Citrus Sinensis ID: 041835

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120
NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI
ccccEEEccEEEccccEEEEEEEEHcccccccccccccccccccccccccccccccEEEccccccccHHHHHHHHHHHHHHHHHHHHccEEEEcccccccccccEEEEcccccEEEEEEc
ccccEEEccEEccccEEEEEEEEEEEcccHHccccHHHccHHHHHccHHHcccccccccccccHHHccccHHHHHHHHHHHHHHHHHHEEEEcccccccccEEEEEEccccccEEEEEcc
nfkeiklgeyiippgvflslpiifvhrdheywgddakkfnpdrfsegvskaSKNQISFfsfgwgpricigQNFALLEAKLALAMILHKFtfqlsptyvhaptrgisvypqhganiilhki
nfkeiklgeyiippgvFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI
NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI
****IKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKF**************NQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIIL***
NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI
NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI
NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query120 2.2.26 [Sep-21-2011]
Q05047524 Secologanin synthase OS=C N/A no 0.983 0.225 0.516 8e-35
Q9SHG5519 Cytochrome P450 72C1 OS=A no no 0.983 0.227 0.491 1e-33
O48786520 Cytochrome P450 734A1 OS= no no 0.975 0.225 0.521 1e-31
B9X287542 Cytochrome P450 734A6 OS= no no 0.95 0.210 0.504 5e-29
Q6Z6D6557 Cytochrome P450 734A2 OS= no no 0.916 0.197 0.490 2e-28
Q69XM6538 Cytochrome P450 734A4 OS= no no 0.883 0.197 0.490 7e-27
Q9ZW95512 Cytokinin hydroxylase OS= no no 0.941 0.220 0.431 2e-26
Q9FF18518 Cytokinin hydroxylase OS= no no 0.941 0.218 0.439 7e-23
Q8LIF2537 Cytochrome P450 734A5 OS= no no 0.983 0.219 0.445 5e-20
Q93VK5595 Protein LUTEIN DEFICIENT no no 0.908 0.183 0.378 2e-13
>sp|Q05047|C72A1_CATRO Secologanin synthase OS=Catharanthus roseus GN=CYP72A1 PE=2 SV=1 Back     alignment and function desciption
 Score =  145 bits (366), Expect = 8e-35,   Method: Compositional matrix adjust.
 Identities = 61/118 (51%), Positives = 87/118 (73%)

Query: 3   KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
           K+ KLG Y IP G  + LP + +HR+   WG+DA +FNP RF +GV+ A+KN +++  F 
Sbjct: 405 KDTKLGSYTIPAGTQVMLPTVMLHREKSIWGEDAMEFNPMRFVDGVANATKNNVTYLPFS 464

Query: 63  WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI 120
           WGPR+C+GQNFALL+AKL LAMIL +F F ++P+YVHAP   ++V PQ G+++I  K+
Sbjct: 465 WGPRVCLGQNFALLQAKLGLAMILQRFKFDVAPSYVHAPFTILTVQPQFGSHVIYKKL 522
Converts loganin into secologanin.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 3EC: .EC: 3EC: .EC: 9
>sp|Q9SHG5|C72C1_ARATH Cytochrome P450 72C1 OS=Arabidopsis thaliana GN=CYP72C1 PE=2 SV=2 Back     alignment and function description
>sp|O48786|C734A_ARATH Cytochrome P450 734A1 OS=Arabidopsis thaliana GN=CYP734A1 PE=2 SV=1 Back     alignment and function description
>sp|B9X287|C7346_ORYSJ Cytochrome P450 734A6 OS=Oryza sativa subsp. japonica GN=CYP734A6 PE=2 SV=1 Back     alignment and function description
>sp|Q6Z6D6|C7342_ORYSJ Cytochrome P450 734A2 OS=Oryza sativa subsp. japonica GN=CYP734A2 PE=2 SV=1 Back     alignment and function description
>sp|Q69XM6|C7344_ORYSJ Cytochrome P450 734A4 OS=Oryza sativa subsp. japonica GN=CYP734A4 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZW95|C7352_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FF18|C7351_ARATH Cytokinin hydroxylase OS=Arabidopsis thaliana GN=CYP735A1 PE=1 SV=1 Back     alignment and function description
>sp|Q8LIF2|C7345_ORYSJ Cytochrome P450 734A5 OS=Oryza sativa subsp. japonica GN=CYP734A5 PE=2 SV=1 Back     alignment and function description
>sp|Q93VK5|LUT5_ARATH Protein LUTEIN DEFICIENT 5, chloroplastic OS=Arabidopsis thaliana GN=CYP97A3 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
224119134 518 cytochrome P450 [Populus trichocarpa] gi 0.983 0.227 0.627 1e-42
224113639144 predicted protein [Populus trichocarpa] 0.983 0.819 0.627 2e-42
164604828 518 cytochrome P450 [Coptis japonica var. di 1.0 0.231 0.641 2e-42
224113631142 cytochrome P450 [Populus trichocarpa] gi 0.983 0.830 0.627 2e-42
224093417 353 cytochrome P450 [Populus trichocarpa] gi 0.983 0.334 0.627 2e-42
297830010 512 CYP72A7 [Arabidopsis lyrata subsp. lyrat 0.983 0.230 0.644 2e-42
15231906 512 cytochrome P450, family 72, subfamily A, 0.983 0.230 0.618 3e-42
224119138 410 predicted protein [Populus trichocarpa] 0.983 0.287 0.627 3e-42
224105979 518 cytochrome P450 [Populus trichocarpa] gi 0.983 0.227 0.627 3e-42
224119122125 cytochrome P450 [Populus trichocarpa] gi 0.983 0.944 0.627 8e-42
>gi|224119134|ref|XP_002331333.1| cytochrome P450 [Populus trichocarpa] gi|222873916|gb|EEF11047.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  176 bits (446), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 74/118 (62%), Positives = 101/118 (85%)

Query: 3   KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
           +EIKLG  ++P GV +SLPII +H+DHE WGDDA +F P+RF+EG+SKA+K+Q+SF  FG
Sbjct: 401 EEIKLGNLLLPAGVQVSLPIILLHQDHELWGDDASEFKPERFAEGISKATKSQVSFLPFG 460

