Citrus Sinensis ID: 041867


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770------
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
ccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEccccccccccccHHHHHcccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccCEEECccHHcccccccccEEEcccccccCCcccccccccccccccEEEccccccccccccccccccccccEEEccccccCECcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccCEEECccccccccccccEEEccccccccccccccccccccccEEEccccccccEEEccccCEECccccccccccccccEEccccCCcccccHHHcccccccEEEccccccCECcccccccccccEEEccccccCCccccccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEEEEccccccccccccEEEEEEEEEcccEEEEccccccccEEEEcccccccccccHHHHccccccccccccccccccccccccccccccEEccccccccccccHHcccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcEEEEEEEEEECcccccc
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSP************DDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxHHHHHHHHHHHHHHHHHHHHxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2O6Q, chain A
Confidence level:very confident
Coverage over the Query: 395-435,472-526,580-692
View the alignment between query and template
View the model in PyMOL
Template: 1OGQ, chain A
Confidence level:very confident
Coverage over the Query: 334-368,379-431,468-525,580-697
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 110-372,385-454,468-524,578-667
View the alignment between query and template
View the model in PyMOL
Template: 4ECO, chain A
Confidence level:very confident
Coverage over the Query: 119-372,384-520
View the alignment between query and template
View the model in PyMOL
Template: 3T6Q, chain A
Confidence level:very confident
Coverage over the Query: 7-203,233-275,287-370,382-453,467-526,580-711
View the alignment between query and template
View the model in PyMOL
Template: 3RGZ, chain A
Confidence level:very confident
Coverage over the Query: 14-369,381-452,466-700
View the alignment between query and template
View the model in PyMOL