|
| >KOG2123 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG4308 consensus LRR-containing protein [Function unknown] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] | Back alignment and domain information |
|---|
| >PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A | Back alignment and domain information |
|---|
| >KOG4341 consensus F-box protein containing LRR [General function prediction only] | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D | Back alignment and domain information |
|---|
| >KOG0473 consensus Leucine-rich repeat protein [Function unknown] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
| >smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily | Back alignment and domain information |
|---|
| >smart00370 LRR Leucine-rich repeats, outliers | Back alignment and domain information |
|---|
| >KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] | Back alignment and domain information |
|---|
| >PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A | Back alignment and domain information |
|---|
| >KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] | Back alignment and domain information |
|---|
| >KOG3864 consensus Uncharacterized conserved protein [Function unknown] | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 500 | ||||
| 3riz_A | 772 | Crystal Structure Of The Plant Steroid Receptor Bri | 3e-18 | ||
| 3rgx_A | 768 | Structural Insight Into Brassinosteroid Perception | 3e-18 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 1e-14 | ||
| 1ogq_A | 313 | The Crystal Structure Of Pgip (Polygalacturonase In | 9e-08 |
| >pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 | Back alignment and structure |
|
| >pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
| >pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 500 | |||
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-46 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 3e-25 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 1e-11 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-45 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-44 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-43 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 8e-41 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-39 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 3e-38 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-36 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 1e-17 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 2e-14 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 9e-29 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-28 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 3e-24 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-22 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 5e-21 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-19 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 1e-18 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 2e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 4e-15 | |
| 3fxi_A | 605 | TLR4, htoll, TOLL-like receptor 4; leucine rich re | 7e-09 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-27 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-26 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-26 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 7e-25 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 6e-24 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 1e-20 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 3e-26 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 6e-26 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-25 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 2e-24 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 9e-22 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 1e-21 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 4e-17 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 8e-26 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 1e-20 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 3e-14 | |
| 3jqh_A | 167 | C-type lectin domain family 4 member M; DC-signr, | 7e-10 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 3e-24 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 4e-24 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 6e-24 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 8e-22 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-20 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-20 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-17 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 5e-17 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 1e-07 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 2e-04 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 3e-23 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 4e-17 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 2e-11 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-22 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 4e-22 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-21 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-17 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-16 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 5e-15 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 2e-13 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 1e-08 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 4e-21 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 9e-21 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 1e-19 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 5e-17 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 2e-16 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-14 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 3e-13 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 9e-21 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 4e-13 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-07 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 2e-06 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 3e-20 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 5e-12 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-07 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 2e-05 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 1e-18 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 8e-18 