Citrus Sinensis ID: 041835
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
Close Homologs for Annotation Transfer
Close Homologs in the Non-Redundant Database Detected by BLAST 
Original result of BLAST against Nonredundant Database
GI ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| 224119134 | 518 | cytochrome P450 [Populus trichocarpa] gi | 0.983 | 0.227 | 0.627 | 1e-42 | |
| 224113639 | 144 | predicted protein [Populus trichocarpa] | 0.983 | 0.819 | 0.627 | 2e-42 | |
| 164604828 | 518 | cytochrome P450 [Coptis japonica var. di | 1.0 | 0.231 | 0.641 | 2e-42 | |
| 224113631 | 142 | cytochrome P450 [Populus trichocarpa] gi | 0.983 | 0.830 | 0.627 | 2e-42 | |
| 224093417 | 353 | cytochrome P450 [Populus trichocarpa] gi | 0.983 | 0.334 | 0.627 | 2e-42 | |
| 297830010 | 512 | CYP72A7 [Arabidopsis lyrata subsp. lyrat | 0.983 | 0.230 | 0.644 | 2e-42 | |
| 15231906 | 512 | cytochrome P450, family 72, subfamily A, | 0.983 | 0.230 | 0.618 | 3e-42 | |
| 224119138 | 410 | predicted protein [Populus trichocarpa] | 0.983 | 0.287 | 0.627 | 3e-42 | |
| 224105979 | 518 | cytochrome P450 [Populus trichocarpa] gi | 0.983 | 0.227 | 0.627 | 3e-42 | |
| 224119122 | 125 | cytochrome P450 [Populus trichocarpa] gi | 0.983 | 0.944 | 0.627 | 8e-42 |
| >gi|224119134|ref|XP_002331333.1| cytochrome P450 [Populus trichocarpa] gi|222873916|gb|EEF11047.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Score = 176 bits (446), Expect = 1e-42, Method: Compositional matrix adjust.
Identities = 74/118 (62%), Positives = 101/118 (85%)
Query: 3 KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
+EIKLG ++P GV +SLPII +H+DHE WGDDA +F P+RF+EG+SKA+K+Q+SF FG
Sbjct: 401 EEIKLGNLLLPAGVQVSLPIILLHQDHELWGDDASEFKPERFAEGISKATKSQVSFLPFG 460
Query: 63 WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI 120
WGPRIC+GQNFAL+EAK+ALAM+L +++F+LSP+Y+HAP I++ PQHGA +IL K+
Sbjct: 461 WGPRICVGQNFALIEAKMALAMVLQRYSFELSPSYIHAPRTVITLQPQHGAPMILRKL 518
|
Source: Populus trichocarpa Species: Populus trichocarpa Genus: Populus Family: Salicaceae Order: Malpighiales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|224113639|ref|XP_002332523.1| predicted protein [Populus trichocarpa] gi|222832635|gb|EEE71112.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|164604828|dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] | Back alignment and taxonomy information |
|---|
| >gi|224113631|ref|XP_002332521.1| cytochrome P450 [Populus trichocarpa] gi|222832633|gb|EEE71110.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224093417|ref|XP_002334834.1| cytochrome P450 [Populus trichocarpa] gi|222875161|gb|EEF12292.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|297830010|ref|XP_002882887.1| CYP72A7 [Arabidopsis lyrata subsp. lyrata] gi|297328727|gb|EFH59146.1| CYP72A7 [Arabidopsis lyrata subsp. lyrata] | Back alignment and taxonomy information |
|---|
| >gi|15231906|ref|NP_188086.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis thaliana] gi|13605897|gb|AAK32934.1|AF367347_1 AT3g14680/MIE1_18 [Arabidopsis thaliana] gi|9294390|dbj|BAB02400.1| cytochrome P450 [Arabidopsis thaliana] gi|24111277|gb|AAN46762.1| At3g14680/MIE1_18 [Arabidopsis thaliana] gi|332642034|gb|AEE75555.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis thaliana] | Back alignment and taxonomy information |
|---|
| >gi|224119138|ref|XP_002331334.1| predicted protein [Populus trichocarpa] gi|222873917|gb|EEF11048.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224105979|ref|XP_002333744.1| cytochrome P450 [Populus trichocarpa] gi|222838385|gb|EEE76750.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|224119122|ref|XP_002331330.1| cytochrome P450 [Populus trichocarpa] gi|222873913|gb|EEF11044.1| cytochrome P450 [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST 
Original result of BLAST against Gene Ontology (AMIGO)
ID ![]() |
Alignment graph ![]() |
Length ![]() |
Definition ![]() |
Q cover ![]() |
H cover ![]() |
Identity ![]() |
E-value ![]() |
| Query | 120 | ||||||
| TAIR|locus:2089621 | 512 | CYP72A14 ""cytochrome P450, fa | 0.983 | 0.230 | 0.618 | 5.3e-40 | |
| TAIR|locus:2089521 | 512 | CYP72A15 ""cytochrome P450, fa | 0.983 | 0.230 | 0.618 | 1.1e-39 | |
| TAIR|locus:2089526 | 512 | CYP72A7 ""cytochrome P450, fam | 0.983 | 0.230 | 0.635 | 1.4e-39 | |
| TAIR|locus:2089546 | 508 | CYP72A9 ""cytochrome P450, fam | 0.983 | 0.232 | 0.593 | 1.4e-39 | |
| TAIR|locus:2089596 | 512 | CYP72A13 ""cytochrome P450, fa | 0.983 | 0.230 | 0.618 | 2.9e-39 | |
| TAIR|locus:2089561 | 514 | CYP72A10 ""cytochrome P450, fa | 0.983 | 0.229 | 0.601 | 5.5e-38 | |
| TAIR|locus:2089586 | 512 | CYP72A11 ""cytochrome P450, fa | 0.983 | 0.230 | 0.601 | 7e-38 | |
| TAIR|locus:2089531 | 515 | CYP72A8 ""cytochrome P450, fam | 0.983 | 0.229 | 0.554 | 1.5e-35 | |
| TAIR|locus:2043823 | 520 | BAS1 "PHYB ACTIVATION TAGGED S | 0.975 | 0.225 | 0.521 | 3.5e-30 | |
| TAIR|locus:2149423 | 525 | CYP714A2 "cytochrome P450, fam | 0.941 | 0.215 | 0.495 | 2e-27 |
| TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 426 (155.0 bits), Expect = 5.3e-40, P = 5.3e-40
Identities = 73/118 (61%), Positives = 100/118 (84%)
Query: 3 KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
KE+KLG+ +P GV +SLP++ VHRD E WG+DA +F P+RF +G+SKA+KNQ+SFF F
Sbjct: 395 KEMKLGDLTLPGGVQISLPVLLVHRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFA 454
Query: 63 WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI 120
WGPRICIGQNF LLEAK+A+++IL +F+F+LSP+YVHAP I++YPQ GA+++LHK+
Sbjct: 455 WGPRICIGQNFTLLEAKMAMSLILQRFSFELSPSYVHAPYTIITLYPQFGAHLMLHKL 512
|
|
| TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2149423 CYP714A2 "cytochrome P450, family 714, subfamily A, polypeptide 2" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Ezypred Server 
Original result from Ezypred Server
Fail to connect to Ezypred Server
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING 
Original result from the STRING server
| CYP72A42v3 | cytochrome P450 (353 aa) | ||||||||||
(Populus trichocarpa) | |||||||||||
| gw1.4331.5.1 | • | 0.491 | |||||||||
| CYP728D10P | • | 0.421 |
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against CDD database part I
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| PLN02290 | 516 | PLN02290, PLN02290, cytokinin trans-hydroxylase | 8e-33 | |
| pfam00067 | 461 | pfam00067, p450, Cytochrome P450 | 2e-22 | |
| COG2124 | 411 | COG2124, CypX, Cytochrome P450 [Secondary metaboli | 7e-19 | |
| PLN02738 | 633 | PLN02738, PLN02738, carotene beta-ring hydroxylase | 5e-16 | |
| PLN02936 | 489 | PLN02936, PLN02936, epsilon-ring hydroxylase | 3e-14 | |
| PLN03195 | 516 | PLN03195, PLN03195, fatty acid omega-hydroxylase; | 5e-11 | |
| PTZ00404 | 482 | PTZ00404, PTZ00404, cytochrome P450; Provisional | 3e-10 | |
| PLN02169 | 500 | PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla | 3e-08 | |
| PLN02966 | 502 | PLN02966, PLN02966, cytochrome P450 83A1 | 3e-08 | |
| PLN02183 | 516 | PLN02183, PLN02183, ferulate 5-hydroxylase | 6e-08 | |
| PLN00110 | 504 | PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F | 1e-07 | |