Query: 63  WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI 120
           WGPRIC+GQNFAL+EAK+ALAM+L +++F+LSP+Y+HAP   I++ PQHGA +IL K+
Sbjct: 461 WGPRICVGQNFALIEAKMALAMVLQRYSFELSPSYIHAPRTVITLQPQHGAPMILRKL 518

Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224113639|ref|XP_002332523.1| predicted protein [Populus trichocarpa] gi|222832635|gb|EEE71112.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|164604828|dbj|BAF98466.1| cytochrome P450 [Coptis japonica var. dissecta] Back     alignment and taxonomy information
>gi|224113631|ref|XP_002332521.1| cytochrome P450 [Populus trichocarpa] gi|222832633|gb|EEE71110.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224093417|ref|XP_002334834.1| cytochrome P450 [Populus trichocarpa] gi|222875161|gb|EEF12292.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|297830010|ref|XP_002882887.1| CYP72A7 [Arabidopsis lyrata subsp. lyrata] gi|297328727|gb|EFH59146.1| CYP72A7 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|15231906|ref|NP_188086.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis thaliana] gi|13605897|gb|AAK32934.1|AF367347_1 AT3g14680/MIE1_18 [Arabidopsis thaliana] gi|9294390|dbj|BAB02400.1| cytochrome P450 [Arabidopsis thaliana] gi|24111277|gb|AAN46762.1| At3g14680/MIE1_18 [Arabidopsis thaliana] gi|332642034|gb|AEE75555.1| cytochrome P450, family 72, subfamily A, polypeptide 14 [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|224119138|ref|XP_002331334.1| predicted protein [Populus trichocarpa] gi|222873917|gb|EEF11048.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224105979|ref|XP_002333744.1| cytochrome P450 [Populus trichocarpa] gi|222838385|gb|EEE76750.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224119122|ref|XP_002331330.1| cytochrome P450 [Populus trichocarpa] gi|222873913|gb|EEF11044.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query120
TAIR|locus:2089621512 CYP72A14 ""cytochrome P450, fa 0.983 0.230 0.618 5.3e-40
TAIR|locus:2089521512 CYP72A15 ""cytochrome P450, fa 0.983 0.230 0.618 1.1e-39
TAIR|locus:2089526512 CYP72A7 ""cytochrome P450, fam 0.983 0.230 0.635 1.4e-39
TAIR|locus:2089546508 CYP72A9 ""cytochrome P450, fam 0.983 0.232 0.593 1.4e-39
TAIR|locus:2089596512 CYP72A13 ""cytochrome P450, fa 0.983 0.230 0.618 2.9e-39
TAIR|locus:2089561514 CYP72A10 ""cytochrome P450, fa 0.983 0.229 0.601 5.5e-38
TAIR|locus:2089586512 CYP72A11 ""cytochrome P450, fa 0.983 0.230 0.601 7e-38
TAIR|locus:2089531515 CYP72A8 ""cytochrome P450, fam 0.983 0.229 0.554 1.5e-35
TAIR|locus:2043823520 BAS1 "PHYB ACTIVATION TAGGED S 0.975 0.225 0.521 3.5e-30
TAIR|locus:2149423525 CYP714A2 "cytochrome P450, fam 0.941 0.215 0.495 2e-27
TAIR|locus:2089621 CYP72A14 ""cytochrome P450, family 72, subfamily A, polypeptide 14"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 426 (155.0 bits), Expect = 5.3e-40, P = 5.3e-40
 Identities = 73/118 (61%), Positives = 100/118 (84%)

Query:     3 KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
             KE+KLG+  +P GV +SLP++ VHRD E WG+DA +F P+RF +G+SKA+KNQ+SFF F 
Sbjct:   395 KEMKLGDLTLPGGVQISLPVLLVHRDTELWGNDAGEFKPERFKDGLSKATKNQVSFFPFA 454

Query:    63 WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI 120
             WGPRICIGQNF LLEAK+A+++IL +F+F+LSP+YVHAP   I++YPQ GA+++LHK+
Sbjct:   455 WGPRICIGQNFTLLEAKMAMSLILQRFSFELSPSYVHAPYTIITLYPQFGAHLMLHKL 512
GO:0005506 "iron ion binding" evidence=IEA
GO:0009055 "electron carrier activity" evidence=IEA
GO:0016705 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen" evidence=IEA
GO:0019825 "oxygen binding" evidence=ISS
GO:0020037 "heme binding" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000041 "transition metal ion transport" evidence=RCA
TAIR|locus:2089521 CYP72A15 ""cytochrome P450, family 72, subfamily A, polypeptide 15"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089526 CYP72A7 ""cytochrome P450, family 72, subfamily A, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089546 CYP72A9 ""cytochrome P450, family 72, subfamily A, polypeptide 9"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089596 CYP72A13 ""cytochrome P450, family 72, subfamily A, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089561 CYP72A10 ""cytochrome P450, family 72, subfamily A, polypeptide 10"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089586 CYP72A11 ""cytochrome P450, family 72, subfamily A, polypeptide 11"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2089531 CYP72A8 ""cytochrome P450, family 72, subfamily A, polypeptide 8"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043823 BAS1 "PHYB ACTIVATION TAGGED SUPPRESSOR 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2149423 CYP714A2 "cytochrome P450, family 714, subfamily A, polypeptide 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
CYP72A42v3
cytochrome P450 (353 aa)
(Populus trichocarpa)
Predicted Functional Partners:
gw1.4331.5.1
annotation not avaliable (340 aa)
  •     0.491
CYP728D10P
cytochrome P450 (151 aa)
  •     0.421