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 3e-17 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-16 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 4e-12 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 4e-17 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 6e-15 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-14 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 9e-14 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 1e-10 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 3e-08 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 6e-17 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 6e-13 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 2e-05 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 9e-17 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-16 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 8e-15 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-14 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-12 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 5e-10 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 2e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 4e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 7e-09 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-08 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-07 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 1e-15 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-14 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 3e-12 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 6e-05 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 1e-15 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-14 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-14 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 3e-12 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 4e-07 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 2e-04 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 3e-15 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-13 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 5e-13 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-10 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 1e-09 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 2e-05 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 8e-05 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 8e-14 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-13 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 5e-13 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-12 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 2e-05 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-14 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 8e-13 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 6e-11 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 5e-10 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 1e-09 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 2e-13 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-11 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 1e-08 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 8e-07 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 6e-04 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-13 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 4e-13 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 9e-13 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 2e-12 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 7e-12 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 1e-11 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 6e-11 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 3e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-12 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 6e-11 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 1e-06 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 2e-04 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-12 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 2e-10 | |
| 1vt4_I | 1221 | APAF-1 related killer DARK; drosophila apoptosome, | 4e-12 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 4e-12 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 7e-08 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 2e-07 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 6e-05 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 6e-12 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 8e-12 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 3e-11 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 1e-10 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 8e-08 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 2e-11 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 3e-11 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 4e-11 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 9e-11 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 3e-11 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 1e-09 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 8e-11 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 1e-10 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 2e-04 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 1e-10 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 8e-09 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 2e-08 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 1e-10 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 2e-07 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 6e-07 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-10 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 2e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 3e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-09 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 7e-08 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 5e-04 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 1e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 1e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 3e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 5e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 5e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 5e-08 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-07 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-06 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 2e-06 | |
