Citrus Sinensis ID: 041782


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770-------780-------790-------800-------810-------820-
MGLSFCFLTAFSLLLFHITNAHLASPLHQLCHAGERSALLQFKESLTINKEASAHRSAHAKFASWNLEEEDRDCCSWDGVKCNEDTGHVIKLNLTSSCIYGSINSSSSLFHLRHLEWLSLADNNFNYSKIPSEIMNLSSFSGQVPSLGNLTKLKCLELSQNNFSSPHSASFSWIAKQTELSWLALANINLIGEFPSWLMNLTQLTYINFDLNQLTGPIPNWLANLNRLTILSLKSNQLRGYLPSQIGSLTQLTALDLSCNQFQGPVPSSISELKRLEYLDLHSNNLSGNVYIEELLPKLKSLIVLFLSANNLSLITRNTVNIRLQNKFVFLGLASCNLKEFLDFLNDQDQLELLDLSANKIPGKIPGWLLNVTTGNLQFVNLSYNLITGFDRGSVVLLWTDLVTLDLRSNKLQGPLPIPPESTIHYLVSNNLLTGKLAPWLCNLNSLRVLDLSHNFLSGVLPQCLSNSKIFKNATNLKMIDLSHNLLQGRIPRSLANCTMLEFLDLGNNQIADIFPSWLGTLPELKVLMLQFNRFHGEIGEPDTGFVFPKLRIIDLSHNRFSGKLPSKYFQCWNAIKVANKSQLKYMQDQPGQSLNYILPSSSAYIFDYSLQYIYAYSITMVNKGIEMNYGKVSNFLTGIILSNNKLIGKIPTSISELKGLNCLNLSGNNLLGHIPSSLGNLTVLESLDLSNNNLSGEIPRQLAELTSLAVFDVSDNNLTGQIPQGKQFNTFENSSFEGNPGLCGKPLSRNCEISESSQKEDQDSETPFEFGWKIVLTGYASGLIVGVVIGQTFTTRINAWFAKTLGMRVQGRRRKRGRRN
ccHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccEEEccccccEEEEEccccccCECccccccccccccccEEEcccccccccccccccccccccccccccccccccccEEEccccccccccccccccccccccccEEEEEcccccccccHHHHccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccCEECcccccccccccccEEEccccccCEECcccccccccccccEEEccccccccccHHHcccccccEEEcccccccccccHHHHccccccccEEEccccccccccccccccccccccEEEccccccccccccccccccEEEcccccccccccHHHcccccccEEEccccccCCcccccccccccccccccccEEEccccCEEECccHHHcccccccEEEcccccccccccccccccccccEEEccccccCECccccccccccccccEEEcccccccccccHHHHHcHHHHHHccccccccccccccccccccccccccccccccccEEEEEEEEEEEcccEEEEcccccccEEEEcccccccccccHHHHccccccccccccccccccccccHHccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEEEEEEEEEEEEEHHHHHHHccHHHHHHHHHcccccEEEccccccc
**LSFCFLTAFSLLLFHITNAHLASPLHQLCHAGERSALLQFKESLTINKEASAHRSAHAKFASWNLEEEDRDCCSWDGVKCNEDTGHVIKLNLTSSCIYGSINSSSSLFHLRHLEWLSLADNNFNYSKIPSEIMNLSSFSGQVPSLGNLTKLKCLELSQNNFSSPHSASFSWIAKQTELSWLALANINLIGEFPSWLMNLTQLTYINFDLNQLTGPIPNWLANLNRLTILSLKSNQLRGYLPSQIGSLTQLTALDLSCNQFQGPVPSSISELKRLEYLDLHSNNLSGNVYIEELLPKLKSLIVLFLSANNLSLITRNTVNIRLQNKFVFLGLASCNLKEFLDFLNDQDQLELLDLSANKIPGKIPGWLLNVTTGNLQFVNLSYNLITGFDRGSVVLLWTDLVTLDLRSNKLQGPLPIPPESTIHYLVSNNLLTGKLAPWLCNLNSLRVLDLSHNFLSGVLPQCLSNSKIFKNATNLKMIDLSHNLLQGRIPRSLANCTMLEFLDLGNNQIADIFPSWLGTLPELKVLMLQFNRFHGEIGEPDTGFVFPKLRIIDLSHNRFSGKLPSKYFQCWNAIKVANKSQLKYMQDQPGQSLNYILPSSSAYIFDYSLQYIYAYSITMVNKGIEMNYGKVSNFLTGIILSNNKLIGKIPTSISELKGLNCLNLSGNNLLGHIPSSLGNLTVLESLDLSNNNLSGEIPRQLAELTSLAVFDVSDNNLTGQIPQGKQFNTFENSSFEGNPGLCGK**********************FEFGWKIVLTGYASGLIVGVVIGQTFTTRINAWFAKTLGMRVQ**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLSFCFLTAFSLLLFHITNAHLASPLHQLCHAGERSALLQFKESLTINKEASAHRSAHAKFASWNLEEEDRDCCSWDGVKCNEDTGHVIKLNLTSSCIYGSINSSSSLFHLRHLEWLSLADNNFNYSKIPSEIMNLSSFSGQVPSLGNLTKLKCLELSQNNFSSPHSASFSWIAKQTELSWLALANINLIGEFPSWLMNLTQLTYINFDLNQLTGPIPNWLANLNRLTILSLKSNQLRGYLPSQIGSLTQLTALDLSCNQFQGPVPSSISELKRLEYLDLHSNNLSGNVYIEELLPKLKSLIVLFLSANNLSLITRNTVNIRLQNKFVFLGLASCNLKEFLDFLNDQDQLELLDLSANKIPGKIPGWLLNVTTGNLQFVNLSYNLITGFDRGSVVLLWTDLVTLDLRSNKLQGPLPIPPESTIHYLVSNNLLTGKLAPWLCNLNSLRVLDLSHNFLSGVLPQCLSNSKIFKNATNLKMIDLSHNLLQGRIPRSLANCTMLEFLDLGNNQIADIFPSWLGTLPELKVLMLQFNRFHGEIGEPDTGFVFPKLRIIDLSHNRFSGKLPSKYFQCWNAIKVANKSQLKYMQDQPGQSLNYILPSSSAYIFDYSLQYIYAYSITMVNKGIEMNYGKVSNFLTGIILSNNKLIGKIPTSISELKGLNCLNLSGNNLLGHIPSSLGNLTVLESLDLSNNNLSGEIPRQLAELTSLAVFDVSDNNLTGQIPQGKQFNTFENSSFEGNPGLCGKPLSRNCEISESSQKEDQDSETPFEFGWKIVLTGYASGLIVGVVIGQTFTTRINAWFAKTLGMRVQGRRRKRGRRN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 147-310
View the alignment between query and template
View the model in PyMOL
Template: 4EZG, chain A
Confidence level:very confident
Coverage over the Query: 109-133,147-284
View the alignment between query and template
View the model in PyMOL
Template: 3ZYJ, chain A
Confidence level:very confident
Coverage over the Query: 424-572,634-748
View the alignment between query and template
View the model in PyMOL
Template: 3ZYJ, chain A
Confidence level:very confident
Coverage over the Query: 404-571,633-724
View the alignment between query and template
View the model in PyMOL
Template: 1H6U, chain A
Confidence level:very confident
Coverage over the Query: 108-127,144-314,341-362
View the alignment between query and template
View the model in PyMOL
Template: 2ID5, chain A
Confidence level:very confident
Coverage over the Query: 327-414,436-572,634-747
View the alignment between query and template
View the model in PyMOL
Template: 2Z66, chain A
Confidence level:very confident
Coverage over the Query: 74-85,98-134,147-318,344-389
View the alignment between query and template
View the model in PyMOL
Template: 3J0A, chain A
Confidence level:very confident
Coverage over the Query: 75-133,147-315,333-460,472-571,629-757
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 30-50,61-133,147-313
View the alignment between query and template
View the model in PyMOL
Template: 1ZIW, chain A
Confidence level:very confident
Coverage over the Query: 87-134,147-591,628-700
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 30-313,340-388,436-571,632-721
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 31-50,61-755
View the alignment between query and template
View the model in PyMOL