| PLN00168 | 519 | PLN00168, PLN00168, Cytochrome P450; Provisional | 2e-07 | |
| PLN02987 | 472 | PLN02987, PLN02987, Cytochrome P450, family 90, su | 3e-07 | |
| PLN02687 | 517 | PLN02687, PLN02687, flavonoid 3'-monooxygenase | 3e-07 | |
| PLN02302 | 490 | PLN02302, PLN02302, ent-kaurenoic acid oxidase | 4e-07 | |
| PLN03234 | 499 | PLN03234, PLN03234, cytochrome P450 83B1; Provisio | 4e-07 | |
| PLN03141 | 452 | PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m | 5e-07 | |
| PLN02426 | 502 | PLN02426, PLN02426, cytochrome P450, family 94, su | 1e-06 | |
| PLN02394 | 503 | PLN02394, PLN02394, trans-cinnamate 4-monooxygenas | 6e-06 | |
| PLN02500 | 490 | PLN02500, PLN02500, cytochrome P450 90B1 | 8e-06 | |
| PLN02655 | 466 | PLN02655, PLN02655, ent-kaurene oxidase | 7e-05 | |
| PLN03018 | 534 | PLN03018, PLN03018, homomethionine N-hydroxylase | 0.002 |
| >gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
Score = 119 bits (299), Expect = 8e-33
Identities = 51/116 (43%), Positives = 75/116 (64%), Gaps = 3/116 (2%)
Query: 2 FKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSF 61
F++IKLG+ IP G+ + +P++ +H E WG DA +FNPDRF+ G A F F
Sbjct: 399 FEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPDRFA-GRPFAPGRH--FIPF 455
Query: 62 GWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIIL 117
GPR CIGQ FA++EAK+ LAM++ KF+F +S Y HAP +++ P++G + L
Sbjct: 456 AAGPRNCIGQAFAMMEAKIILAMLISKFSFTISDNYRHAPVVVLTIKPKYGVQVCL 511
|
Length = 516 |
| >gnl|CDD|215689 pfam00067, p450, Cytochrome P450 | Back alignment and domain information |
|---|
| >gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase | Back alignment and domain information |
|---|
| >gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch 
Original result of HHsearch against CDD database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| KOG0157 | 497 | consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami | 100.0 | |
| PLN02169 | 500 | fatty acid (omega-1)-hydroxylase/midchain alkane h | 99.98 | |
| KOG0158 | 499 | consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf | 99.98 | |
| PLN02290 | 516 | cytokinin trans-hydroxylase | 99.97 | |
| PLN03195 | 516 | fatty acid omega-hydroxylase; Provisional | 99.97 | |
| PLN02500 | 490 | cytochrome P450 90B1 | 99.97 | |
| PLN02426 | 502 | cytochrome P450, family 94, subfamily C protein | 99.97 | |
| PLN00168 | 519 | Cytochrome P450; Provisional | 99.97 | |
| PLN02774 | 463 | brassinosteroid-6-oxidase | 99.97 | |
| PF00067 | 463 | p450: Cytochrome P450 p450 superfamily signature b | 99.97 | |
| PLN02738 | 633 | carotene beta-ring hydroxylase | 99.97 | |
| PLN03141 | 452 | 3-epi-6-deoxocathasterone 23-monooxygenase; Provis | 99.97 | |
| PLN00110 | 504 | flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | 99.97 | |
| PLN03234 | 499 | cytochrome P450 83B1; Provisional | 99.97 | |
| PTZ00404 | 482 | cytochrome P450; Provisional | 99.97 | |
| KOG0156 | 489 | consensus Cytochrome P450 CYP2 subfamily [Secondar | 99.97 | |
| KOG0159 | 519 | consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 | 99.97 | |
| PLN02966 | 502 | cytochrome P450 83A1 | 99.97 | |
| PLN02394 | 503 | trans-cinnamate 4-monooxygenase | 99.97 | |
| PLN02655 | 466 | ent-kaurene oxidase | 99.97 | |
| PLN02987 | 472 | Cytochrome P450, family 90, subfamily A | 99.97 | |
| PLN02183 | 516 | ferulate 5-hydroxylase | 99.96 | |
| PLN02302 | 490 | ent-kaurenoic acid oxidase | 99.96 | |
| PLN03018 | 534 | homomethionine N-hydroxylase | 99.96 | |
| PLN02936 | 489 | epsilon-ring hydroxylase | 99.96 | |
| PLN02971 | 543 | tryptophan N-hydroxylase | 99.96 | |
| PLN02687 | 517 | flavonoid 3'-monooxygenase | 99.96 | |
| PLN02196 | 463 | abscisic acid 8'-hydroxylase | 99.96 | |
| PLN03112 | 514 | cytochrome P450 family protein; Provisional | 99.96 | |
| KOG0684 | 486 | consensus Cytochrome P450 [Secondary metabolites b | 99.94 | |
| COG2124 | 411 | CypX Cytochrome P450 [Secondary metabolites biosyn | 99.94 | |
| PLN02648 | 480 | allene oxide synthase | 99.89 | |
| PF12508 | 200 | DUF3714: Protein of unknown function (DUF3714) ; I | 81.75 |
| >KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] | Back alignment and domain information |
|---|
Probab=100.00 E-value=7.9e-33 Score=208.34 Aligned_cols=120 Identities=37% Similarity=0.721 Sum_probs=108.8
Q ss_pred CccceEe-cCEEeCCCCEEEechhhhhcCCCCcCCCCCCeecCCCCCCcccccCCCcceeeecCCCCcChhHHHHHHHHH
Q 041835 1 NFKEIKL-GEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAK 79 (120)
Q Consensus 1 a~~d~~l-~g~~ip~gt~v~~~~~~~~~d~~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~ 79 (120)
+++|++| +||.||||+.|++++|++|||+++|++||++|+|+||+++......+++.|+|||+|+|.|+|++||++||+
T Consensus 375 ~~~d~~l~~g~~IPkG~~V~i~~~~~~r~~~~~~~dp~~F~PeRf~~~~~~~~~~~~~fipFsaGpR~CiG~~fA~lemK 454 (497)
T KOG0157|consen 375 ATKDVKLPGGYTIPKGTNVLISIYALHRDPRVWGEDPEEFDPERFLDGEEKAKRHPFAFIPFSAGPRNCIGQKFAMLEMK 454 (497)
T ss_pred cCCCeEcCCCcEeCCCCEEEEehHHhccCccccCCChhhcCccccCCCCCcCCCCCccccCCCCCcccchhHHHHHHHHH
Confidence 5789999 589999999999999999999999977999999999997654434567899999999999999999999999
Q ss_pred HHHHHHhhhceeEeCCCCccCCccceEEeeCCCceEEEEEC
Q 041835 80 LALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI 120 (120)
Q Consensus 80 ~~l~~ll~~f~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~r 120 (120)
++++.++++|++++..+....+....+++|.+|++|++++|
T Consensus 455 v~l~~ll~~f~~~~~~~~~~~~~~~~~l~~~~gl~v~~~~r 495 (497)
T KOG0157|consen 455 VVLAHLLRRFRIEPVGGDKPKPVPELTLRPKNGLKVKLRPR 495 (497)
T ss_pred HHHHHHHHheEEEecCCCCceeeeEEEEEecCCeEEEEEeC
Confidence 99999999999998877555667789999999999999987
|
|
| >PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase | Back alignment and domain information |
|---|
| >KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02290 cytokinin trans-hydroxylase | Back alignment and domain information |
|---|
| >PLN03195 fatty acid omega-hydroxylase; Provisional | Back alignment and domain information |
|---|
| >PLN02500 cytochrome P450 90B1 | Back alignment and domain information |
|---|
| >PLN02426 cytochrome P450, family 94, subfamily C protein | Back alignment and domain information |
|---|
| >PLN00168 Cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >PLN02774 brassinosteroid-6-oxidase | Back alignment and domain information |
|---|
| >PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry | Back alignment and domain information |
|---|
| >PLN02738 carotene beta-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional | Back alignment and domain information |
|---|
| >PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional | Back alignment and domain information |
|---|
| >PLN03234 cytochrome P450 83B1; Provisional | Back alignment and domain information |
|---|
| >PTZ00404 cytochrome P450; Provisional | Back alignment and domain information |
|---|
| >KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >PLN02966 cytochrome P450 83A1 | Back alignment and domain information |
|---|