| 2grx_C | 229 | Protein TONB; beta barrel, outer membrane, heteroc | 1e-05 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-08 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 5e-07 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 1e-06 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 9e-06 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-08 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 1e-07 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 7e-06 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 9e-06 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 2e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 4e-05 | |
| 3pgw_B | 231 | SM B; protein-RNA complex, U1 snRNA, SM fold, SM c | 4e-04 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-08 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 2e-05 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 2e-08 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 3e-08 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 8e-08 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 4e-05 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 7e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 3e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 6e-07 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 1e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 8e-06 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 2e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 5e-05 | |
| 1m2v_B | 926 | SEC24, protein transport protein SEC24, SEC24P, SE | 9e-05 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 7e-07 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 1e-05 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 1e-07 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 2e-07 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 9e-05 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 3e-07 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 5e-06 | |
| 3v1v_A | 433 | 2-MIB synthase, 2-methylisoborneol synthase; class | 2e-04 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 1e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 2e-06 | |
| 3iox_A | 497 | AGI/II, PA; alpha helix, PPII helix, supersandwich | 4e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 2e-06 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 1e-05 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 3e-05 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 4e-06 | |
| 2yew_A | 253 | Capsid protein, coat protein; alphavirus, molecula | 5e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 4e-06 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 3e-05 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 1e-04 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 8e-04 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 2e-05 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 3e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 9e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 9e-05 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 2e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 4e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-04 | |
| 1deq_A | 390 | Fibrinogen (alpha chain); coiled-coil, blood clott | 5e-04 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 4e-05 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 5e-05 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 7e-05 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 2e-04 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 4e-04 | |
| 1mv3_A | 213 | MYC box dependent interacting protein 1; tumor sup | 6e-04 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 7e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 8e-05 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 1e-04 | |
| 3h0g_A | 1752 | DNA-directed RNA polymerase II subunit RPB1; trans | 2e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 1e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 2e-04 | |
| 1twf_A | 1733 | B220, DNA-directed RNA polymerase II largest subun | 3e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 2e-04 | |
| 2wvr_C | 546 | DNA replication factor CDT1; DNA replication licen | 6e-04 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 2e-04 | |
| 3i2d_A | 371 | E3 SUMO-protein ligase SIZ1; signal transduction, | 2e-04 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 3e-04 | |
| 3dzy_A | 467 | Retinoic acid receptor RXR-alpha; DNA-binding, HOS | 3e-04 | |
| 1dx0_A | 219 | Prion protein; brain, repeat; NMR {Bos taurus} SCO | 4e-04 | |
| 1pk8_A | 422 | RAT synapsin I; ATP binding, ATP grAsp, calcium (I | 4e-04 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 4e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 6e-04 | |
| 3tx7_B | 352 | Nuclear receptor subfamily 5 group A member 2; LRH | 7e-04 | |
| 3a58_A | 320 | Exocyst complex component SEC3; protein complex, P | 6e-04 |
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
Score = 163 bits (415), Expect = 1e-46
Identities = 68/301 (22%), Positives = 118/301 (39%), Gaps = 42/301 (13%)
Query: 80 ALQAWKKAIISDP----WNLTSNWVGCYVCNYTGVFCAQALDNHSIRTVAGIDLNHGDIA 135
AL KK + + W T++ C + GV C + V +DL+ ++
Sbjct: 10 ALLQIKKDLGNPTTLSSWLPTTD---CCNRTWLGVLCD---TDTQTYRVNNLDLSGLNLP 63
Query: 136 ------------SYL---------------PEELGLLADIALFHVNTNRFCGTLPRSFNK 168
YL P + L + ++ G +P ++
Sbjct: 64 KPYPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQ 123
Query: 169 LKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFD--KDLDAVFINN 226
+K L LD S N +G P + LP L + N G IP + K ++ I+
Sbjct: 124 IKTLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISR 183
Query: 227 NRFSFELPDNIGNSPVSVLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIG 286
NR + ++P N ++ + L+ N G + FG+ ++ L N L L ++G
Sbjct: 184 NRLTGKIPPTFANLNLAFVDLSRNMLEGDASVLFGSDK-NTQKIHLAKNSLAFDLG-KVG 241
Query: 287 LLKNVTVFDVSYNKLMGELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDY 346
L KN+ D+ N++ G LP + ++ L LNV+ N L G +P +L ++
Sbjct: 242 LSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQG-GNLQRFDVSAYAN 300
Query: 347 N 347
N
Sbjct: 301 N 301
|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 | Back alignment and structure |
|---|