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
PLN02290516 PLN02290, PLN02290, cytokinin trans-hydroxylase 8e-33
pfam00067461 pfam00067, p450, Cytochrome P450 2e-22
COG2124411 COG2124, CypX, Cytochrome P450 [Secondary metaboli 7e-19
PLN02738633 PLN02738, PLN02738, carotene beta-ring hydroxylase 5e-16
PLN02936489 PLN02936, PLN02936, epsilon-ring hydroxylase 3e-14
PLN03195516 PLN03195, PLN03195, fatty acid omega-hydroxylase; 5e-11
PTZ00404482 PTZ00404, PTZ00404, cytochrome P450; Provisional 3e-10
PLN02169500 PLN02169, PLN02169, fatty acid (omega-1)-hydroxyla 3e-08
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-08
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 6e-08
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 1e-07
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-07
PLN02987472 PLN02987, PLN02987, Cytochrome P450, family 90, su 3e-07
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 3e-07
PLN02302490 PLN02302, PLN02302, ent-kaurenoic acid oxidase 4e-07
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-07
PLN03141452 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-m 5e-07
PLN02426502 PLN02426, PLN02426, cytochrome P450, family 94, su 1e-06
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 6e-06
PLN02500490 PLN02500, PLN02500, cytochrome P450 90B1 8e-06
PLN02655466 PLN02655, PLN02655, ent-kaurene oxidase 7e-05
PLN03018534 PLN03018, PLN03018, homomethionine N-hydroxylase 0.002
>gnl|CDD|215164 PLN02290, PLN02290, cytokinin trans-hydroxylase Back     alignment and domain information 
 Score =  119 bits (299), Expect = 8e-33
 Identities = 51/116 (43%), Positives = 75/116 (64%), Gaps = 3/116 (2%)

Query: 2   FKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSF 61
           F++IKLG+  IP G+ + +P++ +H   E WG DA +FNPDRF+ G   A      F  F
Sbjct: 399 FEDIKLGDLHIPKGLSIWIPVLAIHHSEELWGKDANEFNPDRFA-GRPFAPGRH--FIPF 455

Query: 62  GWGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIIL 117
             GPR CIGQ FA++EAK+ LAM++ KF+F +S  Y HAP   +++ P++G  + L
Sbjct: 456 AAGPRNCIGQAFAMMEAKIILAMLISKFSFTISDNYRHAPVVVLTIKPKYGVQVCL 511

Length = 516
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|225035 COG2124, CypX, Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>gnl|CDD|215393 PLN02738, PLN02738, carotene beta-ring hydroxylase Back     alignment and domain information
>gnl|CDD|178524 PLN02936, PLN02936, epsilon-ring hydroxylase Back     alignment and domain information
>gnl|CDD|215627 PLN03195, PLN03195, fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|177826 PLN02169, PLN02169, fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|166628 PLN02987, PLN02987, Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|215171 PLN02302, PLN02302, ent-kaurenoic acid oxidase Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215600 PLN03141, PLN03141, 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>gnl|CDD|215235 PLN02426, PLN02426, cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215276 PLN02500, PLN02500, cytochrome P450 90B1 Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|178592 PLN03018, PLN03018, homomethionine N-hydroxylase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 120
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.98
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 99.98
PLN02290516 cytokinin trans-hydroxylase 99.97
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.97
PLN02500490 cytochrome P450 90B1 99.97
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.97
PLN00168519 Cytochrome P450; Provisional 99.97
PLN02774463 brassinosteroid-6-oxidase 99.97
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 99.97
PLN02738633 carotene beta-ring hydroxylase 99.97
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 99.97
PLN00110504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 99.97
PLN03234499 cytochrome P450 83B1; Provisional 99.97
PTZ00404482 cytochrome P450; Provisional 99.97
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 99.97
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.97
PLN02966502 cytochrome P450 83A1 99.97
PLN02394503 trans-cinnamate 4-monooxygenase 99.97
PLN02655466 ent-kaurene oxidase 99.97
PLN02987472 Cytochrome P450, family 90, subfamily A 99.97
PLN02183516 ferulate 5-hydroxylase 99.96
PLN02302490 ent-kaurenoic acid oxidase 99.96
PLN03018534 homomethionine N-hydroxylase 99.96
PLN02936489 epsilon-ring hydroxylase 99.96
PLN02971543 tryptophan N-hydroxylase 99.96
PLN02687517 flavonoid 3'-monooxygenase 99.96
PLN02196463 abscisic acid 8'-hydroxylase 99.96
PLN03112514 cytochrome P450 family protein; Provisional 99.96
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.94
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.94
PLN02648480 allene oxide synthase 99.89
PF12508200 DUF3714: Protein of unknown function (DUF3714) ; I 81.75
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information 
Probab=100.00  E-value=7.9e-33  Score=208.34  Aligned_cols=120  Identities=37%  Similarity=0.721  Sum_probs=108.8

Q ss_pred             CccceEe-cCEEeCCCCEEEechhhhhcCCCCcCCCCCCeecCCCCCCcccccCCCcceeeecCCCCcChhHHHHHHHHH
Q 041835            1 NFKEIKL-GEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAK   79 (120)
Q Consensus         1 a~~d~~l-~g~~ip~gt~v~~~~~~~~~d~~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~   79 (120)
                      +++|++| +||.||||+.|++++|++|||+++|++||++|+|+||+++......+++.|+|||+|+|.|+|++||++||+
T Consensus       375 ~~~d~~l~~g~~IPkG~~V~i~~~~~~r~~~~~~~dp~~F~PeRf~~~~~~~~~~~~~fipFsaGpR~CiG~~fA~lemK  454 (497)
T KOG0157|consen  375 ATKDVKLPGGYTIPKGTNVLISIYALHRDPRVWGEDPEEFDPERFLDGEEKAKRHPFAFIPFSAGPRNCIGQKFAMLEMK  454 (497)
T ss_pred             cCCCeEcCCCcEeCCCCEEEEehHHhccCccccCCChhhcCccccCCCCCcCCCCCccccCCCCCcccchhHHHHHHHHH
Confidence            5789999 589999999999999999999999977999999999997654434567899999999999999999999999


Q ss_pred             HHHHHHhhhceeEeCCCCccCCccceEEeeCCCceEEEEEC
Q 041835           80 LALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHKI  120 (120)
Q Consensus        80 ~~l~~ll~~f~~~~~~~~~~~~~~~~~~~p~~~~~v~~~~r  120 (120)
                      ++++.++++|++++..+....+....+++|.+|++|++++|
T Consensus       455 v~l~~ll~~f~~~~~~~~~~~~~~~~~l~~~~gl~v~~~~r  495 (497)
T KOG0157|consen  455 VVLAHLLRRFRIEPVGGDKPKPVPELTLRPKNGLKVKLRPR  495 (497)
T ss_pred             HHHHHHHHheEEEecCCCCceeeeEEEEEecCCeEEEEEeC
Confidence            99999999999998877555667789999999999999987