| >PLN02394 trans-cinnamate 4-monooxygenase | Back alignment and domain information |
|---|
| >PLN02655 ent-kaurene oxidase | Back alignment and domain information |
|---|
| >PLN02987 Cytochrome P450, family 90, subfamily A | Back alignment and domain information |
|---|
| >PLN02183 ferulate 5-hydroxylase | Back alignment and domain information |
|---|
| >PLN02302 ent-kaurenoic acid oxidase | Back alignment and domain information |
|---|
| >PLN03018 homomethionine N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02936 epsilon-ring hydroxylase | Back alignment and domain information |
|---|
| >PLN02971 tryptophan N-hydroxylase | Back alignment and domain information |
|---|
| >PLN02687 flavonoid 3'-monooxygenase | Back alignment and domain information |
|---|
| >PLN02196 abscisic acid 8'-hydroxylase | Back alignment and domain information |
|---|
| >PLN03112 cytochrome P450 family protein; Provisional | Back alignment and domain information |
|---|
| >KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] | Back alignment and domain information |
|---|
| >COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] | Back alignment and domain information |
|---|
| >PLN02648 allene oxide synthase | Back alignment and domain information |
|---|
| >PF12508 DUF3714: Protein of unknown function (DUF3714) ; InterPro: IPR022187 Proteins in this entry are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST 
Original result of BLAST against Protein Data Bank
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() | |
| Query | 120 | ||||
| 3qi8_B | 472 | Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) | 1e-13 | ||
| 4duf_A | 471 | Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto | 1e-13 | ||
| 4dud_A | 471 | Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le | 1e-13 | ||
| 3ekb_A | 470 | Crystal Structure Of The A264c Mutant Heme Domain O | 1e-13 | ||
| 1yqo_A | 455 | T268a Mutant Heme Domain Of Flavocytochrome P450 Bm | 1e-13 | ||
| 1smi_A | 471 | A Single Mutation Of P450 Bm3 Induces The Conformat | 1e-13 | ||
| 1yqp_A | 455 | T268n Mutant Cytochrome Domain Of Flavocytochrome P | 1e-13 | ||
| 1jpz_A | 473 | Crystal Structure Of A Complex Of The Heme Domain O | 1e-13 | ||
| 1zoa_A | 473 | Crystal Structure Of A328v Mutant Of The Heme Domai | 1e-13 | ||
| 2bmh_A | 455 | Modeling Protein-Substrate Interactions In The Heme | 1e-13 | ||
| 4duc_A | 472 | Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng | 1e-13 | ||
| 3kx5_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 1e-13 | ||
| 1bvy_A | 458 | Complex Of The Heme And Fmn-Binding Domains Of The | 1e-13 | ||
| 3dgi_A | 461 | Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le | 1e-13 | ||
| 4du2_B | 470 | Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin | 1e-13 | ||
| 2x7y_A | 455 | P450 Bm3 F87a In Complex With Dmso Length = 455 | 1e-13 | ||
| 1zo4_A | 473 | Crystal Structure Of A328s Mutant Of The Heme Domai | 1e-13 | ||
| 2hpd_A | 471 | Crystal Structure Of Hemoprotein Domain Of P450bm-3 | 1e-13 | ||
| 1fah_A | 471 | Structure Of Cytochrome P450 Length = 471 | 1e-13 | ||
| 3kx3_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 1e-13 | ||
| 3ekf_A | 470 | Crystal Structure Of The A264q Heme Domain Of Cytoc | 1e-13 | ||
| 3ekd_A | 470 | Crystal Structure Of The A264m Heme Domain Of Cytoc | 1e-13 | ||
| 3ben_A | 470 | Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine | 1e-13 | ||
| 2ij2_A | 470 | Atomic Structure Of The Heme Domain Of Flavocytochr | 1e-13 | ||
| 2ij4_A | 470 | Structure Of The A264k Mutant Of Cytochrome P450 Bm | 1e-13 | ||
| 4dub_A | 472 | Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami | 1e-13 | ||
| 2uwh_A | 458 | Cytochrome P450 Bm3 Mutant In Complex With Palmitic | 1e-13 | ||
| 4dua_A | 471 | Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng | 1e-13 | ||
| 3m4v_A | 482 | Crystal Structure Of The A330p Mutant Of Cytochrome | 1e-13 | ||
| 3npl_A | 470 | Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D | 1e-13 | ||
| 2ij3_A | 470 | Structure Of The A264h Mutant Of Cytochrome P450 Bm | 1e-13 | ||
| 4dtw_B | 469 | Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto | 2e-13 | ||
| 3psx_A | 487 | Crystal Structure Of The Kt2 Mutant Of Cytochrome P | 3e-13 | ||
| 3cbd_A | 455 | Directed Evolution Of Cytochrome P450 Bm3, To Octan | 3e-13 | ||
| 1p0x_A | 455 | F393y Mutant Heme Domain Of Flavocytochrome P450 Bm | 3e-13 | ||
| 3ua1_A | 487 | Crystal Structure Of The Cytochrome P4503a4-Bromoer | 3e-13 | ||
| 1tqn_A | 486 | Crystal Structure Of Human Microsomal P450 3a4 Leng | 3e-13 | ||
| 1w0e_A | 485 | Crystal Structure Of Human Cytochrome P450 3a4 Leng | 3e-13 | ||
| 2nnb_A | 471 | The Q403k Mutnat Heme Domain Of Flavocytochrome P45 | 4e-13 | ||
| 1p0w_A | 455 | F393w Mutant Heme Domain Of Flavocytochrome P450 Bm | 6e-13 | ||
| 3hf2_A | 482 | Crystal Structure Of The I401p Mutant Of Cytochrome | 1e-12 | ||
| 1jme_A | 455 | Crystal Structure Of Phe393his Cytochrome P450 Bm3 | 1e-12 | ||
| 3kx4_A | 470 | Crystal Structure Of Bacillus Megaterium Bm3 Heme D | 1e-12 | ||
| 1p0v_A | 455 | F393a Mutant Heme Domain Of Flavocytochrome P450 Bm | 1e-12 | ||
| 2q9f_A | 456 | Crystal Structure Of Human Cytochrome P450 46a1 In | 6e-10 | ||
| 3l4d_A | 453 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 6e-09 | ||
| 2wuz_A | 473 | X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In | 8e-09 | ||
| 3k1o_A | 458 | Crystal Structure Of Sterol 14-alpha Demethylase (c | 8e-09 | ||
| 3khm_A | 464 | Crystal Structure Of Sterol 14alpha-Demethylase (Cy | 8e-09 | ||
| 3tik_A | 454 | Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom | 2e-08 | ||
| 3p99_A | 453 | Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma | 2e-08 | ||
| 2wv2_A | 475 | X-Ray Structure Of Cyp51 From The Human Pathogen Tr | 2e-08 | ||
| 2x2n_A | 475 | X-Ray Structure Of Cyp51 From Trypanosoma Brucei In | 2e-08 | ||
| 3gw9_A | 450 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 2e-08 | ||
| 3g1q_A | 450 | Crystal Structure Of Sterol 14-Alpha Demethylase (C | 2e-08 | ||
| 1n97_A | 389 | Crystal Stucture Of Cyp175a1 From Thermus Thermophi | 6e-08 | ||
| 3k9v_A | 482 | Crystal Structure Of Rat Mitochondrial P450 24a1 S5 | 1e-07 | ||
| 2ve3_A | 444 | Retinoic Acid Bound Cyanobacterial Cyp120a1 Length | 1e-06 | ||
| 3qz1_A | 496 | Crystal Structure Of Bovine Steroid Of 21-Hydroxyla | 1e-06 | ||
| 3ld6_A | 461 | Crystal Structure Of Human Lanosterol 14alpha-Demet | 3e-06 | ||
| 3mzs_A | 486 | Crystal Structure Of Cytochrome P450 Cyp11a1 In Com | 4e-06 | ||
| 3c6g_A | 479 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 6e-06 | ||
| 3czh_A | 481 | Crystal Structure Of Cyp2r1 In Complex With Vitamin | 7e-06 | ||
| 1wiy_A | 389 | Crystal Structure Analysis Of A 6-Coordinated Cytoc | 1e-05 | ||
| 1io8_A | 368 | Thermophilic Cytochrome P450 (Cyp119) From Sulfolob | 2e-05 | ||
| 3ruk_A | 494 | Human Cytochrome P450 Cyp17a1 In Complex With Abira | 2e-05 | ||
| 1f4t_A | 368 | Thermophilic P450: Cyp119 From Sulfolobus Solfactar | 3e-05 | ||