| >1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >2grx_C Protein TONB; beta barrel, outer membrane, heterocomplex, inter-protein beta sheet, protein-protein, metal transport; HET: GCN KDO GMH FTT DAO MYR FCI; 3.30A {Escherichia coli} SCOP: d.212.1.2 PDB: 1xx3_A Length = 229 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >3pgw_B SM B; protein-RNA complex, U1 snRNA, SM fold, SM core, RRM, splici SNRNPS, splicing factors; HET: DNA; 4.40A {Homo sapiens} PDB: 3cw1_A Length = 231 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1m2v_B SEC24, protein transport protein SEC24, SEC24P, SEC24 protein, abnormal nuclear; zinc-finger, beta barrel, VWA domain, gelsolin domain,; 2.75A {Saccharomyces cerevisiae} SCOP: a.71.2.1 b.2.8.1 c.62.1.2 d.109.2.1 g.41.10.1 Length = 926 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >3v1v_A 2-MIB synthase, 2-methylisoborneol synthase; class I terpenoid cyclase fold, DDXXXXD motif, NDXXSXXXE MOT methylisoborneol biosynthesis; HET: GST; 1.80A {Streptomyces coelicolor} PDB: 3v1x_A* Length = 433 | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >3iox_A AGI/II, PA; alpha helix, PPII helix, supersandwich fold, surface adhesin WALL, peptidoglycan-anchor, cell adhesion; HET: PMS; 1.80A {Streptococcus mutans} PDB: 3ipk_A* 1jmm_A Length = 497 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2yew_A Capsid protein, coat protein; alphavirus, molecular dynamics; 5.00A {Barmah forest virus} Length = 253 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1mv3_A MYC box dependent interacting protein 1; tumor suppressor, endocytosis/exocytosis complex; NMR {Homo sapiens} SCOP: b.34.2.1 Length = 213 | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >3h0g_A DNA-directed RNA polymerase II subunit RPB1; transcription, multi-protein complex, DNA- binding, magnesium; 3.65A {Schizosaccharomyces pombe} Length = 1752 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >1twf_A B220, DNA-directed RNA polymerase II largest subunit; transcription, mRNA, multiprotein complex; HET: UTP; 2.30A {Saccharomyces cerevisiae} SCOP: e.29.1.2 PDB: 1i3q_A 1i6h_A 1k83_A* 1nik_A 1nt9_A 1pqv_A 1r5u_A 1r9s_A* 1r9t_A* 1sfo_A* 1twa_A* 1twc_A* 1i50_A* 1twg_A* 1twh_A* 1wcm_A 1y1v_A 1y1w_A 1y1y_A 1y77_A* ... Length = 1733 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2wvr_C DNA replication factor CDT1; DNA replication license, DNA replication inhibitor, phosphoprotein, UBL conjugation, DNA-binding, polymorphism; HET: DNA; 3.30A {Homo sapiens} PDB: 2klo_A* Length = 546 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 | Back alignment and structure |
|---|
| >3i2d_A E3 SUMO-protein ligase SIZ1; signal transduction, replication, ring E3, PIAS, ubiquitin, UBC9, metal-binding, nucleus; 2.60A {Saccharomyces cerevisiae} Length = 371 | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 | Back alignment and structure |
|---|
| >3dzy_A Retinoic acid receptor RXR-alpha; DNA-binding, HOST-virus interaction, metal-binding, nucleus, receptor, transcription, transcription regulation, zinc-FIN activator; HET: DNA REA BRL; 3.10A {Homo sapiens} PDB: 3dzu_A* 3e00_A* Length = 467 | Back alignment and structure |
|---|
| >1dx0_A Prion protein; brain, repeat; NMR {Bos taurus} SCOP: d.6.1.1 PDB: 1dx1_A 1qlx_A 1qlz_A Length = 219 | Back alignment and structure |
|---|
| >1pk8_A RAT synapsin I; ATP binding, ATP grAsp, calcium (II) ION, membrane protein; HET: ATP; 2.10A {Rattus norvegicus} SCOP: c.30.1.5 d.142.1.3 PDB: 1px2_A* Length = 422 | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3tx7_B Nuclear receptor subfamily 5 group A member 2; LRH-1, beta-catenin, armadillo repeat, nuclear receptor LIGA binding domain, protein binding; HET: P6L; 2.76A {Homo sapiens} Length = 352 | Back alignment and structure |
|---|
| >3a58_A Exocyst complex component SEC3; protein complex, PH domain, GTPase, membrane traffic, coiled coil, exocytosis, phosphoprotein; HET: GNP; 2.60A {Saccharomyces cerevisiae} Length = 320 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 500 | |||
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 100.0 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 100.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 3rgz_A | 768 | Protein brassinosteroid insensitive 1; phytohormon | 100.0 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 100.0 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 100.0 | |
| 1ogq_A | 313 | PGIP-2, polygalacturonase inhibiting protein; inhi | 100.0 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.97 | |
| 3v47_A | 455 | TOLL-like receptor 5B and variable lymphocyte REC | 99.97 | |
| 4eco_A | 636 | Uncharacterized protein; leucine-rich repeats, pro | 99.97 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.96 | |
| 4ecn_A | 876 | Leucine-rich repeat protein; leucine-rich repeats, | 99.96 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.96 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.96 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.96 | |
| 2id5_A | 477 | Lingo-1, leucine rich repeat neuronal 6A; CNS-spec | 99.96 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.96 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.96 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.96 | |
| 4fcg_A | 328 | Uncharacterized protein; structural genomics, PSI- | 99.96 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.96 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.95 | |
| 3o6n_A | 390 | APL1; leucine-rich repeat, protein binding; HET: N | 99.95 | |
| 2z7x_B | 520 | TOLL-like receptor 1, variable lymphocyte recepto; | 99.95 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.95 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.95 | |
| 3t6q_A | 606 | CD180 antigen; protein-protein complex, leucine ri | 99.95 | |
| 3oja_B | 597 | Anopheles plasmodium-responsive leucine-rich REPE | 99.95 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.95 | |
| 3a79_B | 562 | TLR6, VLRB.59, TOLL-like receptor 6, variable lymp | 99.95 | |
| 1xku_A | 330 | Decorin; proteoglycan, leucine-rich repeat, struct | 99.95 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.95 | |
| 2ft3_A | 332 | Biglycan; proteoglycan, dimer interface, structura | 99.95 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.95 | |
| 2z66_A | 306 | Variable lymphocyte receptor B, TOLL-like recepto; | 99.95 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.95 | |
| 3j0a_A | 844 | TOLL-like receptor 5; membrane protein, leucine-ri | 99.94 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.94 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.94 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.94 | |