>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PF12508 DUF3714: Protein of unknown function (DUF3714) ; InterPro: IPR022187 Proteins in this entry are designated TraM and are found in a proposed transfer region of a class of conjugative transposon found in the Bacteroides lineage Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
3qi8_B472 Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) 1e-13
4duf_A471 Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Seroto 1e-13
4dud_A471 Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Le 1e-13
3ekb_A470 Crystal Structure Of The A264c Mutant Heme Domain O 1e-13
1yqo_A455 T268a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-13
1smi_A471 A Single Mutation Of P450 Bm3 Induces The Conformat 1e-13
1yqp_A455 T268n Mutant Cytochrome Domain Of Flavocytochrome P 1e-13
1jpz_A473 Crystal Structure Of A Complex Of The Heme Domain O 1e-13
1zoa_A473 Crystal Structure Of A328v Mutant Of The Heme Domai 1e-13
2bmh_A455 Modeling Protein-Substrate Interactions In The Heme 1e-13
4duc_A472 Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Leng 1e-13
3kx5_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-13
1bvy_A458 Complex Of The Heme And Fmn-Binding Domains Of The 1e-13
3dgi_A461 Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Le 1e-13
4du2_B470 Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamin 1e-13
2x7y_A455 P450 Bm3 F87a In Complex With Dmso Length = 455 1e-13
1zo4_A473 Crystal Structure Of A328s Mutant Of The Heme Domai 1e-13
2hpd_A471 Crystal Structure Of Hemoprotein Domain Of P450bm-3 1e-13
1fah_A471 Structure Of Cytochrome P450 Length = 471 1e-13
3kx3_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-13
3ekf_A470 Crystal Structure Of The A264q Heme Domain Of Cytoc 1e-13
3ekd_A470 Crystal Structure Of The A264m Heme Domain Of Cytoc 1e-13
3ben_A470 Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine 1e-13
2ij2_A470 Atomic Structure Of The Heme Domain Of Flavocytochr 1e-13
2ij4_A470 Structure Of The A264k Mutant Of Cytochrome P450 Bm 1e-13
4dub_A472 Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopami 1e-13
2uwh_A458 Cytochrome P450 Bm3 Mutant In Complex With Palmitic 1e-13
4dua_A471 Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Leng 1e-13
3m4v_A482 Crystal Structure Of The A330p Mutant Of Cytochrome 1e-13
3npl_A470 Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme D 1e-13
2ij3_A470 Structure Of The A264h Mutant Of Cytochrome P450 Bm 1e-13
4dtw_B469 Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Seroto 2e-13
3psx_A487 Crystal Structure Of The Kt2 Mutant Of Cytochrome P 3e-13
3cbd_A455 Directed Evolution Of Cytochrome P450 Bm3, To Octan 3e-13
1p0x_A455 F393y Mutant Heme Domain Of Flavocytochrome P450 Bm 3e-13
3ua1_A487 Crystal Structure Of The Cytochrome P4503a4-Bromoer 3e-13
1tqn_A486 Crystal Structure Of Human Microsomal P450 3a4 Leng 3e-13
1w0e_A485 Crystal Structure Of Human Cytochrome P450 3a4 Leng 3e-13
2nnb_A471 The Q403k Mutnat Heme Domain Of Flavocytochrome P45 4e-13
1p0w_A455 F393w Mutant Heme Domain Of Flavocytochrome P450 Bm 6e-13
3hf2_A482 Crystal Structure Of The I401p Mutant Of Cytochrome 1e-12
1jme_A455 Crystal Structure Of Phe393his Cytochrome P450 Bm3 1e-12
3kx4_A470 Crystal Structure Of Bacillus Megaterium Bm3 Heme D 1e-12
1p0v_A455 F393a Mutant Heme Domain Of Flavocytochrome P450 Bm 1e-12
2q9f_A456 Crystal Structure Of Human Cytochrome P450 46a1 In 6e-10
3l4d_A453 Crystal Structure Of Sterol 14-Alpha Demethylase (C 6e-09
2wuz_A473 X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In 8e-09
3k1o_A458 Crystal Structure Of Sterol 14-alpha Demethylase (c 8e-09
3khm_A464 Crystal Structure Of Sterol 14alpha-Demethylase (Cy 8e-09
3tik_A454 Sterol 14-Alpha Demethylase (Cyp51) From Trypanosom 2e-08
3p99_A453 Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma 2e-08
2wv2_A475 X-Ray Structure Of Cyp51 From The Human Pathogen Tr 2e-08
2x2n_A475 X-Ray Structure Of Cyp51 From Trypanosoma Brucei In 2e-08
3gw9_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-08
3g1q_A450 Crystal Structure Of Sterol 14-Alpha Demethylase (C 2e-08
1n97_A389 Crystal Stucture Of Cyp175a1 From Thermus Thermophi 6e-08
3k9v_A482 Crystal Structure Of Rat Mitochondrial P450 24a1 S5 1e-07
2ve3_A444 Retinoic Acid Bound Cyanobacterial Cyp120a1 Length 1e-06
3qz1_A496 Crystal Structure Of Bovine Steroid Of 21-Hydroxyla 1e-06
3ld6_A461 Crystal Structure Of Human Lanosterol 14alpha-Demet 3e-06
3mzs_A486 Crystal Structure Of Cytochrome P450 Cyp11a1 In Com 4e-06
3c6g_A479 Crystal Structure Of Cyp2r1 In Complex With Vitamin 6e-06
3czh_A481 Crystal Structure Of Cyp2r1 In Complex With Vitamin 7e-06
1wiy_A389 Crystal Structure Analysis Of A 6-Coordinated Cytoc 1e-05
1io8_A368 Thermophilic Cytochrome P450 (Cyp119) From Sulfolob 2e-05
3ruk_A494 Human Cytochrome P450 Cyp17a1 In Complex With Abira 2e-05
1f4t_A368 Thermophilic P450: Cyp119 From Sulfolobus Solfactar 3e-05
2hi4_A495 Crystal Structure Of Human Microsomal P450 1a2 In C 4e-05
3r9c_A418 Crystal Structure Of Mycobacterium Smegmatis Cyp164 8e-05
3na0_A471 Crystal Structure Of Human Cyp11a1 In Complex With 1e-04
3n9y_A487 Crystal Structure Of Human Cyp11a1 In Complex With 1e-04
2vrv_A431 Structure Of Histidine Tagged Cytochrome P450 Eryk 1e-04
2jjn_A411 Structure Of Closed Cytochrome P450 Eryk Length = 4 1e-04
2p85_A476 Structure Of Human Lung Cytochrome P450 2a13 With I 2e-04
1og2_A475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 3e-04
1r9o_A477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 3e-04
4gqs_A477 Structure Of Human Microsomal Cytochrome P450 (cyp) 4e-04
1dt6_A473 Structure Of Mammalian Cytochrome P450 2c5 Length = 5e-04
1gwi_A411 The 1.92 A Structure Of Streptomyces Coelicolor A3( 6e-04
3dbg_A467 Crystal Structure Of Cytochrome P450 170a1 (Cyp170a 7e-04
2f9q_A479 Crystal Structure Of Human Cytochrome P450 2d6 Leng 9e-04
>pdb|3QI8|B Chain B, Evolved Variant Of Cytochrome P450 (Bm3, Cyp102a1) Length = 472 Back     alignment and structure 
Iteration: 1