| 2hi4_A | 495 | Crystal Structure Of Human Microsomal P450 1a2 In C | 4e-05 | ||
| 3r9c_A | 418 | Crystal Structure Of Mycobacterium Smegmatis Cyp164 | 8e-05 | ||
| 3na0_A | 471 | Crystal Structure Of Human Cyp11a1 In Complex With | 1e-04 | ||
| 3n9y_A | 487 | Crystal Structure Of Human Cyp11a1 In Complex With | 1e-04 | ||
| 2vrv_A | 431 | Structure Of Histidine Tagged Cytochrome P450 Eryk | 1e-04 | ||
| 2jjn_A | 411 | Structure Of Closed Cytochrome P450 Eryk Length = 4 | 1e-04 | ||
| 2p85_A | 476 | Structure Of Human Lung Cytochrome P450 2a13 With I | 2e-04 | ||
| 1og2_A | 475 | Structure Of Human Cytochrome P450 Cyp2c9 Length = | 3e-04 | ||
| 1r9o_A | 477 | Crystal Structure Of P4502c9 With Flurbiprofen Boun | 3e-04 | ||
| 4gqs_A | 477 | Structure Of Human Microsomal Cytochrome P450 (cyp) | 4e-04 | ||
| 1dt6_A | 473 | Structure Of Mammalian Cytochrome P450 2c5 Length = | 5e-04 | ||
| 1gwi_A | 411 | The 1.92 A Structure Of Streptomyces Coelicolor A3( | 6e-04 | ||
| 3dbg_A | 467 | Crystal Structure Of Cytochrome P450 170a1 (Cyp170a | 7e-04 | ||
| 2f9q_A | 479 | Crystal Structure Of Human Cytochrome P450 2d6 Leng | 9e-04 |
| >pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 | Back alignment and structure |
|
| >pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 | Back alignment and structure |
| >pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 | Back alignment and structure |
| >pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 | Back alignment and structure |
| >pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 | Back alignment and structure |
| >pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 | Back alignment and structure |
| >pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 | Back alignment and structure |
| >pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 | Back alignment and structure |
| >pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 | Back alignment and structure |
| >pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 | Back alignment and structure |
| >pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 | Back alignment and structure |
| >pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 | Back alignment and structure |
| >pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 | Back alignment and structure |
| >pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 | Back alignment and structure |
| >pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 | Back alignment and structure |
| >pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 | Back alignment and structure |
| >pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 | Back alignment and structure |
| >pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 | Back alignment and structure |
| >pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 | Back alignment and structure |
| >pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 | Back alignment and structure |
| >pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 | Back alignment and structure |
| >pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 | Back alignment and structure |
| >pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 | Back alignment and structure |
| >pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 | Back alignment and structure |
| >pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 | Back alignment and structure |
| >pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 | Back alignment and structure |
| >pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 | Back alignment and structure |
| >pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 | Back alignment and structure |
| >pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 | Back alignment and structure |
| >pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 | Back alignment and structure |
| >pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 | Back alignment and structure |
| >pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 | Back alignment and structure |
| >pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 | Back alignment and structure |
| >pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 | Back alignment and structure |
| >pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 | Back alignment and structure |
| >pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 | Back alignment and structure |
| >pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 | Back alignment and structure |
| >pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 | Back alignment and structure |
| >pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 | Back alignment and structure |
| >pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 | Back alignment and structure |
| >pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 | Back alignment and structure |
| >pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 | Back alignment and structure |
| >pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 | Back alignment and structure |
| >pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 | Back alignment and structure |
| >pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 | Back alignment and structure |
| >pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 | Back alignment and structure |
| >pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 | Back alignment and structure |
| >pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 | Back alignment and structure |
| >pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 | Back alignment and structure |
| >pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 | Back alignment and structure |
| >pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 | Back alignment and structure |
| >pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 | Back alignment and structure |
| >pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 | Back alignment and structure |
| >pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 | Back alignment and structure |
| >pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 | Back alignment and structure |
| >pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 | Back alignment and structure |
| >pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 | Back alignment and structure |
| >pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 | Back alignment and structure |
| >pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 | Back alignment and structure |
| >pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 | Back alignment and structure |
| >pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 | Back alignment and structure |
| >pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 | Back alignment and structure |
| >pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 | Back alignment and structure |
| >pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 | Back alignment and structure |
| >pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 | Back alignment and structure |