| 1ziw_A | 680 | TOLL-like receptor 3; innate immunity, immune syst | 99.94 | |
| 2z81_A | 549 | CD282 antigen, TOLL-like receptor 2, variable lymp | 99.94 | |
| 3zyi_A | 452 | Leucine-rich repeat-containing protein 4; cell adh | 99.94 | |
| 3zyj_A | 440 | Leucine-rich repeat-containing protein 4C; cell ad | 99.94 | |
| 1ozn_A | 285 | Reticulon 4 receptor; NOGO receptor, MAD, myelinat | 99.94 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.94 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.94 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.94 | |
| 3vq2_A | 606 | TLR4, TOLL-like receptor 4; leucine rich repeat MD | 99.94 | |
| 1wwl_A | 312 | Monocyte differentiation antigen CD14; LPS, immune | 99.93 | |
| 4g8a_A | 635 | TOLL-like receptor 4; leucine rich repeat MD-2 rel | 99.93 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.93 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.93 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.93 | |
| 3o53_A | 317 | Protein LRIM1, AGAP006348-PA; leucine-rich repeat, | 99.93 | |
| 4fmz_A | 347 | Internalin; leucine rich repeat, structural genomi | 99.92 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.92 | |
| 2z80_A | 353 | TOLL-like receptor 2, variable lymphocyte recepto; | 99.92 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.92 | |
| 2z63_A | 570 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.92 | |
| 3oja_A | 487 | Leucine-rich immune molecule 1; coiled-coil, helix | 99.92 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.92 | |
| 1o6v_A | 466 | Internalin A; bacterial infection, extracellular r | 99.92 | |
| 3bz5_A | 457 | Internalin-J, INLJ; leucine rich repeat (LRR), cys | 99.92 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.91 | |
| 2z62_A | 276 | TOLL-like receptor 4, variable lymphocyte recepto; | 99.91 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.91 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.91 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.9 | |
| 3rfs_A | 272 | Internalin B, repeat modules, variable lymphocyte | 99.9 | |
| 1jl5_A | 454 | Outer protein YOPM; leucine-rich repeat, molecular | 99.9 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.9 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.89 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.89 | |
| 1p9a_G | 290 | Platelet glycoprotein IB alpha chain precursor; pl | 99.89 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.89 | |
| 3goz_A | 362 | Leucine-rich repeat-containing protein; LEGL7, NES | 99.88 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.88 | |
| 2o6q_A | 270 | Variable lymphocyte receptor A; leucine-rich repea | 99.88 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.88 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.88 | |
| 4glp_A | 310 | Monocyte differentiation antigen CD14; alpha beta | 99.88 | |
| 2ca6_A | 386 | RAN GTPase-activating protein 1; GAP, GTPase activ | 99.88 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.87 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.86 | |
| 1h6u_A | 308 | Internalin H; cell adhesion, leucine rich repeat, | 99.86 | |
| 2ast_B | 336 | S-phase kinase-associated protein 2; SCF-substrate | 99.86 | |
| 1z7x_W | 461 | Ribonuclease inhibitor; leucine-rich repeat, enzym | 99.85 | |
| 3g06_A | 622 | SSPH2 (leucine-rich repeat protein); E3 ubiquitin | 99.85 | |
| 2xwt_C | 239 | Thyrotropin receptor; signaling protein-immune sys | 99.85 | |
| 3cvr_A | 571 | Invasion plasmid antigen; leucine rich repeat and | 99.85 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.84 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.83 | |
| 3m19_A | 251 | Variable lymphocyte receptor A diversity region; a | 99.83 | |
| 4ay9_X | 350 | Follicle-stimulating hormone receptor; hormone-rec | 99.81 | |
| 2o6s_A | 208 | Variable lymphocyte receptor B; leucine-rich repea | 99.81 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.8 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.8 | |
| 1h6t_A | 291 | Internalin B; cell adhesion, leucine rich repeat, | 99.79 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.78 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.78 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.78 | |
| 1m9s_A | 605 | Internalin B; cell invasion, GW domains, SH3 domai | 99.77 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.77 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.76 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.76 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.76 | |
| 2v9t_B | 220 | SLIT homolog 2 protein N-product; structural prote | 99.75 | |
| 3e6j_A | 229 | Variable lymphocyte receptor diversity region; var | 99.75 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.74 | |
| 1dce_A | 567 | Protein (RAB geranylgeranyltransferase alpha subun | 99.74 | |
| 2v70_A | 220 | SLIT-2, SLIT homolog 2 protein N-product; neurogen | 99.74 | |
| 2xot_A | 361 | Amphoterin-induced protein 1; cell adhesion, neuro | 99.73 | |
| 1xeu_A | 263 | Internalin C; cellular invasion, leucine-rich repe | 99.72 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.71 | |
| 4b8c_D | 727 | Glucose-repressible alcohol dehydrogenase transcr | 99.7 | |
| 3ogk_B | 592 | Coronatine-insensitive protein 1; leucine rich rep | 99.69 | |
| 4ezg_A | 197 | Putative uncharacterized protein; internalin-A, le | 99.69 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.68 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.64 | |
| 1w8a_A | 192 | SLIT protein; signaling protein, secreted protein, | 99.63 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.62 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.61 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.6 | |
| 2ell_A | 168 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.6 | |
| 2je0_A | 149 | Acidic leucine-rich nuclear phosphoprotein 32 FAM | 99.58 | |
| 2o6r_A | 177 | Variable lymphocyte receptor B; leucine-rich repea | 99.56 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.55 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.55 | |
| 2p1m_B | 594 | Transport inhibitor response 1 protein; F-BOX, leu | 99.52 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.51 | |
| 1ds9_A | 198 | Outer arm dynein; leucine-rich repeat, beta-BETA-a | 99.51 | |
| 2wfh_A | 193 | SLIT homolog 2 protein C-product; developmental pr | 99.51 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.49 | |
| 1a9n_A | 176 | U2A', U2A'; complex (nuclear protein/RNA), RNA, sn | 99.49 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.47 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.43 | |
| 3sb4_A | 329 | Hypothetical leucine rich repeat protein; LRR, rig | 99.42 | |
| 3g39_A | 170 | Variable lymphocyte receptor VLRB.2D; antibody, X- | 99.39 | |
| 2r9u_A | 174 | Variable lymphocyte receptor; adaptive immunity, V | 99.36 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.35 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.32 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.24 | |
| 3un9_A | 372 | NLR family member X1; leucine rich repeat (LRR), a | 99.23 | |
| 4fdw_A | 401 | Leucine rich hypothetical protein; putative cell s | 99.23 | |
| 2ifg_A | 347 | High affinity nerve growth factor receptor; TRK, T | 99.22 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.94 | |
| 2ra8_A | 362 | Uncharacterized protein Q64V53_bacfr; WGR domain, | 98.86 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.51 | |
| 1io0_A | 185 | Tropomodulin; LRR protein, right-handed super-heli | 98.49 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.45 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.44 | |
| 4fs7_A | 394 | Uncharacterized protein; leucine-rich repeats, pro | 98.43 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.4 | |
| 3rw6_A | 267 | Nuclear RNA export factor 1; retroviral constituti | 98.26 | |
| 4gt6_A | 394 | Cell surface protein; leucine rich repeats, putati | 98.24 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 98.0 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.93 | |
| 3e4g_A | 176 | ATP synthase subunit S, mitochondrial; leucine-ric | 97.8 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.64 | |
| 1pgv_A | 197 | TMD-1, tropomodulin TMD-1; structural genomics, PS | 97.64 | |
| 4h09_A | 379 | Hypothetical leucine rich repeat protein; two LRR_ | 97.56 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.48 | |
| 3rfe_A | 130 | Platelet glycoprotein IB beta chain; platelet surf | 96.29 |
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
Probab=100.00 E-value=4.8e-40 Score=323.88 Aligned_cols=288 Identities=25% Similarity=0.397 Sum_probs=256.9
Q ss_pred hhHHHHHHHHHHHHhccCCCCCCCCCCC-CCCCCC--cCceecCCCCCCCCcCcEEEEECCCCCCcc--cCchhhcCCCC
Q 041736 73 RIRSAYIALQAWKKAIISDPWNLTSNWV-GCYVCN--YTGVFCAQALDNHSIRTVAGIDLNHGDIAS--YLPEELGLLAD 147 (500)
Q Consensus 73 ~~~~~~~~l~~~~~~~~~~~~~~~~~w~-~~~~c~--~~gv~c~~~~~~~~~~~l~~L~L~~n~l~~--~~p~~l~~l~~ 147 (500)
|..++..||++||..+ .++. ...+|. +.+||. |.||.|+.. ....+|+.|+|++|.+.+ .++..|+++++
T Consensus 3 c~~~~~~aL~~~k~~~-~~~~-~l~~W~~~~~~C~~~w~gv~C~~~---~~~~~l~~L~L~~~~l~~~~~~~~~l~~l~~ 77 (313)
T 1ogq_A 3 CNPQDKQALLQIKKDL-GNPT-TLSSWLPTTDCCNRTWLGVLCDTD---TQTYRVNNLDLSGLNLPKPYPIPSSLANLPY 77 (313)
T ss_dssp SCHHHHHHHHHHHHHT-TCCG-GGTTCCTTSCTTTTCSTTEEECCS---SSCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred CCHHHHHHHHHHHHhc-CCcc-cccCCCCCCCCCcCCCcceEeCCC---CCCceEEEEECCCCCccCCcccChhHhCCCC
Confidence 3456777888888876 3554 567885 468898 999999642 112589999999999999 89999999999
Q ss_pred CCEEEcCC-CCCCccCCccccCCCCCCEEeCcCCcCCCcCchhccCCCCCcEEeccCCcCCCCCchhhcC-CCCCeEEcc
Q 041736 148 IALFHVNT-NRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFD-KDLDAVFIN 225 (500)
Q Consensus 148 L~~L~L~~-n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~~p~~~~~-~~L~~L~l~ 225 (500)
|++|+|++ |.+++.+|..|+++++|++|+|++|++++.+|..+.++++|++|+|++|++++.+|..+.. ++|++|+++
T Consensus 78 L~~L~L~~~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~L~ 157 (313)
T 1ogq_A 78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD 157 (313)
T ss_dssp CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred CCeeeCCCCCcccccCChhHhcCCCCCEEECcCCeeCCcCCHHHhCCCCCCEEeCCCCccCCcCChHHhcCCCCCeEECc
Confidence 99999995 9999999999999999999999999999999999999999999999999999989887765 899999999
Q ss_pred CCCccCCCCCccCC-C-CcceEEeccccccccCchhhhcccccCcEEEeccCCCCCCCccccccCCCccEEeccCcccCC
Q 041736 226 NNRFSFELPDNIGN-S-PVSVLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMG 303 (500)
Q Consensus 226 ~n~l~~~~p~~~~~-~-~L~~L~l~~n~l~~~~p~~l~~l~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~ 303 (500)
+|++++.+|..++. . +|++|++++|.+++.++..+..+. |++|++++|.+++.++..+..+++|++|+|++|++++
T Consensus 158 ~N~l~~~~p~~l~~l~~~L~~L~L~~N~l~~~~~~~~~~l~--L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~L~~N~l~~ 235 (313)
T 1ogq_A 158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN--LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF 235 (313)
T ss_dssp SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC--CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECC
T ss_pred CCcccCcCCHHHhhhhhcCcEEECcCCeeeccCChHHhCCc--ccEEECcCCcccCcCCHHHhcCCCCCEEECCCCceee
Confidence 99999999988876 3 799999999999999999999985 9999999999999999999999999999999999997
Q ss_pred CChhhhhCCCCCcEEEcccCCCCCCCchhhcCCCCCcEEEccCCcCccCCCCCc---cCCEEEcCCCC
Q 041736 304 ELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCL---DLQGFDDKRNC 368 (500)
Q Consensus 304 ~~p~~l~~l~~L~~L~L~~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~~p~~~---~L~~l~l~~N~ 368 (500)
.++. +..+++|++|+|++|.+++.+|..+..+++|++|+|++|+++|.+|... .|+.+++++|.
T Consensus 236 ~~~~-~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~~~ip~~~~l~~L~~l~l~~N~ 302 (313)
T 1ogq_A 236 DLGK-VGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNK 302 (313)
T ss_dssp BGGG-CCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSS
T ss_pred ecCc-ccccCCCCEEECcCCcccCcCChHHhcCcCCCEEECcCCcccccCCCCccccccChHHhcCCC
Confidence 7765 8889999999999999999999999999999999999999999998753 46667777664
|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* | Back alignment and structure |
|---|
| >4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} | Back alignment and structure |
|---|
| >2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* | Back alignment and structure |
|---|
| >3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} | Back alignment and structure |
|---|
| >1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* | Back alignment and structure |
|---|
| >2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* | Back alignment and structure |
|---|
| >3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A | Back alignment and structure |
|---|
| >3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} | Back alignment and structure |
|---|
| >1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* | Back alignment and structure |
|---|
| >1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} | Back alignment and structure |
|---|
| >4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} | Back alignment and structure |
|---|
| >4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A | Back alignment and structure |
|---|
| >3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A | Back alignment and structure |
|---|
| >1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 | Back alignment and structure |
|---|
| >2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A | Back alignment and structure |
|---|
| >1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I | Back alignment and structure |
|---|
| >3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} | Back alignment and structure |
|---|
| >2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* | Back alignment and structure |
|---|
| >3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A | Back alignment and structure |
|---|
| >4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* | Back alignment and structure |
|---|
| >2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A | Back alignment and structure |
|---|
| >3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* | Back alignment and structure |
|---|
| >2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} | Back alignment and structure |
|---|
| >2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} | Back alignment and structure |
|---|
| >1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} | Back alignment and structure |
|---|
| >3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* | Back alignment and structure |
|---|
| >4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A | Back alignment and structure |
|---|
| >2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A | Back alignment and structure |
|---|
| >2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A | Back alignment and structure |
|---|
| >2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} | Back alignment and structure |
|---|
| >3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D | Back alignment and structure |
|---|
| >2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} | Back alignment and structure |
|---|
| >4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A | Back alignment and structure |
|---|
| >2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A | Back alignment and structure |
|---|
| >4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 | Back alignment and structure |
|---|
| >4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
| >3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 500 | ||||
| d1ogqa_ | 313 | c.10.2.8 (A:) Polygalacturonase inhibiting protein | 1e-12 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 2e-12 | |
| d2omza2 | 384 | c.10.2.1 (A:33-416) Internalin A {Listeria monocyt | 4e-12 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 4e-12 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-06 | |
| d1xkua_ | 305 | c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 | 5e-05 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 6e-07 | |
| d1p9ag_ | 266 | c.10.2.7 (G:) von Willebrand factor binding domain | 0.002 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 2e-06 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 5e-06 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 4e-05 | |
| d1ozna_ | 284 | c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept | 1e-04 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 7e-06 | |
| d1jl5a_ | 353 | c.10.2.6 (A:) Leucine rich effector protein YopM { | 0.004 | |
| d2astb2 | 284 | c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 | 4e-05 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 2e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 7e-04 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1z7xw1 | 460 | c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( | 0.002 | |
| d1dcea3 | 124 | c.10.2.2 (A:444-567) Rab geranylgeranyltransferase | 0.001 | |
| d2ca6a1 | 344 | c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom | 0.002 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Score = 66.7 bits (161), Expect = 1e-12
Identities = 63/292 (21%), Positives = 115/292 (39%), Gaps = 15/292 (5%)
Query: 80 ALQAWKKAIISDPWNLTSNWVGCYVCNYT--GVFCAQALDNHSIRTVAGIDLNHGDIASY 137
AL KK + +P L+S CN T GV C + V +DL+ ++
Sbjct: 10 ALLQIKKDL-GNPTTLSSWLPTTDCCNRTWLGVLCD---TDTQTYRVNNLDLSGLNLPKP 65
Query: 138 --LPEELGLLADIALFHV-NTNRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLP 194
+P L L + ++ N G +P + KL L L +++ +G P + +
Sbjct: 66 YPIPSSLANLPYLNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIK 125
Query: 195 KLKFLDLRYNEFEGKIPKALFDKDLDAVF-INNNRFSFELPDNIGNSPVSV--LVLANNK 251
L LD YN G +P ++ + NR S +PD+ G+ + ++ N+
Sbjct: 126 TLVTLDFSYNALSGTLPPSISSLPNLVGITFDGNRISGAIPDSYGSFSKLFTSMTISRNR 185
Query: 252 FHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMGELPDTIAE 311
G +P +F N++ + + + + T + +
Sbjct: 186 LTGKIPPTFANLN---LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLGKVGL 242
Query: 312 MTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCLDLQGFD 363
+L L++ +N + GT+P + L L + + +N GE P +LQ FD
Sbjct: 243 SKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFD 294
|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 500 | |||
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 100.0 | |
| d1ogqa_ | 313 | Polygalacturonase inhibiting protein PGIP {Kidney | 99.97 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.92 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.9 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.9 | |
| d1ozna_ | 284 | Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma | 99.9 | |
| d1p9ag_ | 266 | von Willebrand factor binding domain of glycoprote | 99.88 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.88 | |
| d1xkua_ | 305 | Decorin {Cow (Bos taurus) [TaxId: 9913]} | 99.87 | |
| d2omza2 | 384 | Internalin A {Listeria monocytogenes [TaxId: 1639] | 99.83 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.8 | |
| d1h6ua2 | 227 | Internalin H {Listeria monocytogenes [TaxId: 1639] | 99.76 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.74 | |
| d1h6ta2 | 210 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.71 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.71 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.7 | |
| d2omxa2 | 199 | Internalin B {Listeria monocytogenes [TaxId: 1639] | 99.67 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.67 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.66 | |
| d1w8aa_ | 192 | Slit {Fruit fly (Drosophila melanogaster) [TaxId: | 99.65 | |
| d1xwdc1 | 242 | Follicle-stimulating hormone receptor {Human (Homo | 99.65 | |
| d1jl5a_ | 353 | Leucine rich effector protein YopM {Yersinia pesti | 99.62 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.56 | |
| d2ca6a1 | 344 | Rna1p (RanGAP1), N-terminal domain {Fission yeast | 99.52 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.49 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.48 | |
| d2astb2 | 284 | Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa | 99.46 | |
| d1z7xw1 | 460 | Ribonuclease inhibitor {Human (Homo sapiens) [TaxI | 99.46 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.45 | |
| d1dcea3 | 124 | Rab geranylgeranyltransferase alpha-subunit, C-ter | 99.44 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.43 | |
| d1a9na_ | 162 | Splicesomal U2A' protein {Human (Homo sapiens) [Ta | 99.39 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.3 | |
| d1m9la_ | 198 | Outer arm dynein light chain 1 {Green algae (Chlam | 99.22 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.21 | |
| d2ifga3 | 156 | High affinity nerve growth factor receptor, N-term | 99.14 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 98.33 | |
| d1koha1 | 162 | mRNA export factor tap {Human (Homo sapiens) [TaxI | 97.92 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.83 | |
| d1pgva_ | 167 | Tropomodulin C-terminal domain {nematode (Caenorha | 97.79 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.09 | |
| d1io0a_ | 166 | Tropomodulin C-terminal domain {Chicken (Gallus ga | 97.01 |
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
class: Alpha and beta proteins (a/b) fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) superfamily: L domain-like family: Polygalacturonase inhibiting protein PGIP domain: Polygalacturonase inhibiting protein PGIP species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=100.00 E-value=6.4e-39 Score=313.51 Aligned_cols=288 Identities=25% Similarity=0.398 Sum_probs=253.7
Q ss_pred hhHHHHHHHHHHHHhccCCCCCCCCCCC-CCCCCC--cCceecCCCCCCCCcCcEEEEECCCCCCcc--cCchhhcCCCC
Q 041736 73 RIRSAYIALQAWKKAIISDPWNLTSNWV-GCYVCN--YTGVFCAQALDNHSIRTVAGIDLNHGDIAS--YLPEELGLLAD 147 (500)
Q Consensus 73 ~~~~~~~~l~~~~~~~~~~~~~~~~~w~-~~~~c~--~~gv~c~~~~~~~~~~~l~~L~L~~n~l~~--~~p~~l~~l~~ 147 (500)
|..++++||++||+.+. |+ ..+++|. +.|||. |+||+|+.. ....+|+.|||+++++.| .+|.+|++|++
T Consensus 3 c~~~e~~aLl~~k~~~~-~~-~~l~sW~~~~d~C~~~w~gv~C~~~---~~~~~v~~L~L~~~~l~g~~~lp~~l~~L~~ 77 (313)
T d1ogqa_ 3 CNPQDKQALLQIKKDLG-NP-TTLSSWLPTTDCCNRTWLGVLCDTD---TQTYRVNNLDLSGLNLPKPYPIPSSLANLPY 77 (313)
T ss_dssp SCHHHHHHHHHHHHHTT-CC-GGGTTCCTTSCTTTTCSTTEEECCS---SSCCCEEEEEEECCCCSSCEECCGGGGGCTT
T ss_pred CCHHHHHHHHHHHHHCC-CC-CcCCCCCCCCCCCCCcCCCeEEeCC---CCcEEEEEEECCCCCCCCCCCCChHHhcCcc
Confidence 45677888888888764 33 3467785 679995 999999752 334689999999999988 47899999999
Q ss_pred CCEEEcCC-CCCCccCCccccCCCCCCEEeCcCCcCCCcCchhccCCCCCcEEeccCCcCCCCCchhhcC-CCCCeEEcc
Q 041736 148 IALFHVNT-NRFCGTLPRSFNKLKLLFELDLSNNRFAGKFPYVVLGLPKLKFLDLRYNEFEGKIPKALFD-KDLDAVFIN 225 (500)
Q Consensus 148 L~~L~L~~-n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~~p~~~~~-~~L~~L~l~ 225 (500)
|++|+|++ |.++|.+|.+|++|++|++|+|++|++.+..+..+..+.+|+++++++|.+.+.+|..+.. ..|++++++
T Consensus 78 L~~L~Ls~~N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~~~~~~~~L~~l~l~~N~~~~~~p~~l~~l~~L~~l~l~ 157 (313)
T d1ogqa_ 78 LNFLYIGGINNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPDFLSQIKTLVTLDFSYNALSGTLPPSISSLPNLVGITFD 157 (313)
T ss_dssp CSEEEEEEETTEESCCCGGGGGCTTCSEEEEEEECCEEECCGGGGGCTTCCEEECCSSEEESCCCGGGGGCTTCCEEECC
T ss_pred ccccccccccccccccccccccccccchhhhccccccccccccccchhhhcccccccccccccCchhhccCcccceeecc
Confidence 99999997 8999999999999999999999999999999999999999999999999999999888776 899999999
Q ss_pred CCCccCCCCCccCC-CC-cceEEeccccccccCchhhhcccccCcEEEeccCCCCCCCccccccCCCccEEeccCcccCC
Q 041736 226 NNRFSFELPDNIGN-SP-VSVLVLANNKFHGCLPLSFGNMSRTLNEVILTNNGLHSCLPEEIGLLKNVTVFDVSYNKLMG 303 (500)
Q Consensus 226 ~n~l~~~~p~~~~~-~~-L~~L~l~~n~l~~~~p~~l~~l~~~L~~L~Ls~n~l~~~~p~~~~~l~~L~~L~Ls~n~l~~ 303 (500)
+|.+.+.+|..+.. .. ++.+++++|++++..+..+..+. +.+++++++.+.+.++..+..+++|+.|++++|.+++
T Consensus 158 ~n~l~~~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l~--~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~ 235 (313)
T d1ogqa_ 158 GNRISGAIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANLN--LAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAF 235 (313)
T ss_dssp SSCCEEECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGCC--CSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECC
T ss_pred ccccccccccccccccccccccccccccccccccccccccc--ccccccccccccccccccccccccccccccccccccc
Confidence 99999999987765 33 58899999999999999998875 5689999999999999999999999999999999998
Q ss_pred CChhhhhCCCCCcEEEcccCCCCCCCchhhcCCCCCcEEEccCCcCccCCCCCc---cCCEEEcCCCC
Q 041736 304 ELPDTIAEMTSLQQLNVAHNMLSGTVPDSVCSLPNLRNFSFDYNFFTGESPVCL---DLQGFDDKRNC 368 (500)
Q Consensus 304 ~~p~~l~~l~~L~~L~L~~N~l~g~ip~~l~~l~~L~~L~Ls~N~l~g~~p~~~---~L~~l~l~~N~ 368 (500)
.++ .++.+++|++|+|++|+++|.+|.++.++++|++|+|++|+|+|.+|... .|+.+++++|.
T Consensus 236 ~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~~L~~L~Ls~N~l~g~iP~~~~L~~L~~l~l~~N~ 302 (313)
T d1ogqa_ 236 DLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLKFLHSLNVSFNNLCGEIPQGGNLQRFDVSAYANNK 302 (313)
T ss_dssp BGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCTTCCEEECCSSEEEEECCCSTTGGGSCGGGTCSSS
T ss_pred ccc-ccccccccccccCccCeecccCChHHhCCCCCCEEECcCCcccccCCCcccCCCCCHHHhCCCc
Confidence 765 68889999999999999999999999999999999999999999999754 46666666664
|
| >d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} | Back information, alignment and structure |
|---|
| >d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} | Back information, alignment and structure |
|---|
| >d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|
| >d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} | Back information, alignment and structure |
|---|