 Score = 71.6 bits (174), Expect = 1e-13,   Method: Composition-based stats.
 Identities = 39/90 (43%), Positives = 51/90 (56%), Gaps = 3/90 (3%)
Query: 8   GEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRI 67
           GEY +  G  L + I  +HRD   WGDD ++F P+RF    + ++  Q +F  FG G R 
Sbjct: 344 GEYPLEKGDELMVLIPQLHRDKTVWGDDVEEFRPERFE---NPSAIPQHAFKPFGNGQRA 400
Query: 68  CIGQNFALLEAKLALAMILHKFTFQLSPTY 97
           CIGQ FAL EA L L M+L  F F+    Y
Sbjct: 401 CIGQQFALHEATLVLGMMLKHFDFEDHTNY 430
>pdb|4DUF|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor Bound To Serotonin Length = 471 Back     alignment and structure
>pdb|4DUD|A Chain A, Cytochrome P450 Bm3h-2g9c6 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3EKB|A Chain A, Crystal Structure Of The A264c Mutant Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|1YQO|A Chain A, T268a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1SMI|A Chain A, A Single Mutation Of P450 Bm3 Induces The Conformational Rearrangement Seen Upon Substrate-Binding In Wild-Type Enzyme Length = 471 Back     alignment and structure
>pdb|1YQP|A Chain A, T268n Mutant Cytochrome Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|1JPZ|A Chain A, Crystal Structure Of A Complex Of The Heme Domain Of P450bm- 3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|1ZOA|A Chain A, Crystal Structure Of A328v Mutant Of The Heme Domain Of P450bm-3 With N-Palmitoylglycine Length = 473 Back     alignment and structure
>pdb|2BMH|A Chain A, Modeling Protein-Substrate Interactions In The Heme Domain Of Cytochrome P450bm-3 Length = 455 Back     alignment and structure
>pdb|4DUC|A Chain A, Cytochrome P450 Bm3h-2g9 Mri Sensor, No Ligand Length = 472 Back     alignment and structure
>pdb|3KX5|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1BVY|A Chain A, Complex Of The Heme And Fmn-Binding Domains Of The Cytochrome P450(Bm-3) Length = 458 Back     alignment and structure
>pdb|3DGI|A Chain A, Crystal Structure Of F87aT268A MUTANT OF CYP BM3 Length = 461 Back     alignment and structure
>pdb|4DU2|B Chain B, Cytochrome P450 Bm3h-B7 Mri Sensor Bound To Dopamine Length = 470 Back     alignment and structure
>pdb|2X7Y|A Chain A, P450 Bm3 F87a In Complex With Dmso Length = 455 Back     alignment and structure
>pdb|1ZO4|A Chain A, Crystal Structure Of A328s Mutant Of The Heme Domain Of P450bm-3 Length = 473 Back     alignment and structure
>pdb|2HPD|A Chain A, Crystal Structure Of Hemoprotein Domain Of P450bm-3, A Prototype For Microsomal P450's Length = 471 Back     alignment and structure
>pdb|1FAH|A Chain A, Structure Of Cytochrome P450 Length = 471 Back     alignment and structure
>pdb|3KX3|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|3EKF|A Chain A, Crystal Structure Of The A264q Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3EKD|A Chain A, Crystal Structure Of The A264m Heme Domain Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|3BEN|A Chain A, Structure Of N-(12-Imidazolyl-Dodecanoyl)-L-Leucine Inhibitor Bound To The Heme Domain Of Cytochrome P450-Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ2|A Chain A, Atomic Structure Of The Heme Domain Of Flavocytochrome P450- Bm3 Length = 470 Back     alignment and structure
>pdb|2IJ4|A Chain A, Structure Of The A264k Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DUB|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor Bound To Dopamine Length = 472 Back     alignment and structure
>pdb|2UWH|A Chain A, Cytochrome P450 Bm3 Mutant In Complex With Palmitic Acid Length = 458 Back     alignment and structure
>pdb|4DUA|A Chain A, Cytochrome P450 Bm3h-9d7 Mri Sensor, No Ligand Length = 471 Back     alignment and structure
>pdb|3M4V|A Chain A, Crystal Structure Of The A330p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|3NPL|A Chain A, Structure Of Ru(Bpy)2(A-Phen)(K97c) P450 Bm3 Heme Domain, A Ruthenium Modified P450 Bm3 Mutant Length = 470 Back     alignment and structure
>pdb|2IJ3|A Chain A, Structure Of The A264h Mutant Of Cytochrome P450 Bm3 Length = 470 Back     alignment and structure
>pdb|4DTW|B Chain B, Cytochrome P450 Bm3h-8c8 Mri Sensor Bound To Serotonin Length = 469 Back     alignment and structure
>pdb|3PSX|A Chain A, Crystal Structure Of The Kt2 Mutant Of Cytochrome P450 Bm3 Length = 487 Back     alignment and structure
>pdb|3CBD|A Chain A, Directed Evolution Of Cytochrome P450 Bm3, To Octane Monoxygenase 139-3 Length = 455 Back     alignment and structure
>pdb|1P0X|A Chain A, F393y Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3UA1|A Chain A, Crystal Structure Of The Cytochrome P4503a4-Bromoergocryptine Complex Length = 487 Back     alignment and structure
>pdb|1TQN|A Chain A, Crystal Structure Of Human Microsomal P450 3a4 Length = 486 Back     alignment and structure
>pdb|1W0E|A Chain A, Crystal Structure Of Human Cytochrome P450 3a4 Length = 485 Back     alignment and structure
>pdb|2NNB|A Chain A, The Q403k Mutnat Heme Domain Of Flavocytochrome P450 Bm3 Length = 471 Back     alignment and structure
>pdb|1P0W|A Chain A, F393w Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3HF2|A Chain A, Crystal Structure Of The I401p Mutant Of Cytochrome P450 Bm3 Length = 482 Back     alignment and structure
>pdb|1JME|A Chain A, Crystal Structure Of Phe393his Cytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|3KX4|A Chain A, Crystal Structure Of Bacillus Megaterium Bm3 Heme Domain Mut Length = 470 Back     alignment and structure
>pdb|1P0V|A Chain A, F393a Mutant Heme Domain Of Flavocytochrome P450 Bm3 Length = 455 Back     alignment and structure
>pdb|2Q9F|A Chain A, Crystal Structure Of Human Cytochrome P450 46a1 In Complex With Cholesterol-3-Sulphate Length = 456 Back     alignment and structure
>pdb|3L4D|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Leishmania Infantum In Complex With Fluconazole Length = 453 Back     alignment and structure
>pdb|2WUZ|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Cruzi In Complex With Fluconazole In Alternative Conformation Length = 473 Back     alignment and structure
>pdb|3K1O|A Chain A, Crystal Structure Of Sterol 14-alpha Demethylase (cyp51) From Trypanosoma Cruzi In Complex With A Potential Antichagasic Drug, Posaconazole Length = 458 Back     alignment and structure
>pdb|3KHM|A Chain A, Crystal Structure Of Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Cruzi In Complex With Inhibitor Fluconazole Length = 464 Back     alignment and structure
>pdb|3TIK|A Chain A, Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Complex With The Tipifarnib Derivative 6-((4-Chlorophenyl)(Methoxy)(1-Methyl- 1h-Imidazol-5-Yl)methyl)-4-(2, 6-Difluorophenyl)-1-Methylquinolin- 2(1h)-One Length = 454 Back     alignment and structure
>pdb|3P99|A Chain A, Sterol 14alpha-Demethylase (Cyp51) From Trypanosoma Brucei In Complex With Delta7-14alpha-Methylene-Cyclopropyl-Dihydrolanosterol Length = 453 Back     alignment and structure
>pdb|2WV2|A Chain A, X-Ray Structure Of Cyp51 From The Human Pathogen Trypanosoma Brucei In Complex With Fluconazole Length = 475 Back     alignment and structure
>pdb|2X2N|A Chain A, X-Ray Structure Of Cyp51 From Trypanosoma Brucei In Complex With Posaconazole In Two Different Conformations Length = 475 Back     alignment and structure
>pdb|3GW9|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei Bound To An Inhibitor N-(1-(2,4- Dichlorophenyl)-2-(1h-Imidazol-1-Yl)ethyl)-4-(5-Phenyl- 1,3, 4-Oxaziazol-2-Yl)benzamide Length = 450 Back     alignment and structure
>pdb|3G1Q|A Chain A, Crystal Structure Of Sterol 14-Alpha Demethylase (Cyp51) From Trypanosoma Brucei In Ligand Free State Length = 450 Back     alignment and structure