| >pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST 
Original result of RPS-BLAST against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| Query | 120 | |||
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 1e-48 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 2e-47 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 3e-47 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 6e-37 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 3e-33 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 1e-32 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 1e-31 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 1e-31 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 2e-26 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 3e-26 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 6e-26 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 4e-25 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 2e-24 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 4e-24 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 2e-23 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 8e-23 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 1e-22 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 1e-20 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 1e-18 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 2e-14 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 2e-13 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 2e-13 | |
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 2e-13 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 2e-13 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 3e-13 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 5e-13 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 6e-13 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 1e-12 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 1e-11 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 2e-07 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 9e-07 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 5e-06 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 8e-06 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 1e-05 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 1e-05 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 1e-05 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 2e-05 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 2e-05 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 2e-05 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 2e-05 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 2e-05 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 2e-05 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 3e-05 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 3e-05 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 3e-05 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 3e-05 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 3e-05 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 4e-05 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 4e-05 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 4e-05 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 4e-05 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 4e-05 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 5e-05 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 5e-05 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 6e-05 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 7e-05 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 7e-05 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 8e-05 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 8e-05 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 8e-05 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 9e-05 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 1e-04 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 1e-04 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 1e-04 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 1e-04 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 2e-04 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 2e-04 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 2e-04 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 2e-04 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 2e-04 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 4e-04 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 4e-04 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 4e-04 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 5e-04 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 6e-04 |
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 | Back alignment and structure |
|---|
Score = 160 bits (406), Expect = 1e-48
Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 4/117 (3%)
Query: 3 KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
+E + +P L + R Y+ +D FNPDRF G A K + ++F F
Sbjct: 328 EETLIDGVRVPGNTPLLFSTYVMGRMDTYF-EDPLTFNPDRFGPG---APKPRFTYFPFS 383
Query: 63 WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHK 119
G R CIGQ FA +E K+ +A +L + F+L P ++ P L
Sbjct: 384 LGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRP 440
|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 | Back alignment and structure |
|---|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 | Back alignment and structure |
|---|
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch 
Original result of HHsearch against PDB70 database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| 3tbg_A | 479 | Cytochrome P450 2D6; monooxygenase, thioridazine, | 100.0 | |
| 3k9v_A | 482 | 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho | 100.0 | |
| 3n9y_A | 487 | Cholesterol SIDE-chain cleavage enzyme; cytochrome | 100.0 | |
| 2ve3_A | 444 | Putative cytochrome P450 120; oxidoreductase, mono | 100.0 | |
| 3ld6_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 100.0 | |
| 3mdm_A | 456 | Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th | 100.0 | |
| 3nxu_A | 485 | Cytochrome P450 3A4; alpha beta protein, cytochrom | 99.98 | |
| 1po5_A | 476 | Cytochrome P450 2B4; oxidoreductase, membrane prot | 99.97 | |
| 2fdv_A | 476 | Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m | 99.97 | |
| 1r9o_A | 477 | Cytochrome P450 2C9; monooxygenase, drug metaboliz | 99.97 | |
| 2cib_A | 455 | Cytochrome P450 51; heme, heme lipid synthesis, me | 99.97 | |
| 3e6i_A | 476 | CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono | 99.97 | |
| 3pm0_A | 507 | Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase | 99.97 | |
| 3b98_A | 475 | Prostaglandin I2 synthase; prostacyclin synthase, | 99.97 | |
| 3swz_A | 494 | Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro | 99.97 | |
| 1izo_A | 417 | P450bsbeta, cytochrome P450 152A1; heme protein, p | 99.97 | |
| 3s79_A | 503 | Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD | 99.97 | |
| 3dax_A | 491 | Cytochrome P450 7A1; cholesterol, cholesterol 7-al | 99.97 | |