>pdb|1N97|A Chain A, Crystal Stucture Of Cyp175a1 From Thermus Thermophillus Strain Hb27 Length = 389 Back     alignment and structure
>pdb|3K9V|A Chain A, Crystal Structure Of Rat Mitochondrial P450 24a1 S57d In Complex With Chaps Length = 482 Back     alignment and structure
>pdb|2VE3|A Chain A, Retinoic Acid Bound Cyanobacterial Cyp120a1 Length = 444 Back     alignment and structure
>pdb|3QZ1|A Chain A, Crystal Structure Of Bovine Steroid Of 21-Hydroxylase (P450c21) Length = 496 Back     alignment and structure
>pdb|3LD6|A Chain A, Crystal Structure Of Human Lanosterol 14alpha-Demethylase (C Complex With Ketoconazole Length = 461 Back     alignment and structure
>pdb|3MZS|A Chain A, Crystal Structure Of Cytochrome P450 Cyp11a1 In Complex With 22- Hydroxy-Cholesterol Length = 486 Back     alignment and structure
>pdb|3C6G|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D3 Length = 479 Back     alignment and structure
>pdb|3CZH|A Chain A, Crystal Structure Of Cyp2r1 In Complex With Vitamin D2 Length = 481 Back     alignment and structure
>pdb|1WIY|A Chain A, Crystal Structure Analysis Of A 6-Coordinated Cytochorome P450 From Thermus Thermophilus Hb8 Length = 389 Back     alignment and structure
>pdb|1IO8|A Chain A, Thermophilic Cytochrome P450 (Cyp119) From Sulfolobus Solfataricus: High Resolution Structural Origin Of Its Thermostability And Functional Properties Length = 368 Back     alignment and structure
>pdb|3RUK|A Chain A, Human Cytochrome P450 Cyp17a1 In Complex With Abiraterone Length = 494 Back     alignment and structure
>pdb|1F4T|A Chain A, Thermophilic P450: Cyp119 From Sulfolobus Solfactaricus With 4- Phenylimidazole Bound Length = 368 Back     alignment and structure
>pdb|2HI4|A Chain A, Crystal Structure Of Human Microsomal P450 1a2 In Complex With Alpha-Naphthoflavone Length = 495 Back     alignment and structure
>pdb|3R9C|A Chain A, Crystal Structure Of Mycobacterium Smegmatis Cyp164a2 With Econazole Bound Length = 418 Back     alignment and structure
>pdb|3NA0|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With 20,22- Dihydroxycholesterol Length = 471 Back     alignment and structure
>pdb|3N9Y|A Chain A, Crystal Structure Of Human Cyp11a1 In Complex With Cholesterol Length = 487 Back     alignment and structure
>pdb|2VRV|A Chain A, Structure Of Histidine Tagged Cytochrome P450 Eryk In Complex With Inhibitor Clotrimazole (Clt) Length = 431 Back     alignment and structure
>pdb|2JJN|A Chain A, Structure Of Closed Cytochrome P450 Eryk Length = 411 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|1GWI|A Chain A, The 1.92 A Structure Of Streptomyces Coelicolor A3(2) Cyp154c1: A New Monooxygenase That Functionalizes Macrolide Ring Systems Length = 411 Back     alignment and structure
>pdb|3DBG|A Chain A, Crystal Structure Of Cytochrome P450 170a1 (Cyp170a1) From Streptomyces Coelicolor Length = 467 Back     alignment and structure
>pdb|2F9Q|A Chain A, Crystal Structure Of Human Cytochrome P450 2d6 Length = 479 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query120
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 1e-48
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 2e-47
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 3e-47
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 6e-37
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 3e-33
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-32
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 1e-31
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-31
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 2e-26
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 3e-26
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 6e-26
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 4e-25
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-24
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 4e-24
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-23
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 8e-23
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 1e-22
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 1e-20
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 1e-18
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 2e-14
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 2e-13
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-13
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 2e-13
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-13
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 3e-13
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 5e-13
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 6e-13
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 1e-12
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 1e-11
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 2e-07
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 9e-07
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 5e-06
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 8e-06
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 1e-05
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 1e-05
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 1e-05
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 2e-05
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 2e-05
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 2e-05
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 2e-05
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 2e-05
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 2e-05
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 3e-05
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 3e-05
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 3e-05
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 3e-05
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 3e-05
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 4e-05
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 4e-05
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 4e-05
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 4e-05
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 4e-05
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 5e-05
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 5e-05
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 6e-05
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 7e-05
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 7e-05
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 8e-05
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 8e-05
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 8e-05
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 9e-05
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 1e-04
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 1e-04
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 1e-04
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 1e-04
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 2e-04
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 2e-04
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 2e-04
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 2e-04
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 2e-04
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 4e-04
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 4e-04
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 4e-04
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 5e-04
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 6e-04
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* Length = 456 Back     alignment and structure
 Score =  160 bits (406), Expect = 1e-48
 Identities = 34/117 (29%), Positives = 51/117 (43%), Gaps = 4/117 (3%)