| 3dbg_A | 467 | Putative cytochrome P450; cytochrome P450 oxidored | 99.97 | |
| 3czh_A | 481 | Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro | 99.97 | |
| 2hi4_A | 495 | Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m | 99.97 | |
| 3qz1_A | 496 | Steroid 21-hydroxylase; P450 monooxygenase, oxidor | 99.97 | |
| 2ij2_A | 470 | Cytochrome P450 BM3; monoxygenase, heme binding pr | 99.96 | |
| 3awm_A | 415 | Fatty acid alpha-hydroxylase; cytochrome P450, per | 99.96 | |
| 3gw9_A | 450 | Sterol 14alpha-demethylase; CYP51, cytochrome P450 | 99.96 | |
| 3b6h_A | 498 | Prostacyclin synthase; enzyme-inhibitor complex, C | 99.96 | |
| 1n97_A | 389 | CYP175A1; electron transport; HET: SRT HEM; 1.80A | 99.96 | |
| 3nc3_A | 441 | Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE | 99.96 | |
| 3i3k_A | 461 | Lanosterol 14-alpha demethylase; cytochrome P450, | 99.96 | |
| 3buj_A | 397 | CALO2; heme, iron, metal-binding, monooxygenase, o | 99.96 | |
| 1gwi_A | 411 | CYP154C1, cytochrome P450 154C1; oxidoreductase, m | 99.96 | |
| 4dnj_A | 412 | Putative cytochrome P450; oxidoreductase; HET: HEM | 99.96 | |
| 4fb2_A | 398 | P450CIN; heme, monooxygenase, cindoxin, oxidoreduc | 99.96 | |
| 2uuq_A | 414 | CYP130, cytochrome P450 130; iron, heme, monooxyge | 99.96 | |
| 2dkk_A | 411 | Cytochrome P450; CYP158A1, INHI oxidoreductase; HE | 99.96 | |
| 3ejb_B | 404 | Biotin biosynthesis cytochrome P450-like enzyme; p | 99.96 | |
| 3oft_A | 396 | Cytochrome P450, CYP101C1; oxidoreductase; HET: HE | 99.96 | |
| 3v8d_A | 491 | Cholesterol 7-alpha-monooxygenase; cytochrome, oxi | 99.96 | |
| 3aba_A | 403 | Cytochrome P450; oxidoreductase, heme, monooxygena | 99.96 | |
| 3a4g_A | 411 | Vitamin D hydroxylase; cytochrome P450, hemoprotei | 99.96 | |
| 1n40_A | 396 | P450 MT2, cytochrome P450 121; heme binding, oxyge | 99.96 | |
| 1ued_A | 406 | P450 OXYC, P450 monooxygenase; cytochrome P450 van | 99.95 | |
| 1odo_A | 408 | Putative cytochrome P450 154A1; P450 monooxygenase | 99.95 | |
| 3abb_A | 408 | CYP105D6, cytochrome P450 hydroxylase; oxidoreduct | 99.95 | |
| 2cd8_A | 436 | Cytochrome P450 monooxygenase; oxidoreductase, PIK | 99.95 | |
| 2jjn_A | 411 | Cytochrome P450 113A1; oxidoreductase, iron, heme, | 99.95 | |
| 1s1f_A | 406 | Putative cytochrome P450; cytochrome P450 oxidored | 99.95 | |
| 3lxh_A | 421 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.95 | |
| 1cpt_A | 428 | Cytochrome P450-TERP; oxidoreductase(oxygenase); H | 99.95 | |
| 2xkr_A | 398 | CYP142, putative cytochrome P450 142; oxidoreducta | 99.95 | |
| 3b4x_A | 367 | 367AA long hypothetical cytochrome P450; HEM prote | 99.95 | |
| 2z3t_A | 425 | Cytochrome P450; monoxygenase, oxydoreductase, hem | 99.95 | |
| 2zwu_A | 415 | Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl | 99.95 | |
| 1q5d_A | 419 | P450 epoxidase; cytochrome P450, epothilone, oxydo | 99.95 | |
| 3mgx_A | 415 | Putative P450 monooxygenase; cytochrome P450 oxida | 99.95 | |
| 2y5n_A | 417 | MYCG, P-450-like protein; oxidoreductase, mycinami | 99.95 | |
| 1z8o_A | 404 | 6-deoxyerythronolide B hydroxylase; heme, CYP, ery | 99.95 | |
| 1io7_A | 368 | Cytochrome P450 CYP119; thermophilic, cytochromo P | 99.95 | |
| 4dxy_A | 417 | Cytochrome P450, CYP101D2; cytochrome P450 mutant, | 99.95 | |
| 2xbk_A | 404 | PIMD protein; epoxidation, oxidoreductase; HET: HE | 99.95 | |
| 1lfk_A | 398 | OXYB, P450 monooxygenase; oxidative phenol couplin | 99.95 | |
| 1jfb_A | 404 | Nitric-oxide reductase cytochrome P450 55A1; cytoc | 99.95 | |
| 3rwl_A | 426 | Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 | 99.95 | |
| 3r9b_A | 418 | Cytochrome P450 164A2; monooxygenase, oxidoreducta | 99.95 | |
| 3ivy_A | 433 | Cytochrome P450 CYP125; cholesterol, monooxygenase | 99.95 | |
| 2rfb_A | 343 | Cytochrome P450; heme, iron, metal-binding, monoox | 99.94 | |
| 2z36_A | 413 | MOXA, cytochrome P450 type compactin 3'',4''- hydr | 99.94 | |
| 2zbx_A | 412 | Cytochrome P450-SU1; beta prism, heme, iron, metal | 99.94 | |
| 2wiy_A | 394 | XPLA-heme, cytochrome P450-like protein XPLA; CYT- | 99.94 | |
| 3tyw_A | 417 | Putative cytochrome P450; P450 monooxygenase, oxid | 99.94 | |
| 3tkt_A | 450 | Cytochrome P450; aromatic hydrocarbon binding of P | 99.94 | |
| 2wm5_A | 435 | CYP124, putative cytochrome P450 124; metal-bindin | 99.93 | |
| 3p3o_A | 416 | Cytochrome P450; monooxygenase, oxidoreductase; HE | 99.93 | |
| 2yjn_B | 381 | Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; | 99.93 | |
| 3dan_A | 473 | Cytochrome P450 74A2; AOS heme cytochrome P450 str | 99.93 | |
| 3dsk_A | 495 | Cytochrome P450 74A, chloroplast; P450 fold, fatty | 99.92 | |
| 3oo3_A | 384 | OXY protein; cytochrome P450, monooxygenase, PCD-t | 99.91 |
| >3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=3.5e-34 Score=210.84 Aligned_cols=117 Identities=21% Similarity=0.413 Sum_probs=102.3
Q ss_pred CccceEecCEEeCCCCEEEechhhhhcCCCCcCCCCCCeecCCCCCCcccccCCCcceeeecCCCCcChhHHHHHHHHHH
Q 041835 1 NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKL 80 (120)
Q Consensus 1 a~~d~~l~g~~ip~gt~v~~~~~~~~~d~~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~~ 80 (120)
+.+|++++||.|||||.|+++.|++||||++| ++|++|+||||++++... .+...++|||+|+|.|+|++||.+|+++
T Consensus 356 ~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~-~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA~~e~~~ 433 (479)
T 3tbg_A 356 TSRDIEVQGFRIPKGTTLITNLSSVLKDEAVW-EKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLARMELFL 433 (479)
T ss_dssp CSSCEEETTEEECTTCEEEEEHHHHHTCTTTS-SSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHHHHHHHH
T ss_pred cCCCceECCEEecCCCeeeechhhhcCChhhC-CCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHHHHHHHH
Confidence 35799999999999999999999999999999 899999999999876543 3567899999999999999999999999
Q ss_pred HHHHHhhhceeEeCCCCccCC---ccceEEeeCCCceEEEEEC
Q 041835 81 ALAMILHKFTFQLSPTYVHAP---TRGISVYPQHGANIILHKI 120 (120)
Q Consensus 81 ~l~~ll~~f~~~~~~~~~~~~---~~~~~~~p~~~~~v~~~~r 120 (120)
+++.||++|+++++++..... ...++..|+ +++|++++|
T Consensus 434 ~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P~-~~~v~~~pR 475 (479)
T 3tbg_A 434 FFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPS-PYELCAVPR 475 (479)
T ss_dssp HHHHHHHHEEEECCTTSCCCCSCEEESSSEEEC-CCCBEEEEC
T ss_pred HHHHHHHccEEEeCCCCCCccccccceeeecCC-CeEEEEEEC
Confidence 999999999999987643222 235667786 899999997
|
| >3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* | Back alignment and structure |
|---|
| >3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* | Back alignment and structure |
|---|
| >2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* | Back alignment and structure |
|---|
| >3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* | Back alignment and structure |
|---|
| >3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* | Back alignment and structure |
|---|
| >3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* | Back alignment and structure |
|---|
| >1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* | Back alignment and structure |
|---|
| >2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* | Back alignment and structure |
|---|
| >1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* | Back alignment and structure |
|---|
| >2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* | Back alignment and structure |
|---|
| >3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* | Back alignment and structure |
|---|
| >3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* | Back alignment and structure |
|---|
| >3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* | Back alignment and structure |
|---|
| >1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* | Back alignment and structure |
|---|
| >3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* | Back alignment and structure |
|---|
| >3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* | Back alignment and structure |
|---|
| >3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* | Back alignment and structure |
|---|
| >3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* | Back alignment and structure |
|---|
| >2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} | Back alignment and structure |
|---|
| >3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} | Back alignment and structure |
|---|
| >2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... | Back alignment and structure |
|---|
| >3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* | Back alignment and structure |
|---|
| >3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* | Back alignment and structure |
|---|
| >3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* | Back alignment and structure |
|---|
| >1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* | Back alignment and structure |
|---|
| >3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* | Back alignment and structure |
|---|
| >3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} | Back alignment and structure |
|---|
| >1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* | Back alignment and structure |
|---|
| >4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* | Back alignment and structure |
|---|
| >2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* | Back alignment and structure |
|---|
| >2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* | Back alignment and structure |
|---|
| >3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* | Back alignment and structure |
|---|
| >3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* | Back alignment and structure |
|---|
| >3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* | Back alignment and structure |
|---|
| >3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* | Back alignment and structure |
|---|
| >3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* | Back alignment and structure |
|---|
| >1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* | Back alignment and structure |
|---|
| >1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} | Back alignment and structure |
|---|
| >2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* | Back alignment and structure |
|---|
| >2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* | Back alignment and structure |
|---|
| >1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* | Back alignment and structure |
|---|
| >3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* | Back alignment and structure |
|---|
| >1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 | Back alignment and structure |
|---|
| >2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* | Back alignment and structure |
|---|
| >2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* | Back alignment and structure |
|---|
| >2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... | Back alignment and structure |
|---|
| >1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* | Back alignment and structure |
|---|
| >3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} | Back alignment and structure |
|---|
| >2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* | Back alignment and structure |
|---|
| >1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* | Back alignment and structure |
|---|
| >1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* | Back alignment and structure |
|---|
| >4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* | Back alignment and structure |
|---|
| >2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* | Back alignment and structure |
|---|
| >1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* | Back alignment and structure |
|---|
| >1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* | Back alignment and structure |
|---|
| >3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} | Back alignment and structure |
|---|
| >3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* | Back alignment and structure |
|---|
| >3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* | Back alignment and structure |
|---|
| >2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* | Back alignment and structure |
|---|
| >2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} | Back alignment and structure |
|---|
| >2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* | Back alignment and structure |
|---|
| >2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* | Back alignment and structure |
|---|
| >3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* | Back alignment and structure |
|---|
| >3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} | Back alignment and structure |
|---|
| >2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* | Back alignment and structure |
|---|
| >3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* | Back alignment and structure |
|---|
| >2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} | Back alignment and structure |
|---|
| >3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* | Back alignment and structure |
|---|
| >3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* | Back alignment and structure |
|---|
| >3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST 
Original result of RPS-BLAST against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
E-value ![]() |
| 120 | ||||
| d1tqna_ | 472 | a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma | 2e-25 | |
| d2ij2a1 | 453 | a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus | 1e-24 | |
| d3czha1 | 463 | a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 | 2e-24 | |
| d1po5a_ | 465 | a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb | 1e-22 | |
| d2ciba1 | 445 | a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero | 6e-21 | |
| d1r9oa_ | 467 | a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma | 2e-20 | |
| d1izoa_ | 411 | a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba | 2e-19 | |
| d1gwia_ | 403 | a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce | 7e-19 | |
| d1cpta_ | 428 | a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s | 1e-18 | |
| d1n97a_ | 385 | a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax | 1e-18 | |
| d1odoa_ | 401 | a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce | 2e-18 | |
| d1jfba_ | 399 | a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta | 8e-16 | |
| d1z8oa1 | 402 | a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo | 8e-16 | |
| d1lfka_ | 394 | a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops | 1e-15 | |
| d1s1fa_ | 399 | a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ | 2e-15 | |
| d1ueda_ | 403 | a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops | 4e-15 | |
| d1q5da_ | 401 | a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell | 4e-15 | |
| d1n40a_ | 395 | a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My | 3e-14 | |
| d1ue8a_ | 367 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai | 2e-13 | |
| d1re9a_ | 404 | a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu | 2e-13 | |
| d1io7a_ | 366 | a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata | 2e-12 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Score = 96.7 bits (239), Expect = 2e-25
Identities = 38/119 (31%), Positives = 62/119 (52%), Gaps = 4/119 (3%)
Query: 3 KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
K++++ IP GV + +P +HRD +YW + +KF P+RFS+ +K + + + FG
Sbjct: 352 KDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFSKK-NKDNIDPYIYTPFG 409
Query: 63 WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPT--RGISVYPQHGANIILHK 119
GPR CIG FAL+ KLAL +L F+F+ G + P+ + +
Sbjct: 410 SGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVES 468
|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 | Back information, alignment and structure |
|---|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch 
Original result of HHsearch against SCOP70(version1.75) database
ID ![]() | Alignment Graph ![]() | Length ![]() |
Definition ![]() |
Probability ![]() |
| Query | 120 | |||
| d1tqna_ | 472 | Mammalian cytochrome P450 3a4 {Human (Homo sapiens | 100.0 | |
| d3czha1 | 463 | Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie | 100.0 | |
| d2ciba1 | 445 | Cytochrome p450 14 alpha-sterol demethylase (cyp51 | 99.97 | |
| d1po5a_ | 465 | Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus | 99.97 | |
| d1izoa_ | 411 | Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis | 99.97 | |
| d1r9oa_ | 467 | Mammalian cytochrome p450 2c9 {Human (Homo sapiens | 99.97 | |
| d2ij2a1 | 453 | Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: | 99.97 | |
| d1cpta_ | 428 | Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] | 99.96 | |
| d1odoa_ | 401 | Cyp154a1 monooxygenase {Streptomyces coelicolor [T | 99.96 | |
| d1n97a_ | 385 | Cyp175a1 {Thermus thermophilus [TaxId: 274]} | 99.96 | |
| d1q5da_ | 401 | Cytochrome P450epok {Sorangium cellulosum [TaxId: | 99.96 | |
| d1gwia_ | 403 | Cyp154c1 monooxygenase {Streptomyces coelicolor [T | 99.96 | |
| d1s1fa_ | 399 | Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | 99.95 | |
| d1z8oa1 | 402 | Cytochrome P450-ERYF {Saccharopolyspora erythraea | 99.95 | |
| d1ueda_ | 403 | p450 monoxygenase OxyC {Amycolatopsis orientalis [ | 99.95 | |
| d1jfba_ | 399 | Cytochrome P450-NOR, nitric reductase {Fungus (Fus | 99.95 | |
| d1ue8a_ | 367 | Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 | 99.94 | |
| d1re9a_ | 404 | Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 | 99.94 | |
| d1lfka_ | 394 | p450 monoxygenase OxyB {Amycolatopsis orientalis [ | 99.94 | |
| d1io7a_ | 366 | Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 | 99.94 | |
| d1n40a_ | 395 | Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub | 99.93 |
| >d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
class: All alpha proteins fold: Cytochrome P450 superfamily: Cytochrome P450 family: Cytochrome P450 domain: Mammalian cytochrome P450 3a4 species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00 E-value=1.1e-33 Score=205.35 Aligned_cols=118 Identities=31% Similarity=0.582 Sum_probs=104.8
Q ss_pred CccceEecCEEeCCCCEEEechhhhhcCCCCcCCCCCCeecCCCCCCcccccCCCcceeeecCCCCcChhHHHHHHHHHH
Q 041835 1 NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKL 80 (120)
Q Consensus 1 a~~d~~l~g~~ip~gt~v~~~~~~~~~d~~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~~ 80 (120)
+.+|+.++||.|||||.|+++.+++|+||++| ++|++|+||||++.+... ..+..++|||+|+|.|+|+++|.+++++
T Consensus 350 ~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~-~dp~~F~PeRfl~~~~~~-~~~~~~~~FG~G~r~C~G~~~A~~~~~~ 427 (472)
T d1tqna_ 350 CKKDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFSKKNKDN-IDPYIYTPFGSGPRNCIGMRFALMNMKL 427 (472)
T ss_dssp CCSCEEETTEEECTTCEEEECHHHHHTCTTTS-SSTTSCCGGGGSTTTGGG-CCTTTSCTTCCSTTSCTTHHHHHHHHHH
T ss_pred cccCccccCceeCCCCEEEEechhhhcCchhC-CCccccCccccCCCCccc-CCCceecCCCCCCccChhHHHHHHHHHH
Confidence 46899999999999999999999999999999 899999999999876543 3567899999999999999999999999
Q ss_pred HHHHHhhhceeEeCCCCc--cCCccceEEeeCCCceEEEEEC
Q 041835 81 ALAMILHKFTFQLSPTYV--HAPTRGISVYPQHGANIILHKI 120 (120)
Q Consensus 81 ~l~~ll~~f~~~~~~~~~--~~~~~~~~~~p~~~~~v~~~~r 120 (120)
+++.||++|+++++++.. .......++.|+.++.|++++|
T Consensus 428 ~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R 469 (472)
T d1tqna_ 428 ALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR 469 (472)
T ss_dssp HHHHHHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEET
T ss_pred HHHHHHHhCEEEeCCCCCCCceeccceEEeeCCCEEEEEEEC
Confidence 999999999999876643 2334466789999999999998
|
| >d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} | Back information, alignment and structure |
|---|
| >d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} | Back information, alignment and structure |
|---|
| >d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} | Back information, alignment and structure |
|---|
| >d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} | Back information, alignment and structure |
|---|
| >d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} | Back information, alignment and structure |
|---|
| >d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} | Back information, alignment and structure |
|---|
| >d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} | Back information, alignment and structure |
|---|
| >d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} | Back information, alignment and structure |
|---|
| >d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} | Back information, alignment and structure |
|---|
| >d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} | Back information, alignment and structure |
|---|
| >d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} | Back information, alignment and structure |
|---|
| >d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} | Back information, alignment and structure |
|---|
| >d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} | Back information, alignment and structure |
|---|
| >d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|