Query: 3   KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
           +E  +    +P    L      + R   Y+ +D   FNPDRF  G   A K + ++F F 
Sbjct: 328 EETLIDGVRVPGNTPLLFSTYVMGRMDTYF-EDPLTFNPDRFGPG---APKPRFTYFPFS 383

Query: 63  WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPTRGISVYPQHGANIILHK 119
            G R CIGQ FA +E K+ +A +L +  F+L P          ++ P       L  
Sbjct: 384 LGHRSCIGQQFAQMEVKVVMAKLLQRLEFRLVPGQRFGLQEQATLKPLDPVLCTLRP 440
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Length = 389 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Length = 450 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Length = 485 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Length = 495 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Length = 473 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 411 Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Length = 441 Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Length = 414 Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Length = 394 Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Length = 418 Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Length = 416 Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Length = 411 Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Length = 396 Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Length = 404 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Length = 408 Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Length = 413 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Length = 412 Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Length = 398 Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Length = 436 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Length = 408 Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Length = 404 Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Length = 404 Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Length = 396 Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Length = 415 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 1t2b_A* 3bdz_A* 3be0_A* Length = 398 Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Length = 417 Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Length = 426 Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} Length = 417 Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Length = 412 Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Length = 367 Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Length = 406 Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Length = 403 Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} PDB: 3ejd_B* 3eje_B* Length = 404 Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Length = 411 Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Length = 411 Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Length = 406 Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Length = 419 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Length = 425 Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Length = 343 Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Length = 368 Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Length = 381 Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Length = 435 Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} PDB: 3lxi_A* Length = 421 Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Length = 415 Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Length = 417 Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Length = 433 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} PDB: 3o1a_A* Length = 384 Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Length = 428 Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Length = 450 Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Length = 397 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Length = 398 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 99.98
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 99.97
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 99.97
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 99.97
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 99.97
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 99.97
3pm0_A507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 99.97
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.97
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 99.97
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.97
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 99.97
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.97
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 99.97
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 99.97
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 99.97
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 99.97
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.96
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.96
3gw9_A450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 99.96
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.96
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.96
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.96
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 99.96
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.96
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.96
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.96
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.96
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.96
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.96
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.96
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.96
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 99.96
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.96
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.96
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.96
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.95
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.95
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.95
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.95
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.95
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.95
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.95
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.95
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.95
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.95
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.95
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.95
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.95
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.95
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.95
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.95
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.95
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.95
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.95
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 99.95
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.95
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.95
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.95
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.94
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.94
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.94
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.94
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.94
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.94
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.93
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.93
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.93
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.93
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.92
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.91
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=3.5e-34  Score=210.84  Aligned_cols=117  Identities=21%  Similarity=0.413  Sum_probs=102.3

Q ss_pred             CccceEecCEEeCCCCEEEechhhhhcCCCCcCCCCCCeecCCCCCCcccccCCCcceeeecCCCCcChhHHHHHHHHHH
Q 041835            1 NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKL   80 (120)
Q Consensus         1 a~~d~~l~g~~ip~gt~v~~~~~~~~~d~~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~~   80 (120)
                      +.+|++++||.|||||.|+++.|++||||++| ++|++|+||||++++... .+...++|||+|+|.|+|++||.+|+++
T Consensus       356 ~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~-~dP~~F~PeRfl~~~~~~-~~~~~~~pFG~G~R~C~G~~lA~~e~~~  433 (479)
T 3tbg_A          356 TSRDIEVQGFRIPKGTTLITNLSSVLKDEAVW-EKPFRFHPEHFLDAQGHF-VKPEAFLPFSAGRRACLGEPLARMELFL  433 (479)
T ss_dssp             CSSCEEETTEEECTTCEEEEEHHHHHTCTTTS-SSTTSCCGGGGBCTTCCB-CCCTTCCTTCCSTTSCTTHHHHHHHHHH
T ss_pred             cCCCceECCEEecCCCeeeechhhhcCChhhC-CCccccCccccCCCCccc-CCCCceecCCCCCcCChhHHHHHHHHHH
Confidence            35799999999999999999999999999999 899999999999876543 3567899999999999999999999999


Q ss_pred             HHHHHhhhceeEeCCCCccCC---ccceEEeeCCCceEEEEEC
Q 041835           81 ALAMILHKFTFQLSPTYVHAP---TRGISVYPQHGANIILHKI  120 (120)
Q Consensus        81 ~l~~ll~~f~~~~~~~~~~~~---~~~~~~~p~~~~~v~~~~r  120 (120)
                      +++.||++|+++++++.....   ...++..|+ +++|++++|
T Consensus       434 ~la~ll~~f~~~~~~~~~~~~~~~~~~~~~~P~-~~~v~~~pR  475 (479)
T 3tbg_A          434 FFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPS-PYELCAVPR  475 (479)
T ss_dssp             HHHHHHHHEEEECCTTSCCCCSCEEESSSEEEC-CCCBEEEEC
T ss_pred             HHHHHHHccEEEeCCCCCCccccccceeeecCC-CeEEEEEEC
Confidence            999999999999987643222   235667786 899999997
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 120
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-25
d2ij2a1453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 1e-24
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-24
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-22
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 6e-21
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 2e-20
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 2e-19
d1gwia_403 a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyce 7e-19
d1cpta_428 a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas s 1e-18
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 1e-18
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 2e-18
d1jfba_399 a.104.1.1 (A:) Cytochrome P450-NOR, nitric reducta 8e-16
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 8e-16
d1lfka_394 a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatops 1e-15
d1s1fa_399 a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [ 2e-15
d1ueda_403 a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatops 4e-15
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 4e-15
d1n40a_395 a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {My 3e-14
d1ue8a_367 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodai 2e-13
d1re9a_404 a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas pu 2e-13
d1io7a_366 a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfata 2e-12
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 96.7 bits (239), Expect = 2e-25
 Identities = 38/119 (31%), Positives = 62/119 (52%), Gaps = 4/119 (3%)

Query: 3   KEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFG 62
           K++++    IP GV + +P   +HRD +YW  + +KF P+RFS+  +K + +   +  FG
Sbjct: 352 KDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFSKK-NKDNIDPYIYTPFG 409

Query: 63  WGPRICIGQNFALLEAKLALAMILHKFTFQLSPTYVHAPT--RGISVYPQHGANIILHK 119
            GPR CIG  FAL+  KLAL  +L  F+F+             G  + P+    + +  
Sbjct: 410 SGPRNCIGMRFALMNMKLALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVES 468
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 403 Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Length = 428 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Length = 399 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Length = 394 Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Length = 399 Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Length = 403 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 395 Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Length = 367 Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Length = 404 Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 366 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query120
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 99.97
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 99.97
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.97
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 99.97
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 99.97
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.96
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.96
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.96
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.96
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.96
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.95
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.95
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.95
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.95
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.94
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.94
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.94
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.94
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.93
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome P450 3a4
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.1e-33  Score=205.35  Aligned_cols=118  Identities=31%  Similarity=0.582  Sum_probs=104.8

Q ss_pred             CccceEecCEEeCCCCEEEechhhhhcCCCCcCCCCCCeecCCCCCCcccccCCCcceeeecCCCCcChhHHHHHHHHHH
Q 041835            1 NFKEIKLGEYIIPPGVFLSLPIIFVHRDHEYWGDDAKKFNPDRFSEGVSKASKNQISFFSFGWGPRICIGQNFALLEAKL   80 (120)
Q Consensus         1 a~~d~~l~g~~ip~gt~v~~~~~~~~~d~~~~~~~p~~f~P~R~l~~~~~~~~~~~~~~~Fg~G~~~C~G~~la~~~~~~   80 (120)
                      +.+|+.++||.|||||.|+++.+++|+||++| ++|++|+||||++.+... ..+..++|||+|+|.|+|+++|.+++++
T Consensus       350 ~~~d~~~~g~~ipkGt~v~~~~~~~~~d~~~~-~dp~~F~PeRfl~~~~~~-~~~~~~~~FG~G~r~C~G~~~A~~~~~~  427 (472)
T d1tqna_         350 CKKDVEINGMFIPKGVVVMIPSYALHRDPKYW-TEPEKFLPERFSKKNKDN-IDPYIYTPFGSGPRNCIGMRFALMNMKL  427 (472)
T ss_dssp             CCSCEEETTEEECTTCEEEECHHHHHTCTTTS-SSTTSCCGGGGSTTTGGG-CCTTTSCTTCCSTTSCTTHHHHHHHHHH
T ss_pred             cccCccccCceeCCCCEEEEechhhhcCchhC-CCccccCccccCCCCccc-CCCceecCCCCCCccChhHHHHHHHHHH
Confidence            46899999999999999999999999999999 899999999999876543 3567899999999999999999999999


Q ss_pred             HHHHHhhhceeEeCCCCc--cCCccceEEeeCCCceEEEEEC
Q 041835           81 ALAMILHKFTFQLSPTYV--HAPTRGISVYPQHGANIILHKI  120 (120)
Q Consensus        81 ~l~~ll~~f~~~~~~~~~--~~~~~~~~~~p~~~~~v~~~~r  120 (120)
                      +++.||++|+++++++..  .......++.|+.++.|++++|
T Consensus       428 ~la~ll~~f~~~~~~~~~~~~~~~~~~~~~p~~~~~~~~~~R  469 (472)
T d1tqna_         428 ALIRVLQNFSFKPCKETQIPLKLSLGGLLQPEKPVVLKVESR  469 (472)
T ss_dssp             HHHHHHTTEEEECCTTCCSSCCBCSSSSCCBSSCCEEEEEET
T ss_pred             HHHHHHHhCEEEeCCCCCCCceeccceEEeeCCCEEEEEEEC
Confidence            999999999999876643  2334466789999999999998
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure