Citrus Sinensis ID: 041867


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------520-------530-------540-------550-------560-------570-------580-------590-------600-------610-------620-------630-------640-------650-------660-------670-------680-------690-------700-------710-------720-------730-------740-------750-------760-------770------
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
ccccccccEEEcccccccccccHHHHcccccccEEEccccccccccccccccccccccEEEccccccccccccHHHHHcccccccEEEcccccccccccccccccccccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccEEEccccEEEEEccHHcccccccccEEEcccccccEEcccccccccccccccEEEccccccccccccccccccccccEEEccccccEEEcccccccccccccEEEcccccccccccccccccccccEEEcccccccccccHHHHHccccccEEEccccEEEEEccccccccccccEEEccccccccccccccccccccccEEEccccccccEEEccccEEEEccccccccccccccEEccccEEcccccHHHcccccccEEEccccccEEEcccccccccccEEEccccccEEccccccccccccccccHHHHccccccEEEcccccccccccccccccccccEEEccccccccccccccccccccccccccccccccEEEEEccccccccccccEEEEEEEEEcccEEEEccccccccEEEEccccccccccHHHHHccccccccccccccccccccccccccccccEEccccccccccccHHcccccccccccccccccEEccccccccccccccccccccccccccccccccccccccccccccccccccccccEEEEHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcEEEEEEEEEEEcccccc
cccccccEEEEcccccccccccHHHHHHHHHccEEEcccccccccccHHHHHccccccEEEccccccccccccccHHHcccccccEEEcccccccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHHHccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHHccccccccEEEEEccccccccccccHHHcccccccEEEcccccccccccHHHHHccccccEEEEccccccccccHHHcccccccEEEEccccccccccHHHHHHHHcccEEEcccccccccccHHHccccccEEEEcccccccccccHHHHcccccccEEEEccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEcccccccccccHHHcccccEEEEEcccccccccccccccccccccccHHHccccccEEEEEccccccccccHHHccccccEEEEcccccccccccHHHccccccEEEEccccccccccccccccccccccHHHHHHHHHcccccccccHHHccccccEEEEcccccEEccccHHHHHcccccEEEEEEEccEEEccHHHHHcccccEEEccccEEEccccHHHHHcccccEEEccccccEEEccHHHHccccccEEEccccccccccccHHcccccccEccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEHHccccccccc
LHNFTNLEYLTLHGSSLHISLLQSIASIFpslknlsisycevngvvhgqgfphfkslehLGMMSTRIALNTNFLQVISESMPSLKYLSLSYstlgtnssrildrglcspvhlqelyigsndlrgslpwcmtnltslrildvssnqltgsisssplihlTSIEKlylsnnhfqipisleplfnhsrlktfyadnnelnaeitqshsltapnfqlsrlslssgyedgvtfpkflyhqhdletVELSHIkmngefptwllenntkLRQLSLVndslggpfrlpihshkrlgmldisnnnfrghipieigdvlpslylfnnsmnaldgsipsslgnmkFLQILDlsnnhltgeipehlAVGCVNLQSLALsnnnlqeglylnnnslsgkiprwlgnLTWLQYIImpnnhlegpipvefcQLDLLQildisdnnisgslpscfhplsikqvhLSKNMLhgqlkrdlsynrlngsipdwvDGLSQLSHLILGHNNLEGEVLVQLCELNqlqlldlsnnnlhgpippcfdnttlyesysnsssldeQFEIFFSiespqgnveKQIHEIFEFTTKNIVYIYQGKVLSLLsgldlscnkligpippqignltriqtlnlshndliglipstfsnlkhvesldlsnnklngkiphqlVELKTLEVFSVAYNNlsgeipewTAQFATfnessyegntflcglplpicrspatmseasignerddnlidmdsFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFvvdnliptrfyh
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISEsmpslkylslsystlgtnssRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVnlqslalsnnnlqEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCqldllqildiSDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVlvqlcelnqlqlldlsnnnlHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
***FTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSP************DDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRF**
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESY*****LDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCG****************************DSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
*HNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPT****
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiHHHHHHHHHHHHHHHHoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHoooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITSSYYFVVDNLIPTRFYH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query776 2.2.26 [Sep-21-2011]
Q9FIZ3 1252 LRR receptor-like serine/ no no 0.787 0.488 0.291 1e-54
Q9FL28 1173 LRR receptor-like serine/ no no 0.658 0.435 0.327 1e-52
Q9FZ59 1088 Leucine-rich repeat recep no no 0.677 0.483 0.319 2e-51
Q9ZWC8 1166 Serine/threonine-protein no no 0.802 0.534 0.303 6e-51
C0LGQ5 1249 LRR receptor-like serine/ no no 0.679 0.421 0.314 7e-51
Q9ZPS9 1143 Serine/threonine-protein no no 0.721 0.489 0.289 3e-50
Q9LJF3 1164 Receptor-like protein kin no no 0.800 0.533 0.302 2e-49
Q9LHP4 1141 Receptor-like protein kin no no 0.731 0.497 0.306 2e-49
Q8L899 1207 Systemin receptor SR160 O N/A no 0.822 0.528 0.294 6e-49
Q9LYN8 1192 Leucine-rich repeat recep no no 0.744 0.484 0.297 8e-49
>sp|Q9FIZ3|GSO2_ARATH LRR receptor-like serine/threonine-protein kinase GSO2 OS=Arabidopsis thaliana GN=GSO2 PE=2 SV=2 Back     alignment and function desciption
 Score =  215 bits (547), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 212/727 (29%), Positives = 328/727 (45%), Gaps = 116/727 (15%)

Query: 110 VHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNN 169
           V LQ L +  N+L G +P  + N TSL +   + N+L GS+ +  L  L +++ L L +N
Sbjct: 192 VQLQTLILQDNELEGPIPAEIGNCTSLALFAAAFNRLNGSLPAE-LNRLKNLQTLNLGDN 250

Query: 170 HF--QIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVT 227
            F  +IP  L  L +   L       N+L   I +  +  A    L  L LSS    GV 
Sbjct: 251 SFSGEIPSQLGDLVSIQYLNLI---GNQLQGLIPKRLTELA---NLQTLDLSSNNLTGVI 304

Query: 228 FPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRL 287
             +F +  + LE + L+  +++G  P  +  NNT L+QL L    L G     I + + L
Sbjct: 305 HEEF-WRMNQLEFLVLAKNRLSGSLPKTICSNNTSLKQLFLSETQLSGEIPAEISNCQSL 363

Query: 288 GMLDISNNNFRGHIPIEIGDV--LPSLYLFNNSM---------------------NALDG 324
            +LD+SNN   G IP  +  +  L +LYL NNS+                     N L+G
Sbjct: 364 KLLDLSNNTLTGQIPDSLFQLVELTNLYLNNNSLEGTLSSSISNLTNLQEFTLYHNNLEG 423

Query: 325 SIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQ------------ 372
            +P  +G +  L+I+ L  N  +GE+P  +   C  LQ +    N L             
Sbjct: 424 KVPKEIGFLGKLEIMYLYENRFSGEMPVEIG-NCTRLQEIDWYGNRLSGEIPSSIGRLKD 482

Query: 373 -EGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNIS 431
              L+L  N L G IP  LGN   +  I + +N L G IP  F  L  L++  I +N++ 
Sbjct: 483 LTRLHLRENELVGNIPASLGNCHQMTVIDLADNQLSGSIPSSFGFLTALELFMIYNNSLQ 542

Query: 432 GSLPSCFHPLS-IKQVHLSKNMLHGQL--------------------------------- 457
           G+LP     L  + +++ S N  +G +                                 
Sbjct: 543 GNLPDSLINLKNLTRINFSSNKFNGSISPLCGSSSYLSFDVTENGFEGDIPLELGKSTNL 602

Query: 458 -KRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHG 516
            +  L  N+  G IP     +S+LS L +  N+L G + V+L    +L  +DL+NN L G
Sbjct: 603 DRLRLGKNQFTGRIPRTFGKISELSLLDISRNSLSGIIPVELGLCKKLTHIDLNNNYLSG 662

Query: 517 PIPPCFDNTTLYESYSNSS------------SLDEQFEIFFSIESPQGNVEKQIHEIFEF 564
            IP       L      SS            SL     +F    S  G++ ++I  +   
Sbjct: 663 VIPTWLGKLPLLGELKLSSNKFVGSLPTEIFSLTNILTLFLDGNSLNGSIPQEIGNLQAL 722

Query: 565 TTKNI--------VYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQT-LNLSHNDL 615
              N+        +    GK LS L  L LS N L G IP +IG L  +Q+ L+LS+N+ 
Sbjct: 723 NALNLEENQLSGPLPSTIGK-LSKLFELRLSRNALTGEIPVEIGQLQDLQSALDLSYNNF 781

Query: 616 IGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFA 675
            G IPST S L  +ESLDLS+N+L G++P Q+ ++K+L   +++YNNL G++ +   QF+
Sbjct: 782 TGRIPSTISTLPKLESLDLSHNQLVGEVPGQIGDMKSLGYLNLSYNNLEGKLKK---QFS 838

Query: 676 TFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTS-YVIVIF 734
            +   ++ GN  LCG PL  C    + ++ S+  +            I+  +S   I + 
Sbjct: 839 RWQADAFVGNAGLCGSPLSHCNRAGSKNQRSLSPKT--------VVIISAISSLAAIALM 890

Query: 735 AIVIILY 741
            +VIIL+
Sbjct: 891 VLVIILF 897




Together with GSO1, receptor-like serine/threonine-kinase required during the development of the epidermal surface in embryos and cotyledons. Involved in the nuclear division phase of megagametogenesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1
>sp|Q9FL28|FLS2_ARATH LRR receptor-like serine/threonine-protein kinase FLS2 OS=Arabidopsis thaliana GN=FLS2 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ59|PEPR2_ARATH Leucine-rich repeat receptor-like protein kinase PEPR2 OS=Arabidopsis thaliana GN=PEPR2 PE=1 SV=1 Back     alignment and function description
>sp|Q9ZWC8|BRL1_ARATH Serine/threonine-protein kinase BRI1-like 1 OS=Arabidopsis thaliana GN=BRL1 PE=1 SV=1 Back     alignment and function description
>sp|C0LGQ5|GSO1_ARATH LRR receptor-like serine/threonine-protein kinase GSO1 OS=Arabidopsis thaliana GN=GSO1 PE=2 SV=1 Back     alignment and function description
>sp|Q9ZPS9|BRL2_ARATH Serine/threonine-protein kinase BRI1-like 2 OS=Arabidopsis thaliana GN=BRL2 PE=1 SV=1 Back     alignment and function description
>sp|Q9LJF3|BRL3_ARATH Receptor-like protein kinase BRI1-like 3 OS=Arabidopsis thaliana GN=BRL3 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHP4|RCH2_ARATH Receptor-like protein kinase 2 OS=Arabidopsis thaliana GN=RCH2 PE=1 SV=1 Back     alignment and function description
>sp|Q8L899|BRI1_SOLPE Systemin receptor SR160 OS=Solanum peruvianum PE=1 SV=1 Back     alignment and function description
>sp|Q9LYN8|EXS_ARATH Leucine-rich repeat receptor protein kinase EXS OS=Arabidopsis thaliana GN=EXS PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query776
255581263 912 serine-threonine protein kinase, plant-t 0.895 0.762 0.476 1e-175
224142481781 predicted protein [Populus trichocarpa] 0.885 0.879 0.470 1e-159
224123984 1016 predicted protein [Populus trichocarpa] 0.967 0.739 0.432 1e-159
224073436 1014 predicted protein [Populus trichocarpa] 0.974 0.745 0.418 1e-153
224134891 953 predicted protein [Populus trichocarpa] 0.957 0.779 0.423 1e-152
224112245876 predicted protein [Populus trichocarpa] 0.887 0.786 0.443 1e-151
224073422 969 predicted protein [Populus trichocarpa] 0.954 0.764 0.426 1e-150
224073382 1309 predicted protein [Populus trichocarpa] 0.846 0.501 0.451 1e-149
224098008 1097 predicted protein [Populus trichocarpa] 0.925 0.654 0.421 1e-147
224073452710 predicted protein [Populus trichocarpa] 0.810 0.885 0.453 1e-146
>gi|255581263|ref|XP_002531443.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223528936|gb|EEF30930.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  621 bits (1602), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 364/764 (47%), Positives = 472/764 (61%), Gaps = 69/764 (9%)

Query: 46  VHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRG 105
           +  Q  P+F++LE L +   +I L  +FLQ +   M SLK LSLS   L      +  +G
Sbjct: 168 IQAQDLPNFENLEELYL--DKIELENSFLQTVG-VMTSLKVLSLSGCGLTGALPNV--QG 222

Query: 106 LCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLY 165
           LC  +HL+ L + SN+  G LPWC++NLTSL++LD+SSNQ  G IS+SPL  L S+  L 
Sbjct: 223 LCELIHLRVLDVSSNEFHGILPWCLSNLTSLQLLDLSSNQFVGDISNSPLKILKSLVDLD 282

Query: 166 LSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDG 225
           +SNNHFQ+P SL P FNHS LK     NN +  E  + HS  AP FQL  + + SGY   
Sbjct: 283 VSNNHFQVPFSLGPFFNHSNLKHIRGQNNAIYLE-AELHS--APRFQLISI-IFSGYGIC 338

Query: 226 VTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHK 285
            TFP FLYHQ++L+ V+LSH+ + GEFP WLL NNT+L  L LVN+SL G  +LP+H H 
Sbjct: 339 GTFPNFLYHQNNLQFVDLSHLSLKGEFPNWLLTNNTRLEILDLVNNSLSGHLQLPLHPHV 398

Query: 286 RLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNH 345
            L  LDISNN+   HIP+EIG  LP L L N S N  DGSIPSS GNM  L+ILDLSNN 
Sbjct: 399 NLLALDISNNHVHDHIPLEIGTFLPKLELLNMSSNGFDGSIPSSFGNMNSLRILDLSNNQ 458

Query: 346 LTGEIPEHLAVGCVNLQSLALSNNNLQEGLY----------------------------- 376
           L+G IPEHLA GC +L +L LSNN+LQ  ++                             
Sbjct: 459 LSGSIPEHLATGCFSLNTLILSNNSLQGQMFSKQFNLTNLWWLELDKNHFSGRIPKSLSK 518

Query: 377 -------LNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNN 429
                  L++N LSG IP W+GNL++LQ +I+ NN L+GPIPVEFCQL  L++LD+++N+
Sbjct: 519 SALSIMDLSDNHLSGMIPGWIGNLSYLQNLILSNNRLKGPIPVEFCQLHYLEVLDLANNS 578

Query: 430 ISGSLPSCFHPLSIKQVHLSKNMLHGQ-----------LKRDLSYNRLNGSIPDWVDGLS 478
           +SG LPSC  P SI  VHLS+NM+ G            +  DLS NR+ G IP  + G++
Sbjct: 579 VSGILPSCLSPSSIIHVHLSQNMIEGPWTNAFSGSHFLVTLDLSSNRITGRIPTLIGGIN 638

Query: 479 QLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLD 538
            L  L L  N  +GE+  Q+C L QL L+ L++NNL G IP C     L +S S +  + 
Sbjct: 639 ALRILNLKSNRFDGEIPAQICGLYQLSLIVLADNNLSGSIPSCLQ---LDQSDSLAPDVP 695

Query: 539 EQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQ 598
                      P       +  ++ FTTK   Y YQGK+LS +SG+D SCNKL G IPP+
Sbjct: 696 PVPNPLNPYYLP-------VRPMY-FTTKRRSYSYQGKILSYISGIDFSCNKLTGEIPPE 747

Query: 599 IGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSV 658
           +GN + I +LNLS+N   G IPSTFSNLK +ESLDLS N LNG IP QL+ELK L  FSV
Sbjct: 748 MGNHSAIYSLNLSYNRFTGPIPSTFSNLKQIESLDLSYNNLNGDIPSQLLELKFLSYFSV 807

Query: 659 AYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICRSPATMSEASIGNERDD--NLI 716
           A+NNL G+ P+ T QFATF  SSYEGN  LCGLPLP   +    S A   +  D+  N +
Sbjct: 808 AHNNLFGKTPKRTGQFATFEVSSYEGNPNLCGLPLPKSCTEREASSAPRASAMDEESNFL 867

Query: 717 DMDSFFITFTTSYVIVIFAIVIILYVNSYWRRRWFYFVEMWITS 760
           DM++F+ +F  SY  VI  + ++LY+N  WRR WF FV++ I+S
Sbjct: 868 DMNTFYGSFIVSYTFVIIGMFLVLYINPQWRRAWFDFVDICISS 911




Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|224142481|ref|XP_002324585.1| predicted protein [Populus trichocarpa] gi|222866019|gb|EEF03150.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224123984|ref|XP_002330258.1| predicted protein [Populus trichocarpa] gi|222871714|gb|EEF08845.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073436|ref|XP_002304095.1| predicted protein [Populus trichocarpa] gi|222841527|gb|EEE79074.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224134891|ref|XP_002327515.1| predicted protein [Populus trichocarpa] gi|222836069|gb|EEE74490.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224112245|ref|XP_002332815.1| predicted protein [Populus trichocarpa] gi|222833209|gb|EEE71686.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073422|ref|XP_002304093.1| predicted protein [Populus trichocarpa] gi|222841525|gb|EEE79072.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073382|ref|XP_002304087.1| predicted protein [Populus trichocarpa] gi|222841519|gb|EEE79066.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224098008|ref|XP_002334579.1| predicted protein [Populus trichocarpa] gi|222873205|gb|EEF10336.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224073452|ref|XP_002304097.1| predicted protein [Populus trichocarpa] gi|222841529|gb|EEE79076.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query776
TAIR|locus:20373131000 RLP13 "AT1G74170" [Arabidopsis 0.931 0.723 0.284 1.6e-64
TAIR|locus:2040075935 RLP21 "AT2G25470" [Arabidopsis 0.796 0.660 0.306 1.8e-63
TAIR|locus:2155909908 RLP56 "AT5G49290" [Arabidopsis 0.747 0.638 0.323 5e-63
TAIR|locus:2101943891 RLP45 "AT3G53240" [Arabidopsis 0.765 0.666 0.315 9.1e-61
TAIR|locus:2019662965 RLP15 "AT1G74190" [Arabidopsis 0.747 0.601 0.3 6.8e-58
TAIR|locus:20250121083 RLP1 "AT1G07390" [Arabidopsis 0.802 0.575 0.291 2.3e-54
TAIR|locus:2122239 1136 AT4G36180 [Arabidopsis thalian 0.779 0.532 0.306 1.1e-53
TAIR|locus:2037308976 RLP14 "AT1G74180" [Arabidopsis 0.793 0.631 0.304 1.4e-50
TAIR|locus:2041150 1143 BRL2 "BRI1-like 2" [Arabidopsi 0.743 0.504 0.293 1.3e-47
TAIR|locus:2046585808 RLP27 "receptor like protein 2 0.756 0.726 0.299 3.1e-46
TAIR|locus:2037313 RLP13 "AT1G74170" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 638 (229.6 bits), Expect = 1.6e-64, Sum P(2) = 1.6e-64
 Identities = 227/799 (28%), Positives = 355/799 (44%)

Query:     1 LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQG-FPHFKSLEH 59
             L + TN+E L L  +  + S+          LK L +S  E +  V  QG F   K L  
Sbjct:   194 LRDLTNVELLDLSRNRFNGSIPVRALFALRKLKALDLSDNEFSSSVELQGKFAKTKPLSG 253

Query:    60 LGMMST--RIALNTNFLQVISEXXXXXXXXXXXXXXXXXXXXRILDRGLCSPVHLQELYI 117
                      + L+ N L                           +   L +   L+ L +
Sbjct:   254 TCPWKNMEELKLSNNKLAGQFPLCLTSLTGLRVLDLSSNQLTGNVPSALANLESLEYLSL 313

Query:   118 GSNDLRGSLPW-CMTNLTSLRIL--DVSSNQLTGSISSS--PLIHLT-------SIEKL- 164
               N+  G      + NL+ L++L  D  SN L     +S  P   L        ++EK+ 
Sbjct:   314 FGNNFEGFFSLGLLANLSKLKVLRLDSQSNSLEVEFETSWKPKFQLVVIALRSCNLEKVP 373

Query:   165 -YLSNNHFQIPISLEPLFNHSRLKTFYADNN-ELNAEITQSHSLTAPNFQLSRLSLSSGY 222
              +L +      + L     H    ++  +NN +L   + Q++S T+  FQL + + +  +
Sbjct:   374 HFLLHQKDLHHVDLSDNQIHGNFPSWLLENNTKLEVLLLQNNSFTS--FQLPKSAHNLLF 431

Query:   223 EDGVTFPKF--LYHQH------DLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLG 274
              + V+  KF  L+ Q+       L  V L++    G  P+  L+N   +  L L ++   
Sbjct:   432 LN-VSVNKFNHLFLQNFGWILPHLVCVNLAYNGFQGNLPS-SLDNMKSIEFLDLSHNRFH 489

Query:   275 GPFRLPIHSHK---RLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLG 331
             G  +LP    K    L +L +S+N   G +  E  +    L++ +   N   G+I     
Sbjct:   490 G--KLPRRFLKGCYNLTILKLSHNKLSGEVFPEAAN-FTRLWVMSMDNNLFTGNIGKGFR 546

Query:   332 NMKFLQILDLSNNHLTGEIPEHLAVGCVXXXXXXXXXXXXXEGLYLNNNSLSGKIPRWLG 391
             ++  L +LD+SNN LTG IP  +                    L L+NN L G+IP  L 
Sbjct:   547 SLPSLNVLDISNNKLTGVIPSWIG------------ERQGLFALQLSNNMLEGEIPTSLF 594

Query:   392 NLTWLQYIIMPNNHLEGPIPVEFCXXXXXXXXXXSDNNISGSLPSCFHPLSIKQVHLSKN 451
             N+++LQ + + +N L G IP               +NN+SG +P                
Sbjct:   595 NISYLQLLDLSSNRLSGDIPPHVSSIYHGAVLLLQNNNLSGVIPD--------------T 640

Query:   452 MLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVXXXXXXXXXXXXXXXXX 511
             +L   +  DL  NRL+G++P++++    +S L+L  NN  G++                 
Sbjct:   641 LLLNVIVLDLRNNRLSGNLPEFIN-TQNISILLLRGNNFTGQIPHQFCSLSNIQLLDLSN 699

Query:   512 XXXHGPIPPCFDNTTL----------YESYSNSSSLDEQ--FEIFFSIESPQGNVEKQIH 559
                +G IP C  NT+           Y+  S   +  +   FE    I+      E    
Sbjct:   700 NKFNGSIPSCLSNTSFGLRKGDDSYRYDVPSRFGTAKDPVYFESLLMIDEFNMVNETNSQ 759

Query:   560 EIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLI 619
                EF TK+    Y G  L LL G+DLS N+L G IP ++G L  ++ LNLSHN+L G+I
Sbjct:   760 TKIEFATKHRYDAYMGGNLKLLFGMDLSENELSGEIPVELGGLVELEALNLSHNNLSGVI 819

Query:   620 PSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNE 679
               +FS LK+VESLDLS N+L G IP QL ++ +L VF+V+YNNLSG +P+   QF TF  
Sbjct:   820 LESFSGLKNVESLDLSFNRLQGPIPLQLTDMISLAVFNVSYNNLSGIVPQGR-QFNTFET 878

Query:   680 SSYEGNTFLCGLPLPICRSPATMSEASIGNERDDNLIDMDSFFITFTTSYVIVIFAIVII 739
              SY GN  LCG  + I  +         G E D++ +DM+SF+ +F  +YV ++  I+  
Sbjct:   879 QSYFGNPLLCGKSIDISCASNNFHPTDNGVEADESTVDMESFYWSFVAAYVTILLGILAS 938

Query:   740 LYVNSYWRRRWFYFVEMWI 758
             L  +S W R WFY V+ ++
Sbjct:   939 LSFDSPWSRAWFYIVDAFV 957


GO:0007165 "signal transduction" evidence=IC
TAIR|locus:2040075 RLP21 "AT2G25470" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2155909 RLP56 "AT5G49290" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2101943 RLP45 "AT3G53240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2019662 RLP15 "AT1G74190" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025012 RLP1 "AT1G07390" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2122239 AT4G36180 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2037308 RLP14 "AT1G74180" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041150 BRL2 "BRI1-like 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2046585 RLP27 "receptor like protein 27" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
eugene3.00181059
hypothetical protein (781 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-51
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 1e-47
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 2e-24
PLN00113968 PLN00113, PLN00113, leucine-rich repeat receptor-l 4e-17
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-16
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-12
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 3e-11
PLN00113 968 PLN00113, PLN00113, leucine-rich repeat receptor-l 8e-10
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 1e-08
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-08
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 3e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 4e-06
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 4e-06
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 2e-05
cd00116319 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribo 1e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 6e-04
PLN03150623 PLN03150, PLN03150, hypothetical protein; Provisio 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 7e-04
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
pfam1385560 pfam13855, LRR_8, Leucine rich repeat 0.001
COG4886394 COG4886, COG4886, Leucine-rich repeat (LRR) protei 0.001
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
 Score =  192 bits (490), Expect = 4e-51
 Identities = 191/657 (29%), Positives = 278/657 (42%), Gaps = 124/657 (18%)

Query: 84  LKYLS---------LSYSTLGTNSSRILDRGLCSPVHLQELYIGSNDLRGSLPWCMTNLT 134
           LKYLS         L       NSSR+             + +   ++ G +   +  L 
Sbjct: 45  LKYLSNWNSSADVCLWQGITCNNSSRV-----------VSIDLSGKNISGKISSAIFRLP 93

Query: 135 SLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNN 194
            ++ +++S+NQL+G I        +S+  L LSNN+F   I    + N   L+T    NN
Sbjct: 94  YIQTINLSNNQLSGPIPDDIFTTSSSLRYLNLSNNNFTGSIPRGSIPN---LETLDLSNN 150

Query: 195 ELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPT 254
            L+ EI                      + G            L+ ++L    + G+ P 
Sbjct: 151 MLSGEIPN--------------------DIGSFS--------SLKVLDLGGNVLVGKIPN 182

Query: 255 WLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYL 314
            L  N T L  L+L ++ L G     +   K L  + +  NN  G IP EIG  L SL  
Sbjct: 183 SL-TNLTSLEFLTLASNQLVGQIPRELGQMKSLKWIYLGYNNLSGEIPYEIGG-LTSLNH 240

Query: 315 FNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEG 374
            +   N L G IPSSLGN+K LQ L L  N L+G IP  +      L SL LS+N     
Sbjct: 241 LDLVYNNLTGPIPSSLGNLKNLQYLFLYQNKLSGPIPPSI-FSLQKLISLDLSDN----- 294

Query: 375 LYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSL 434
                 SLSG+IP  +  L  L+ + + +N+  G IPV    L  LQ+L +  N  SG +
Sbjct: 295 ------SLSGEIPELVIQLQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGEI 348

Query: 435 PSCFHPLSIKQVHLSKNMLHGQLK-RDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGE 493
           P           +L K   H  L   DLS N L G IP+ +     L  LIL  N+LEGE
Sbjct: 349 PK----------NLGK---HNNLTVLDLSTNNLTGEIPEGLCSSGNLFKLILFSNSLEGE 395

Query: 494 VLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGN 553
           +   L     L+ + L +N+  G +P  F    L      S++            + QG 
Sbjct: 396 IPKSLGACRSLRRVRLQDNSFSGELPSEFTKLPLVYFLDISNN------------NLQGR 443

Query: 554 VEKQIHEIFEFTTKNI-VYIYQGKVLSL-----LSGLDLSCNKLIGPIPPQIGNLTRIQT 607
           +  +  ++      ++    + G +        L  LDLS N+  G +P ++G+L+ +  
Sbjct: 444 INSRKWDMPSLQMLSLARNKFFGGLPDSFGSKRLENLDLSRNQFSGAVPRKLGSLSELMQ 503

Query: 608 LNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEI 667
           L LS N L G IP   S+ K + SLDLS+N+L+G+IP    E+  L    ++ N LSGEI
Sbjct: 504 LKLSENKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEI 563

Query: 668 PE-----------------------WTAQFATFNESSYEGNTFLCG----LPLPICR 697
           P+                        T  F   N S+  GN  LCG      LP C+
Sbjct: 564 PKNLGNVESLVQVNISHNHLHGSLPSTGAFLAINASAVAGNIDLCGGDTTSGLPPCK 620


Length = 968

>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|215061 PLN00113, PLN00113, leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|238064 cd00116, LRR_RI, Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|178695 PLN03150, PLN03150, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|206026 pfam13855, LRR_8, Leucine rich repeat Back     alignment and domain information
>gnl|CDD|227223 COG4886, COG4886, Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 776
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
PLN00113 968 leucine-rich repeat receptor-like protein kinase; 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG4194 873 consensus Membrane glycoprotein LIG-1 [Signal tran 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0472565 consensus Leucine-rich repeat protein [Function un 100.0
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.98
KOG0618 1081 consensus Serine/threonine phosphatase 2C containi 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.97
KOG0444 1255 consensus Cytoskeletal regulator Flightless-I (con 99.96
KOG4237498 consensus Extracellular matrix protein slit, conta 99.92
KOG4237498 consensus Extracellular matrix protein slit, conta 99.91
PLN03210 1153 Resistant to P. syringae 6; Provisional 99.86
PLN032101153 Resistant to P. syringae 6; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.85
PRK15387 788 E3 ubiquitin-protein ligase SspH2; Provisional 99.81
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.75
PRK15370 754 E3 ubiquitin-protein ligase SlrP; Provisional 99.73
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.69
cd00116319 LRR_RI Leucine-rich repeats (LRRs), ribonuclease i 99.68
KOG0617264 consensus Ras suppressor protein (contains leucine 99.65
PLN03150623 hypothetical protein; Provisional 99.51
KOG0617264 consensus Ras suppressor protein (contains leucine 99.5
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.18
KOG1259490 consensus Nischarin, modulator of integrin alpha5 99.14
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.14
PLN03150623 hypothetical protein; Provisional 99.13
KOG3207505 consensus Beta-tubulin folding cofactor E [Posttra 99.09
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.07
PF14580175 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQ 99.07
KOG0532 722 consensus Leucine-rich repeat (LRR) protein, conta 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.06
KOG1909382 consensus Ran GTPase-activating protein [RNA proce 99.02
COG4886394 Leucine-rich repeat (LRR) protein [Function unknow 99.0
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.95
KOG1259490 consensus Nischarin, modulator of integrin alpha5 98.95
PF1385561 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RF 98.92
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.75
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.67
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.67
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.62
KOG0531414 consensus Protein phosphatase 1, regulatory subuni 98.58
KOG1859 1096 consensus Leucine-rich repeat proteins [General fu 98.49
KOG4658889 consensus Apoptotic ATPase [Signal transduction me 98.45
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.35
KOG2120419 consensus SCF ubiquitin ligase, Skp2 component [Po 98.34
KOG2982418 consensus Uncharacterized conserved protein [Funct 98.34
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.3
COG5238388 RNA1 Ran GTPase-activating protein (RanGAP) involv 98.08
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 98.07
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 98.04
KOG4341483 consensus F-box protein containing LRR [General fu 98.0
KOG4579177 consensus Leucine-rich repeat (LRR) protein associ 97.95
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.93
KOG3665699 consensus ZYG-1-like serine/threonine protein kina 97.88
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
PF1279944 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_ 97.84
KOG1644233 consensus U2-associated snRNP A' protein [RNA proc 97.79
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.66
KOG4341483 consensus F-box protein containing LRR [General fu 97.56
PF13306129 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_ 97.51
PRK15386 426 type III secretion protein GogB; Provisional 97.38
PRK15386426 type III secretion protein GogB; Provisional 97.26
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 97.23
KOG2739260 consensus Leucine-rich acidic nuclear protein [Cel 96.71
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.54
KOG2123388 consensus Uncharacterized conserved protein [Funct 96.53
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.18
KOG1947482 consensus Leucine rich repeat proteins, some prote 96.11
TIGR00864 2740 PCC polycystin cation channel protein. Note: this 94.83
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.64
PF0056022 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Le 94.64
KOG4308478 consensus LRR-containing protein [Function unknown 92.57
KOG4308478 consensus LRR-containing protein [Function unknown 92.01
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.89
smart0037026 LRR Leucine-rich repeats, outliers. 91.89
smart0037026 LRR Leucine-rich repeats, outliers. 91.25
smart0036926 LRR_TYP Leucine-rich repeats, typical (most popula 91.25
KOG0473326 consensus Leucine-rich repeat protein [Function un 90.6
PF1350417 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OO 90.23
KOG0473 326 consensus Leucine-rich repeat protein [Function un 89.54
KOG3864221 consensus Uncharacterized conserved protein [Funct 88.71
KOG4242553 consensus Predicted myosin-I-binding protein [Cell 86.52
PF1351624 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RI 84.71
KOG3864221 consensus Uncharacterized conserved protein [Funct 80.59
>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
Probab=100.00  E-value=4.5e-60  Score=566.79  Aligned_cols=542  Identities=32%  Similarity=0.459  Sum_probs=427.3

Q ss_pred             CCCCEEeCCCCcCccccCCCcCCCCCCCcEEeCCCCccccCcchhHHHHhcCCCccEEEccCCCCCCCCCCcCCcCCCCC
Q 041867           30 PSLKNLSISYCEVNGVVHGQGFPHFKSLEHLGMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSP  109 (776)
Q Consensus        30 ~~L~~L~Ls~n~~~~~~~~~~~~~l~~L~~L~l~~~~i~~~~~~~~~~~~~l~~L~~L~L~~n~i~~~~~~~~~~~l~~l  109 (776)
                      .+++.|+|++|.+.+.++. .|..+++|++|++++|  .+.+.++..++..+++|++|++++|.+.+   .++.   +.+
T Consensus        69 ~~v~~L~L~~~~i~~~~~~-~~~~l~~L~~L~Ls~n--~~~~~ip~~~~~~l~~L~~L~Ls~n~l~~---~~p~---~~l  139 (968)
T PLN00113         69 SRVVSIDLSGKNISGKISS-AIFRLPYIQTINLSNN--QLSGPIPDDIFTTSSSLRYLNLSNNNFTG---SIPR---GSI  139 (968)
T ss_pred             CcEEEEEecCCCccccCCh-HHhCCCCCCEEECCCC--ccCCcCChHHhccCCCCCEEECcCCcccc---ccCc---ccc
Confidence            4677888888887766655 6778888888888888  55566676666578888888888888766   4443   456


Q ss_pred             CCCCEEEccCCccccccCccccCCCCCCEEeCCCCcCcccCCcccccCCCCCCEEeccCCccccccCcccccCCCCCcEE
Q 041867          110 VHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTF  189 (776)
Q Consensus       110 ~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~i~~~~~~~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L  189 (776)
                      ++|++|+|++|.+++..|..++++++|++|++++|.+.+.+|. .+.++++|++|++++|.+.+.++ ..+..+++|++|
T Consensus       140 ~~L~~L~Ls~n~~~~~~p~~~~~l~~L~~L~L~~n~l~~~~p~-~~~~l~~L~~L~L~~n~l~~~~p-~~l~~l~~L~~L  217 (968)
T PLN00113        140 PNLETLDLSNNMLSGEIPNDIGSFSSLKVLDLGGNVLVGKIPN-SLTNLTSLEFLTLASNQLVGQIP-RELGQMKSLKWI  217 (968)
T ss_pred             CCCCEEECcCCcccccCChHHhcCCCCCEEECccCcccccCCh-hhhhCcCCCeeeccCCCCcCcCC-hHHcCcCCccEE
Confidence            7788888888888777788888888888888888887766666 77888888888888888775554 456777788888


Q ss_pred             EcccCcccccccccccCCCCCcccceEeccCCCCCCcccCccccCCCCcCEEEcCCCCCcccCChHHhhcCCCCcEEEcc
Q 041867          190 YADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLV  269 (776)
Q Consensus       190 ~l~~n~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~L~  269 (776)
                      ++++|.+.                            +.+|..+..+++|+.|++++|.+.+.+|..+ +++++|+.|+++
T Consensus       218 ~L~~n~l~----------------------------~~~p~~l~~l~~L~~L~L~~n~l~~~~p~~l-~~l~~L~~L~L~  268 (968)
T PLN00113        218 YLGYNNLS----------------------------GEIPYEIGGLTSLNHLDLVYNNLTGPIPSSL-GNLKNLQYLFLY  268 (968)
T ss_pred             ECcCCccC----------------------------CcCChhHhcCCCCCEEECcCceeccccChhH-hCCCCCCEEECc
Confidence            77776543                            2345566677777777777777777777665 677777777777


Q ss_pred             CCCCcCcCCCCCCCCCCcCEEEceeccCcccCChhhhccCcccceeecccccCccCCCccCCCCCCCCEEEccCCcCCCc
Q 041867          270 NDSLGGPFRLPIHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGE  349 (776)
Q Consensus       270 ~n~~~~~~~~~~~~~~~L~~L~ls~n~l~~~~~~~~~~~l~~L~~L~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~l~~~  349 (776)
                      +|.+.+..+..+..+++|+.|++++|.+.+.+|..+.. +++|+.|++++|.+.+..|..+..+++|+.|++++|.+.+.
T Consensus       269 ~n~l~~~~p~~l~~l~~L~~L~Ls~n~l~~~~p~~~~~-l~~L~~L~l~~n~~~~~~~~~~~~l~~L~~L~L~~n~l~~~  347 (968)
T PLN00113        269 QNKLSGPIPPSIFSLQKLISLDLSDNSLSGEIPELVIQ-LQNLEILHLFSNNFTGKIPVALTSLPRLQVLQLWSNKFSGE  347 (968)
T ss_pred             CCeeeccCchhHhhccCcCEEECcCCeeccCCChhHcC-CCCCcEEECCCCccCCcCChhHhcCCCCCEEECcCCCCcCc
Confidence            77777767777777777777777777777666666554 67777788877777777777777778888888888877766


Q ss_pred             CchhhhhcCCCCcEEEccCccccceEecCCCcCCCCCCccccCCCCCCEEeccCCccccCCCcccCCCCCCcEEEccccc
Q 041867          350 IPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNN  429 (776)
Q Consensus       350 ~~~~~~~~l~~L~~L~ls~n~l~~~l~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~ls~n~  429 (776)
                      +|..+. .+++|+.|++++|+           +.+..|..+..+++|+.|++++|.+.+..|..+..+++|+.|++++|.
T Consensus       348 ~p~~l~-~~~~L~~L~Ls~n~-----------l~~~~p~~~~~~~~L~~L~l~~n~l~~~~p~~~~~~~~L~~L~L~~n~  415 (968)
T PLN00113        348 IPKNLG-KHNNLTVLDLSTNN-----------LTGEIPEGLCSSGNLFKLILFSNSLEGEIPKSLGACRSLRRVRLQDNS  415 (968)
T ss_pred             CChHHh-CCCCCcEEECCCCe-----------eEeeCChhHhCcCCCCEEECcCCEecccCCHHHhCCCCCCEEECcCCE
Confidence            666544 57777777744443           445667777777778888888888877777777788888888888888


Q ss_pred             cCCCCCCCCC-CCcccEEEcCCcccCcccccccCCccccccCChhhccCccCCEEEcccccCCccchhhhcCCCCCCEEe
Q 041867          430 ISGSLPSCFH-PLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLD  508 (776)
Q Consensus       430 l~~~~~~~~~-~~~L~~L~l~~n~l~~~~~~~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~  508 (776)
                      +.+..+..+. ++.|+.+++++|.+             ++.++..+..+++|+.|++++|++.+..|..+ ..++|+.|+
T Consensus       416 l~~~~p~~~~~l~~L~~L~Ls~N~l-------------~~~~~~~~~~l~~L~~L~L~~n~~~~~~p~~~-~~~~L~~L~  481 (968)
T PLN00113        416 FSGELPSEFTKLPLVYFLDISNNNL-------------QGRINSRKWDMPSLQMLSLARNKFFGGLPDSF-GSKRLENLD  481 (968)
T ss_pred             eeeECChhHhcCCCCCEEECcCCcc-------------cCccChhhccCCCCcEEECcCceeeeecCccc-ccccceEEE
Confidence            7776666555 67777775555544             34566667788999999999999988777655 468999999


Q ss_pred             CCCCcccCCCCCCCcCCcccccccCCCCcchhhhcccccCCCCCCccccccceeeeeecceEEEeccccccccceEEccC
Q 041867          509 LSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSC  588 (776)
Q Consensus       509 Ls~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~L~~L~Ls~  588 (776)
                      +++|++.+..|..+..++                                                     +|+.|+|++
T Consensus       482 ls~n~l~~~~~~~~~~l~-----------------------------------------------------~L~~L~Ls~  508 (968)
T PLN00113        482 LSRNQFSGAVPRKLGSLS-----------------------------------------------------ELMQLKLSE  508 (968)
T ss_pred             CcCCccCCccChhhhhhh-----------------------------------------------------ccCEEECcC
Confidence            999999988888776544                                                     899999999


Q ss_pred             CcCCCCChhhhccCccCCeeecccccccccCccccCCCCCCCEEECcCCccCCcCCccccCCCCCCEEecccccCcccCC
Q 041867          589 NKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIP  668 (776)
Q Consensus       589 n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~l~~N~l~~~~p  668 (776)
                      |.+.+.+|..+..+++|++|+|++|.+++.+|..|..+++|+.|+|++|++++.+|..+..+++|+.|++++|++++.+|
T Consensus       509 N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~~~~l~~L~~L~Ls~N~l~~~~p~~l~~l~~L~~l~ls~N~l~~~~p  588 (968)
T PLN00113        509 NKLSGEIPDELSSCKKLVSLDLSHNQLSGQIPASFSEMPVLSQLDLSQNQLSGEIPKNLGNVESLVQVNISHNHLHGSLP  588 (968)
T ss_pred             CcceeeCChHHcCccCCCEEECCCCcccccCChhHhCcccCCEEECCCCcccccCChhHhcCcccCEEeccCCcceeeCC
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CccccccccCcccccCCCCCCCCC
Q 041867          669 EWTAQFATFNESSYEGNTFLCGLP  692 (776)
Q Consensus       669 ~~~~~~~~l~~~~~~~n~~~c~~~  692 (776)
                      .. .++.++....+.|||..|+.+
T Consensus       589 ~~-~~~~~~~~~~~~~n~~lc~~~  611 (968)
T PLN00113        589 ST-GAFLAINASAVAGNIDLCGGD  611 (968)
T ss_pred             Cc-chhcccChhhhcCCccccCCc
Confidence            84 678888899999999999753



>PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG4194 consensus Membrane glycoprotein LIG-1 [Signal transduction mechanisms] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0472 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0618 consensus Serine/threonine phosphatase 2C containing leucine-rich repeats, similar to SCN circadian oscillatory protein (SCOP) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG0444 consensus Cytoskeletal regulator Flightless-I (contains leucine-rich and gelsolin repeats) [Cytoskeleton] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>KOG4237 consensus Extracellular matrix protein slit, contains leucine-rich and EGF-like repeats [Extracellular structures; Signal transduction mechanisms] Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PLN03210 Resistant to P Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15387 E3 ubiquitin-protein ligase SspH2; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>PRK15370 E3 ubiquitin-protein ligase SlrP; Provisional Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>cd00116 LRR_RI Leucine-rich repeats (LRRs), ribonuclease inhibitor (RI)-like subfamily Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG0617 consensus Ras suppressor protein (contains leucine-rich repeats) [Signal transduction mechanisms] Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PLN03150 hypothetical protein; Provisional Back     alignment and domain information
>KOG3207 consensus Beta-tubulin folding cofactor E [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF14580 LRR_9: Leucine-rich repeat; PDB: 2JE1_D 2JE0_A 2JQD_A Back     alignment and domain information
>KOG0532 consensus Leucine-rich repeat (LRR) protein, contains calponin homology domain [Cytoskeleton] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>KOG1909 consensus Ran GTPase-activating protein [RNA processing and modification; Nuclear structure; Signal transduction mechanisms] Back     alignment and domain information
>COG4886 Leucine-rich repeat (LRR) protein [Function unknown] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG1259 consensus Nischarin, modulator of integrin alpha5 subunit action [Signal transduction mechanisms; Cytoskeleton] Back     alignment and domain information
>PF13855 LRR_8: Leucine rich repeat; PDB: 2O6S_A 3A79_B 3RFS_A 3G39_A 3VQ2_A 3VQ1_B 2Z64_A 2Z66_C 3FXI_A 2Z63_A Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG0531 consensus Protein phosphatase 1, regulatory subunit, and related proteins [Signal transduction mechanisms] Back     alignment and domain information
>KOG1859 consensus Leucine-rich repeat proteins [General function prediction only] Back     alignment and domain information
>KOG4658 consensus Apoptotic ATPase [Signal transduction mechanisms] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2120 consensus SCF ubiquitin ligase, Skp2 component [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>COG5238 RNA1 Ran GTPase-activating protein (RanGAP) involved in mRNA processing and transport [Signal transduction mechanisms / RNA processing and modification] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>KOG4579 consensus Leucine-rich repeat (LRR) protein associated with apoptosis in muscle tissue [General function prediction only] Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>KOG3665 consensus ZYG-1-like serine/threonine protein kinases [General function prediction only] Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>PF12799 LRR_4: Leucine Rich repeats (2 copies); PDB: 2OMT_A 1XEU_A 2OMX_A 2OMU_A 2UZY_A 2WQU_D 1D0B_A 2WQW_A 1OTO_A 2WQV_B Back     alignment and domain information
>KOG1644 consensus U2-associated snRNP A' protein [RNA processing and modification] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>KOG4341 consensus F-box protein containing LRR [General function prediction only] Back     alignment and domain information
>PF13306 LRR_5: Leucine rich repeats (6 copies); PDB: 3ZYJ_A 3V47_B 3V44_A 3ZYN_A 3ZYO_A 3SB4_A Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>PRK15386 type III secretion protein GogB; Provisional Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2739 consensus Leucine-rich acidic nuclear protein [Cell cycle control, cell division, chromosome partitioning; General function prediction only] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG2123 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>KOG1947 consensus Leucine rich repeat proteins, some proteins contain F-box [General function prediction only] Back     alignment and domain information
>TIGR00864 PCC polycystin cation channel protein Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>PF00560 LRR_1: Leucine Rich Repeat; InterPro: IPR001611 Leucine-rich repeats (LRR) consist of 2-45 motifs of 20-30 amino acids in length that generally folds into an arc or horseshoe shape [] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>KOG4308 consensus LRR-containing protein [Function unknown] Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00370 LRR Leucine-rich repeats, outliers Back     alignment and domain information
>smart00369 LRR_TYP Leucine-rich repeats, typical (most populated) subfamily Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>PF13504 LRR_7: Leucine rich repeat; PDB: 3OJA_B 3G06_A 1OOK_G 1QYY_G 1SQ0_B 1P9A_G 1GWB_A 1P8V_A 1M0Z_A 1U0N_D Back     alignment and domain information
>KOG0473 consensus Leucine-rich repeat protein [Function unknown] Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4242 consensus Predicted myosin-I-binding protein [Cell motility] Back     alignment and domain information
>PF13516 LRR_6: Leucine Rich repeat; PDB: 3RGZ_A 3RJ0_A 3RIZ_A 3RGX_A 1DFJ_I 2BNH_A 3VQ1_A 3VQ2_A 2Z64_A 2OMX_A Back     alignment and domain information
>KOG3864 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
3riz_A772 Crystal Structure Of The Plant Steroid Receptor Bri 3e-37
3riz_A 772 Crystal Structure Of The Plant Steroid Receptor Bri 8e-19
3rgx_A768 Structural Insight Into Brassinosteroid Perception 3e-37
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 6e-18
3rgx_A 768 Structural Insight Into Brassinosteroid Perception 5e-05
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 3e-14
1ogq_A313 The Crystal Structure Of Pgip (Polygalacturonase In 5e-04
3e6j_A229 Crystal Structure Of Variable Lymphocyte Receptor ( 6e-04
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure

Iteration: 1

Score = 154 bits (388), Expect = 3e-37, Method: Compositional matrix adjust. Identities = 171/618 (27%), Positives = 272/618 (44%), Gaps = 55/618 (8%) Query: 112 LQELYIGSNDLRGS--LPWCMTN-LTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSN 168 L+ L + +N + G+ + W +++ L+ L +S N+++G + S ++L E L +S+ Sbjct: 150 LEVLDLSANSISGANVVGWVLSDGCGELKHLAISGNKISGDVDVSRCVNL---EFLDVSS 206 Query: 169 NHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTF 228 N+F I L + S L+ N+L+ + +++ S +L L++SS G Sbjct: 207 NNFSTGIPF--LGDCSALQHLDISGNKLSGDFSRAISTCT---ELKLLNISSNQFVGPIP 261 Query: 229 PKFLYHQHDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLG 288 P L L+ + L+ K GE P +L L L L + G S L Sbjct: 262 PLPL---KSLQYLSLAENKFTGEIPDFLSGACDTLTGLDLSGNHFYGAVPPFFGSCSLLE 318 Query: 289 MLDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKF-LQILDLSNNHLT 347 L +S+NNF G +P++ + L + + S N G +P SL N+ L LDLS+N+ + Sbjct: 319 SLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLTLDLSSNNFS 378 Query: 348 GEIPEHLAVGCVXXXXXXXXXXXXXEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLE 407 G I +L + LYL NN +GKIP L N + L + + N+L Sbjct: 379 GPILPNLC----------QNPKNTLQELYLQNNGFTGKIPPTLSNCSELVSLHLSFNYLS 428 Query: 408 GPIPVEFCXXXXXXXXXXSDNNISGSLPS-CFHPLSIKQVHLSKNMLHGQLKR------- 459 G IP N + G +P + +++ + L N L G++ Sbjct: 429 GTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTN 488 Query: 460 ----DLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVXXXXXXXXXXXXXXXXXXXXH 515 LS NRL G IP W+ L L+ L L +N+ G + + Sbjct: 489 LNWISLSNNRLTGEIPKWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFN 548 Query: 516 GPIPPC-FDNTTLYES---------YSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFT 565 G IP F + + Y + + ++ ++ QG +Q++ + Sbjct: 549 GTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKECHGAGNLLEFQGIRSEQLNRLSTRN 608 Query: 566 TKNIV-YIYQGKVLSLLSG------LDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGL 618 NI +Y G LD+S N L G IP +IG++ + LNL HND+ G Sbjct: 609 PCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGS 668 Query: 619 IPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFN 678 IP +L+ + LDLS+NKL+G+IP + L L ++ NNLSG IPE QF TF Sbjct: 669 IPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFP 727 Query: 679 ESSYEGNTFLCGLPLPIC 696 + + N LCG PLP C Sbjct: 728 PAKFLNNPGLCGYPLPRC 745
>pdb|3RIZ|A Chain A, Crystal Structure Of The Plant Steroid Receptor Bri1 Ectodomain Length = 772 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|3RGX|A Chain A, Structural Insight Into Brassinosteroid Perception By Bri1 Length = 768 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|1OGQ|A Chain A, The Crystal Structure Of Pgip (Polygalacturonase Inhibiting Protein), A Leucine Rich Repeat Protein Involved In Plant Defense Length = 313 Back     alignment and structure
>pdb|3E6J|A Chain A, Crystal Structure Of Variable Lymphocyte Receptor (Vlr) Rbc36 In Complex With H-Trisaccharide Length = 229 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query776
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-123
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-100
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 1e-97
3rgz_A 768 Protein brassinosteroid insensitive 1; phytohormon 3e-97
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 7e-67
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 8e-22
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-59
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 1e-53
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-51
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 4e-39
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 6e-31
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 2e-10
1ogq_A 313 PGIP-2, polygalacturonase inhibiting protein; inhi 3e-06
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 4e-59
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 6e-50
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-42
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 7e-41
3fxi_A605 TLR4, htoll, TOLL-like receptor 4; leucine rich re 1e-38
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 5e-57
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 1e-41
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 4e-41
4ecn_A 876 Leucine-rich repeat protein; leucine-rich repeats, 4e-38
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 2e-37
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 1e-56
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 3e-55
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 7e-52
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 2e-44
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 1e-42
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 5e-39
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 9e-37
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 5e-33
4eco_A 636 Uncharacterized protein; leucine-rich repeats, pro 2e-18
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-50
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 3e-41
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 1e-35
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 2e-32
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 2e-15
3t6q_A 606 CD180 antigen; protein-protein complex, leucine ri 7e-08
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 7e-50
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-33
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 4e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 9e-14
3vq2_A 606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 1e-07
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 8e-42
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 1e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 9e-29
3j0a_A844 TOLL-like receptor 5; membrane protein, leucine-ri 7e-06
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-38
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 9e-36
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 2e-35
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 5e-30
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 7e-24
2z63_A 570 TOLL-like receptor 4, variable lymphocyte recepto; 3e-05
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-34
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 1e-32
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 3e-29
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 9e-27
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 5e-23
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-31
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 1e-24
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-24
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 2e-22
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 5e-20
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-31
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-29
4fmz_A347 Internalin; leucine rich repeat, structural genomi 1e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 2e-27
4fmz_A347 Internalin; leucine rich repeat, structural genomi 5e-24
4fmz_A347 Internalin; leucine rich repeat, structural genomi 7e-10
4fmz_A347 Internalin; leucine rich repeat, structural genomi 6e-08
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-30
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-23
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 3e-21
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-19
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 4e-18
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 2e-16
1o6v_A466 Internalin A; bacterial infection, extracellular r 5e-30
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-29
1o6v_A466 Internalin A; bacterial infection, extracellular r 9e-28
1o6v_A466 Internalin A; bacterial infection, extracellular r 2e-24
1o6v_A466 Internalin A; bacterial infection, extracellular r 4e-20
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 3e-28
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 2e-23
3g06_A622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 9e-14
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-28
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-24
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 2e-21
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 3e-16
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 4e-13
2id5_A 477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 1e-05
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-28
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 3e-18
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 2e-17
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 6e-10
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 5e-05
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 3e-27
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-24
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 5e-20
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 6e-17
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 2e-14
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 1e-11
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 3e-27
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-26
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-25
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-20
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 1e-19
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 7e-17
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-09
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 2e-07
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 6e-26
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 1e-23
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 8e-22
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 2e-10
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 1e-25
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-24
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 3e-23
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 2e-22
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 6e-16
3oja_B597 Anopheles plasmodium-responsive leucine-rich REPE 8e-09
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 9e-07
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 4e-25
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 8e-21
1jl5_A 454 Outer protein YOPM; leucine-rich repeat, molecular 2e-07
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-24
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 2e-20
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 1e-18
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 8e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 1e-23
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 8e-20
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 1e-16
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 6e-14
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 8e-13
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 6e-12
3cvr_A571 Invasion plasmid antigen; leucine rich repeat and 4e-10
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-23
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-18
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-12
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 7e-08
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 1e-05
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 4e-05
1xku_A 330 Decorin; proteoglycan, leucine-rich repeat, struct 6e-05
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-21
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-18
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 2e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 4e-16
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 1e-15
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-13
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 8e-12
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 5e-09
2z66_A 306 Variable lymphocyte receptor B, TOLL-like recepto; 9e-05
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 5e-21
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-17
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 4e-16
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 8e-15
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 1e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 9e-08
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-20
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 9e-19
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 1e-15
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 3e-12
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 4e-10
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 2e-09
3zyj_A 440 Leucine-rich repeat-containing protein 4C; cell ad 6e-05
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-20
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-19
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-15
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 2e-12
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 3e-10
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 1e-09
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-20
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-19
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 5e-18
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 7e-17
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-14
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 8e-11
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 3e-08
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 2e-07
3jqh_A167 C-type lectin domain family 4 member M; DC-signr, 1e-05
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 4e-20
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-15
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-14
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 3e-13
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 1e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 2e-10
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 9e-10
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 8e-20
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 3e-16
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-14
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-12
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 1e-09
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-19
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-15
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 1e-13
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 2e-12
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 4e-10
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 5e-07
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 3e-05
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 1e-18
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 6e-15
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-12
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 2e-08
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 9e-06
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 4e-17
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 6e-14
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-13
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-10
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 1e-08
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 5e-04
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-16
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 2e-13
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-09
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 5e-08
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 1e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 3e-07
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 4e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 4e-14
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 1e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 2e-06
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-05
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 7e-04
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 8e-04
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-14
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 8e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 9e-08
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 2e-05
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 8e-14
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-12
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-11
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 4e-10
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 1e-08
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 7e-07
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-06
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 2e-05
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-13
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 3e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 5e-13
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 4e-12
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 1e-11
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 7e-11
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 2e-10
1m9s_A605 Internalin B; cell invasion, GW domains, SH3 domai 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 4e-13
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 1e-12
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-10
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 2e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 6e-08
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-07
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 3e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-05
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 7e-04
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 9e-04
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 9e-13
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 3e-11
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 2e-09
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 6e-04
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 2e-12
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 1e-10
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 3e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-12
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 3e-11
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-09
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-08
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 1e-07
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 5e-07
2xot_A 361 Amphoterin-induced protein 1; cell adhesion, neuro 2e-06
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 4e-06
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 8e-12
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 1e-11
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 5e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 6e-10
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-09
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 3e-07
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 4e-05
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-11
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 8e-09
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 2e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 3e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 5e-07
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 4e-11
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 1e-06
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 3e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 3e-10
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-09
4ezg_A197 Putative uncharacterized protein; internalin-A, le 6e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 9e-08
4ezg_A197 Putative uncharacterized protein; internalin-A, le 8e-07
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 2e-05
4ezg_A197 Putative uncharacterized protein; internalin-A, le 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 4e-10
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 8e-08
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-06
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 9e-05
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 1e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 2e-04
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-10
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 4e-09
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 2e-08
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 4e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 5e-10
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 1e-09
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 7e-07
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-10
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-09
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 4e-08
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 8e-06
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 6e-05
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 1e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 2e-04
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 3e-04
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-09
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 8e-08
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-06
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 1e-05
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 4e-05
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 6e-09
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 8e-08
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 7e-06
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 2e-05
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 4e-04
2ifg_A347 High affinity nerve growth factor receptor; TRK, T 6e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 2e-06
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-05
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 2e-08
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-06
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 1e-04
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 3e-04
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 5e-08
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-06
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 3e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 4e-05
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 1e-04
3m19_A251 Variable lymphocyte receptor A diversity region; a 6e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 9e-08
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 4e-07
3m19_A251 Variable lymphocyte receptor A diversity region; a 2e-06
3m19_A251 Variable lymphocyte receptor A diversity region; a 3e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-07
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 4e-06
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-05
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 2e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 3e-04
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 8e-04
1w8a_A192 SLIT protein; signaling protein, secreted protein, 1e-06
1w8a_A192 SLIT protein; signaling protein, secreted protein, 7e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 2e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 4e-06
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
3e6j_A229 Variable lymphocyte receptor diversity region; var 3e-04
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 3e-06
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 4e-05
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-06
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 8e-05
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-04
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-06
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 2e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 3e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-05
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 9e-06
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 4e-04
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 7e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 5e-05
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 6e-04
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 6e-05
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 7e-04
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
 Score =  387 bits (996), Expect = e-123
 Identities = 177/722 (24%), Positives = 289/722 (40%), Gaps = 121/722 (16%)

Query: 1   LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHGQGFPHFKSLEHL 60
           L + + L++L +  ++L      S      SL+ L +S   ++G                
Sbjct: 122 LGSCSGLKFLNVSSNTLDFPGKVSGGLKLNSLEVLDLSANSISGANVVGWV--------- 172

Query: 61  GMMSTRIALNTNFLQVISESMPSLKYLSLSYSTLGTNSSRILDRGLCSPVHLQELYIGSN 120
                           +S+    LK+L++S + +   S  +    +   V+L+ L + SN
Sbjct: 173 ----------------LSDGCGELKHLAISGNKI---SGDV---DVSRCVNLEFLDVSSN 210

Query: 121 DLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLIHLTSIEKLYLSNNHFQIPISLEPL 180
           +    +P+ + + ++L+ LD+S N+L+G  S + +   T ++ L +S+N F  PI   P 
Sbjct: 211 NFSTGIPF-LGDCSALQHLDISGNKLSGDFSRA-ISTCTELKLLNISSNQFVGPI---PP 265

Query: 181 FNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQHDLET 240
                L+      N+   EI    S       L+ L LS  +  G   P F      LE+
Sbjct: 266 LPLKSLQYLSLAENKFTGEIPDFLSGACDT--LTGLDLSGNHFYG-AVPPFFGSCSLLES 322

Query: 241 VELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLPIHSHKRLGMLDISNNNFRGH 300
           + LS    +GE P   L     L+ L L                        S N F G 
Sbjct: 323 LALSSNNFSGELPMDTLLKMRGLKVLDL------------------------SFNEFSGE 358

Query: 301 IPIEIGDVLPSLYLFNNSMNALDGSIPSSLGN--MKFLQILDLSNNHLTGEIPEHLAVGC 358
           +P  + ++  SL   + S N   G I  +L       LQ L L NN  TG+IP  L+  C
Sbjct: 359 LPESLTNLSASLLTLDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NC 417

Query: 359 VNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPVEFCQLD 418
             L SL LS N            LSG IP  LG+L+ L+ + +  N LEG IP E   + 
Sbjct: 418 SELVSLHLSFNY-----------LSGTIPSSLGSLSKLRDLKLWLNMLEGEIPQELMYVK 466

Query: 419 LLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKR-DLSYNRLNGSIPDWVDGL 477
            L+ L +  N+++G +PS     +              L    LS NRL G IP W+  L
Sbjct: 467 TLETLILDFNDLTGEIPSGLSNCT-------------NLNWISLSNNRLTGEIPKWIGRL 513

Query: 478 SQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSL 537
             L+ L L +N+  G +  +L +   L  LDL+ N  +G IP      +   + +  +  
Sbjct: 514 ENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAG- 572

Query: 538 DEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVLSLLSGLDLSCNKLIGPIPP 597
               + +  I++     E                      LS  +  +++     G   P
Sbjct: 573 ----KRYVYIKNDGMKKECHGAGNLLEFQGIRSEQL--NRLSTRNPCNITSRVYGGHTSP 626

Query: 598 QIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFS 657
              N   +  L++S+N L G IP    ++ ++  L+L +N ++G IP ++ +L+ L +  
Sbjct: 627 TFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHNDISGSIPDEVGDLRGLNILD 686

Query: 658 VAYNNLSGEIPE-----------------------WTAQFATFNESSYEGNTFLCGLPLP 694
           ++ N L G IP+                          QF TF  + +  N  LCG PLP
Sbjct: 687 LSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEMGQFETFPPAKFLNNPGLCGYPLP 746

Query: 695 IC 696
            C
Sbjct: 747 RC 748


>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Length = 768 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Length = 680 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Length = 313 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>3fxi_A TLR4, htoll, TOLL-like receptor 4; leucine rich repeat, glycoprotein, immune response, inflamma response, innate immunity, membrane, receptor; HET: PA1 KDO GMH FTT DAO MYR NAG GCS; 3.10A {Homo sapiens} Length = 605 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Length = 876 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Length = 636 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Length = 606 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Length = 844 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Length = 570 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Length = 549 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 487 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Length = 347 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Length = 328 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Length = 466 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Length = 622 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Length = 477 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Length = 562 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Length = 520 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Length = 390 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Length = 455 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Length = 597 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Length = 454 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Length = 317 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Length = 571 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Length = 330 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Length = 306 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Length = 332 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Length = 440 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Length = 452 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Length = 353 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Length = 457 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Length = 285 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Length = 312 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Length = 461 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Length = 276 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Length = 239 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Length = 350 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Length = 290 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Length = 605 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Length = 270 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Length = 592 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Length = 567 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Length = 361 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Length = 308 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Length = 291 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Length = 362 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Length = 197 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Length = 263 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Length = 386 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Length = 336 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Length = 594 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Length = 220 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Length = 347 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Length = 272 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Length = 176 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Length = 251 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Length = 198 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Length = 192 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Length = 229 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Length = 193 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Length = 168 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Length = 149 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Length = 208 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Length = 362 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Length = 372 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query776
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
3rgz_A768 Protein brassinosteroid insensitive 1; phytohormon 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
1ziw_A680 TOLL-like receptor 3; innate immunity, immune syst 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
3t6q_A606 CD180 antigen; protein-protein complex, leucine ri 100.0
3j0a_A 844 TOLL-like receptor 5; membrane protein, leucine-ri 100.0
3vq2_A606 TLR4, TOLL-like receptor 4; leucine rich repeat MD 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
2z63_A570 TOLL-like receptor 4, variable lymphocyte recepto; 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z81_A549 CD282 antigen, TOLL-like receptor 2, variable lymp 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
2z7x_B520 TOLL-like receptor 1, variable lymphocyte recepto; 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4eco_A636 Uncharacterized protein; leucine-rich repeats, pro 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
4ecn_A876 Leucine-rich repeat protein; leucine-rich repeats, 100.0
4g8a_A635 TOLL-like receptor 4; leucine rich repeat MD-2 rel 100.0
3a79_B562 TLR6, VLRB.59, TOLL-like receptor 6, variable lymp 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
3v47_A455 TOLL-like receptor 5B and variable lymphocyte REC 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
1jl5_A454 Outer protein YOPM; leucine-rich repeat, molecular 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
2id5_A477 Lingo-1, leucine rich repeat neuronal 6A; CNS-spec 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
1o6v_A466 Internalin A; bacterial infection, extracellular r 100.0
3bz5_A457 Internalin-J, INLJ; leucine rich repeat (LRR), cys 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
3o6n_A390 APL1; leucine-rich repeat, protein binding; HET: N 100.0
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 100.0
3oja_B 597 Anopheles plasmodium-responsive leucine-rich REPE 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.98
4fmz_A347 Internalin; leucine rich repeat, structural genomi 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.97
2ft3_A332 Biglycan; proteoglycan, dimer interface, structura 99.97
1ogq_A313 PGIP-2, polygalacturonase inhibiting protein; inhi 99.96
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.96
1xku_A330 Decorin; proteoglycan, leucine-rich repeat, struct 99.96
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
1z7x_W461 Ribonuclease inhibitor; leucine-rich repeat, enzym 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.96
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.96
2z66_A306 Variable lymphocyte receptor B, TOLL-like recepto; 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyj_A440 Leucine-rich repeat-containing protein 4C; cell ad 99.95
1ozn_A285 Reticulon 4 receptor; NOGO receptor, MAD, myelinat 99.95
3zyi_A452 Leucine-rich repeat-containing protein 4; cell adh 99.95
2z80_A353 TOLL-like receptor 2, variable lymphocyte recepto; 99.94
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.94
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.94
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3ogk_B592 Coronatine-insensitive protein 1; leucine rich rep 99.93
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.93
4fcg_A328 Uncharacterized protein; structural genomics, PSI- 99.93
3oja_A 487 Leucine-rich immune molecule 1; coiled-coil, helix 99.93
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.93
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.92
3o53_A317 Protein LRIM1, AGAP006348-PA; leucine-rich repeat, 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.92
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.92
1wwl_A312 Monocyte differentiation antigen CD14; LPS, immune 99.92
3g06_A 622 SSPH2 (leucine-rich repeat protein); E3 ubiquitin 99.92
2z62_A276 TOLL-like receptor 4, variable lymphocyte recepto; 99.91
3oja_A487 Leucine-rich immune molecule 1; coiled-coil, helix 99.91
2o6q_A270 Variable lymphocyte receptor A; leucine-rich repea 99.91
2p1m_B594 Transport inhibitor response 1 protein; F-BOX, leu 99.9
1p9a_G290 Platelet glycoprotein IB alpha chain precursor; pl 99.89
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.89
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3m19_A251 Variable lymphocyte receptor A diversity region; a 99.88
3rfs_A272 Internalin B, repeat modules, variable lymphocyte 99.88
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.86
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.86
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.86
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.85
2xwt_C239 Thyrotropin receptor; signaling protein-immune sys 99.85
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.85
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
3goz_A362 Leucine-rich repeat-containing protein; LEGL7, NES 99.84
4glp_A310 Monocyte differentiation antigen CD14; alpha beta 99.84
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.83
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.83
1h6u_A308 Internalin H; cell adhesion, leucine rich repeat, 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.82
4ay9_X350 Follicle-stimulating hormone receptor; hormone-rec 99.82
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.82
2ca6_A386 RAN GTPase-activating protein 1; GAP, GTPase activ 99.82
2ast_B336 S-phase kinase-associated protein 2; SCF-substrate 99.81
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.79
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.79
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.79
2v9t_B220 SLIT homolog 2 protein N-product; structural prote 99.78
2v70_A220 SLIT-2, SLIT homolog 2 protein N-product; neurogen 99.78
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.77
3e6j_A229 Variable lymphocyte receptor diversity region; var 99.77
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.76
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.76
2xot_A361 Amphoterin-induced protein 1; cell adhesion, neuro 99.75
2o6s_A208 Variable lymphocyte receptor B; leucine-rich repea 99.75
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.73
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.72
1h6t_A291 Internalin B; cell adhesion, leucine rich repeat, 99.72
3cvr_A 571 Invasion plasmid antigen; leucine rich repeat and 99.72
1w8a_A192 SLIT protein; signaling protein, secreted protein, 99.71
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.71
1m9s_A 605 Internalin B; cell invasion, GW domains, SH3 domai 99.71
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.69
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.66
4ezg_A197 Putative uncharacterized protein; internalin-A, le 99.65
3sb4_A329 Hypothetical leucine rich repeat protein; LRR, rig 99.65
1xeu_A263 Internalin C; cellular invasion, leucine-rich repe 99.65
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
4fdw_A401 Leucine rich hypothetical protein; putative cell s 99.64
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.63
1dce_A567 Protein (RAB geranylgeranyltransferase alpha subun 99.63
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.62
2o6r_A177 Variable lymphocyte receptor B; leucine-rich repea 99.6
2wfh_A193 SLIT homolog 2 protein C-product; developmental pr 99.6
4b8c_D 727 Glucose-repressible alcohol dehydrogenase transcr 99.6
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.6
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.58
4fs7_A394 Uncharacterized protein; leucine-rich repeats, pro 99.57
2ell_A168 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.56
4b8c_D727 Glucose-repressible alcohol dehydrogenase transcr 99.56
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.55
2je0_A149 Acidic leucine-rich nuclear phosphoprotein 32 FAM 99.54
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.51
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.51
3g39_A170 Variable lymphocyte receptor VLRB.2D; antibody, X- 99.48
1a9n_A176 U2A', U2A'; complex (nuclear protein/RNA), RNA, sn 99.46
2r9u_A174 Variable lymphocyte receptor; adaptive immunity, V 99.44
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.44
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.42
1ds9_A198 Outer arm dynein; leucine-rich repeat, beta-BETA-a 99.4
4gt6_A394 Cell surface protein; leucine rich repeats, putati 99.38
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.35
2ifg_A 347 High affinity nerve growth factor receptor; TRK, T 99.32
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.24
3un9_A372 NLR family member X1; leucine rich repeat (LRR), a 99.12
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.1
4h09_A379 Hypothetical leucine rich repeat protein; two LRR_ 99.0
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.67
2ra8_A362 Uncharacterized protein Q64V53_bacfr; WGR domain, 98.66
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.44
1io0_A185 Tropomodulin; LRR protein, right-handed super-heli 98.43
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 98.26
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.22
3rw6_A267 Nuclear RNA export factor 1; retroviral constituti 98.19
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.95
3e4g_A176 ATP synthase subunit S, mitochondrial; leucine-ric 97.85
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
1pgv_A197 TMD-1, tropomodulin TMD-1; structural genomics, PS 97.32
3rfe_A130 Platelet glycoprotein IB beta chain; platelet surf 97.17
>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
Probab=100.00  E-value=8.4e-70  Score=633.09  Aligned_cols=656  Identities=29%  Similarity=0.417  Sum_probs=526.5

Q ss_pred             CCCCCCCcEEECCCCCCCCccchhccCCCCCCCEEeCCCCcCccccCC-CcCCCCCCCcEEeCCCCccccCcchhHHHHh
Q 041867            1 LHNFTNLEYLTLHGSSLHISLLQSIASIFPSLKNLSISYCEVNGVVHG-QGFPHFKSLEHLGMMSTRIALNTNFLQVISE   79 (776)
Q Consensus         1 ~~~l~~L~~L~L~~n~~~~~~~~~~~~~~~~L~~L~Ls~n~~~~~~~~-~~~~~l~~L~~L~l~~~~i~~~~~~~~~~~~   79 (776)
                      |.++++|+.++++.+.+.. .+.. +..+++|++|+|++|.+.+.+|. ..+.++++|++|++++|  .+.+..+..+..
T Consensus        73 l~~L~~L~~l~~~~~~~~~-l~~~-~~~l~~L~~L~Ls~n~l~~~~~~~~~l~~l~~L~~L~Ls~n--~l~~~~~~~~~~  148 (768)
T 3rgz_A           73 LLSLTGLESLFLSNSHING-SVSG-FKCSASLTSLDLSRNSLSGPVTTLTSLGSCSGLKFLNVSSN--TLDFPGKVSGGL  148 (768)
T ss_dssp             TTTCTTCCEEECTTSCEEE-CCCC-CCCCTTCCEEECCSSEEEEEGGGGGGGGGCTTCCEEECCSS--EEECCSSCCSCC
T ss_pred             HhccCcccccCCcCCCcCC-Cchh-hccCCCCCEEECCCCcCCCcCCChHHHhCCCCCCEEECcCC--ccCCcCCHHHhc
Confidence            4567888888888876532 3355 88999999999999999876663 25888999999999999  555555555533


Q ss_pred             cCCCccEEEccCCCCCCCCCCcCCcC---CCCCCCCCEEEccCCccccccCccccCCCCCCEEeCCCCcCcccCCccccc
Q 041867           80 SMPSLKYLSLSYSTLGTNSSRILDRG---LCSPVHLQELYIGSNDLRGSLPWCMTNLTSLRILDVSSNQLTGSISSSPLI  156 (776)
Q Consensus        80 ~l~~L~~L~L~~n~i~~~~~~~~~~~---l~~l~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~~i~~~~~~  156 (776)
                      ++++|++|++++|.+++   ..+ ..   +.++++|++|++++|.+++..+  +..+++|++|++++|.+++.+|.  +.
T Consensus       149 ~l~~L~~L~Ls~n~l~~---~~~-~~~~~~~~l~~L~~L~Ls~n~l~~~~~--~~~l~~L~~L~Ls~n~l~~~~~~--l~  220 (768)
T 3rgz_A          149 KLNSLEVLDLSANSISG---ANV-VGWVLSDGCGELKHLAISGNKISGDVD--VSRCVNLEFLDVSSNNFSTGIPF--LG  220 (768)
T ss_dssp             CCTTCSEEECCSSCCEE---ETH-HHHHHTTCCTTCCEEECCSSEEESCCB--CTTCTTCCEEECCSSCCCSCCCB--CT
T ss_pred             cCCCCCEEECCCCccCC---cCC-hhhhhhccCCCCCEEECCCCcccccCC--cccCCcCCEEECcCCcCCCCCcc--cc
Confidence            88999999999999876   333 23   7888999999999999986554  47899999999999999865654  88


Q ss_pred             CCCCCCEEeccCCccccccCcccccCCCCCcEEEcccCcccccccccccCCCCCcccceEeccCCCCCCcccCccccCC-
Q 041867          157 HLTSIEKLYLSNNHFQIPISLEPLFNHSRLKTFYADNNELNAEITQSHSLTAPNFQLSRLSLSSGYEDGVTFPKFLYHQ-  235 (776)
Q Consensus       157 ~l~~L~~L~L~~n~l~~~~~~~~l~~l~~L~~L~l~~n~~~~~~~~~~~~~~~~~~L~~L~l~~~~~~~~~~~~~l~~~-  235 (776)
                      ++++|++|++++|.+++.++ ..+..+++|++|++++|.+.+..+..     ...+|+.|++ ..+.+.+.+|..+... 
T Consensus       221 ~l~~L~~L~Ls~n~l~~~~~-~~l~~l~~L~~L~Ls~n~l~~~~~~~-----~l~~L~~L~L-~~n~l~~~ip~~~~~~~  293 (768)
T 3rgz_A          221 DCSALQHLDISGNKLSGDFS-RAISTCTELKLLNISSNQFVGPIPPL-----PLKSLQYLSL-AENKFTGEIPDFLSGAC  293 (768)
T ss_dssp             TCCSCCEEECCSSCCCSCHH-HHTTTCSSCCEEECCSSCCEESCCCC-----CCTTCCEEEC-CSSEEEESCCCCSCTTC
T ss_pred             cCCCCCEEECcCCcCCCccc-HHHhcCCCCCEEECCCCcccCccCcc-----ccCCCCEEEC-cCCccCCccCHHHHhhc
Confidence            99999999999999886544 46888999999999999887544432     3458999999 7888888889888775 


Q ss_pred             CCcCEEEcCCCCCcccCChHHhhcCCCCcEEEccCCCCcCcCCCC-CCCCCCcCEEEceeccCcccCChhhhccCcccce
Q 041867          236 HDLETVELSHIKMNGEFPTWLLENNTKLRQLSLVNDSLGGPFRLP-IHSHKRLGMLDISNNNFRGHIPIEIGDVLPSLYL  314 (776)
Q Consensus       236 ~~L~~L~l~~~~~~~~~~~~~~~~l~~L~~L~L~~n~~~~~~~~~-~~~~~~L~~L~ls~n~l~~~~~~~~~~~l~~L~~  314 (776)
                      ++|++|++++|.+.+.+|..+ +++++|+.|++++|.+.+..+.. +..+++|++|++++|.+.+.+|..+....++|+.
T Consensus       294 ~~L~~L~Ls~n~l~~~~p~~~-~~l~~L~~L~L~~n~l~~~ip~~~l~~l~~L~~L~Ls~n~l~~~~p~~l~~l~~~L~~  372 (768)
T 3rgz_A          294 DTLTGLDLSGNHFYGAVPPFF-GSCSLLESLALSSNNFSGELPMDTLLKMRGLKVLDLSFNEFSGELPESLTNLSASLLT  372 (768)
T ss_dssp             TTCSEEECCSSEEEECCCGGG-GGCTTCCEEECCSSEEEEECCHHHHTTCTTCCEEECCSSEEEECCCTTHHHHTTTCSE
T ss_pred             CcCCEEECcCCcCCCccchHH-hcCCCccEEECCCCcccCcCCHHHHhcCCCCCEEeCcCCccCccccHHHHhhhcCCcE
Confidence            999999999999998899886 89999999999999998766654 8899999999999999998999888774349999


Q ss_pred             eecccccCccCCCccCCC--CCCCCEEEccCCcCCCcCchhhhhcCCCCcEEEccCccccceEecCCCcCCCCCCccccC
Q 041867          315 FNNSMNALDGSIPSSLGN--MKFLQILDLSNNHLTGEIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGN  392 (776)
Q Consensus       315 L~l~~n~l~~~~~~~~~~--l~~L~~L~l~~n~l~~~~~~~~~~~l~~L~~L~ls~n~l~~~l~l~~n~l~~~~~~~~~~  392 (776)
                      |++++|.+.+..|..+..  +++|++|++++|.+++.+|..+. .+++|+.|++++|           .+++..|..+..
T Consensus       373 L~Ls~N~l~~~~~~~~~~~~~~~L~~L~L~~n~l~~~~p~~l~-~l~~L~~L~Ls~N-----------~l~~~~p~~l~~  440 (768)
T 3rgz_A          373 LDLSSNNFSGPILPNLCQNPKNTLQELYLQNNGFTGKIPPTLS-NCSELVSLHLSFN-----------YLSGTIPSSLGS  440 (768)
T ss_dssp             EECCSSEEEEECCTTTTCSTTCCCCEEECCSSEEEEECCGGGG-GCTTCCEEECCSS-----------EEESCCCGGGGG
T ss_pred             EEccCCCcCCCcChhhhhcccCCccEEECCCCccccccCHHHh-cCCCCCEEECcCC-----------cccCcccHHHhc
Confidence            999999999888888877  88999999999999977777665 6999999995555           455678999999


Q ss_pred             CCCCCEEeccCCccccCCCcccCCCCCCcEEEccccccCCCCCCCCC-CCcccEEEcCCcccCcccccccCCccccccCC
Q 041867          393 LTWLQYIIMPNNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFH-PLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIP  471 (776)
Q Consensus       393 l~~L~~L~l~~n~i~~~~~~~~~~l~~L~~L~ls~n~l~~~~~~~~~-~~~L~~L~l~~n~l~~~~~~~l~~n~l~~~~~  471 (776)
                      +++|++|++++|.+.+..|..+..+++|++|++++|.+.+..|..+. +++|++|++++|+             +++.+|
T Consensus       441 l~~L~~L~L~~n~l~~~~p~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~L~~N~-------------l~~~~p  507 (768)
T 3rgz_A          441 LSKLRDLKLWLNMLEGEIPQELMYVKTLETLILDFNDLTGEIPSGLSNCTNLNWISLSNNR-------------LTGEIP  507 (768)
T ss_dssp             CTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSCCCSCCCGGGGGCTTCCEEECCSSC-------------CCSCCC
T ss_pred             CCCCCEEECCCCcccCcCCHHHcCCCCceEEEecCCcccCcCCHHHhcCCCCCEEEccCCc-------------cCCcCC
Confidence            99999999999999999999999999999999999999988888776 8899999666655             446788


Q ss_pred             hhhccCccCCEEEcccccCCccchhhhcCCCCCCEEeCCCCcccCCCCCCCcCCcccccccCCCC----------cchh-
Q 041867          472 DWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPIPPCFDNTTLYESYSNSSS----------LDEQ-  540 (776)
Q Consensus       472 ~~~~~l~~L~~L~L~~n~l~~~~~~~~~~l~~L~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~~~----------~~~~-  540 (776)
                      .++..+++|+.|++++|++++..|..+..+++|+.|++++|++.+.+|..+..............          .... 
T Consensus       508 ~~~~~l~~L~~L~L~~N~l~~~~p~~l~~l~~L~~L~Ls~N~l~g~ip~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  587 (768)
T 3rgz_A          508 KWIGRLENLAILKLSNNSFSGNIPAELGDCRSLIWLDLNTNLFNGTIPAAMFKQSGKIAANFIAGKRYVYIKNDGMKKEC  587 (768)
T ss_dssp             GGGGGCTTCCEEECCSSCCEEECCGGGGGCTTCCEEECCSSEEESBCCGGGGTTTTCBCCSTTCSCEEEEEECCSCCTTC
T ss_pred             hHHhcCCCCCEEECCCCcccCcCCHHHcCCCCCCEEECCCCccCCcCChHHhcccchhhhhccccccccccccccccccc
Confidence            89999999999999999999999999999999999999999999999887655432211110000          0000 


Q ss_pred             --hhcccccCCCCCCccccc--cceeeeeecceEE--EeccccccccceEEccCCcCCCCChhhhccCccCCeeeccccc
Q 041867          541 --FEIFFSIESPQGNVEKQI--HEIFEFTTKNIVY--IYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHND  614 (776)
Q Consensus       541 --~~~~~~~~~~~~~~~~~~--~~~~~~~~~~~~~--~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~  614 (776)
                        ..................  ........+....  ......+++|+.|||++|++++.+|..++++++|+.|+|++|+
T Consensus       588 ~~~~~~~~~~~~~~~~~~~l~~~~~~~l~~~~~~g~~~~~~~~l~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~Ls~N~  667 (768)
T 3rgz_A          588 HGAGNLLEFQGIRSEQLNRLSTRNPCNITSRVYGGHTSPTFDNNGSMMFLDMSYNMLSGYIPKEIGSMPYLFILNLGHND  667 (768)
T ss_dssp             CSSEEEEECTTCCGGGGGGGGGTCCSCTTSCEEEEECCCSCSSSBCCCEEECCSSCCBSCCCGGGGGCTTCCEEECCSSC
T ss_pred             cccccccccccccchhhhccccccccccccceecccCchhhhccccccEEECcCCcccccCCHHHhccccCCEEeCcCCc
Confidence              000000000000000000  0000000011100  0111336789999999999999999999999999999999999


Q ss_pred             ccccCccccCCCCCCCEEECcCCccCCcCCccccCCCCCCEEecccccCcccCCCccccccccCcccccCCCCCCCCCCC
Q 041867          615 LIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELKTLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLP  694 (776)
Q Consensus       615 l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~~L~~L~l~~N~l~~~~p~~~~~~~~l~~~~~~~n~~~c~~~~~  694 (776)
                      +++.+|..|+++++|+.|||++|++++.+|+.+..+++|++||+++|+++|.+|.. .++.++...++.|||.+|+.|+.
T Consensus       668 l~g~ip~~l~~L~~L~~LdLs~N~l~g~ip~~l~~l~~L~~L~ls~N~l~g~iP~~-~~~~~~~~~~~~gN~~Lcg~~l~  746 (768)
T 3rgz_A          668 ISGSIPDEVGDLRGLNILDLSSNKLDGRIPQAMSALTMLTEIDLSNNNLSGPIPEM-GQFETFPPAKFLNNPGLCGYPLP  746 (768)
T ss_dssp             CCSCCCGGGGGCTTCCEEECCSSCCEECCCGGGGGCCCCSEEECCSSEEEEECCSS-SSGGGSCGGGGCSCTEEESTTSC
T ss_pred             cCCCCChHHhCCCCCCEEECCCCcccCcCChHHhCCCCCCEEECcCCcccccCCCc-hhhccCCHHHhcCCchhcCCCCc
Confidence            99999999999999999999999999999999999999999999999999999985 78999999999999999999988


Q ss_pred             CCCCCCCC
Q 041867          695 ICRSPATM  702 (776)
Q Consensus       695 ~c~~~~~~  702 (776)
                      .|......
T Consensus       747 ~C~~~~~~  754 (768)
T 3rgz_A          747 RCDPSNAD  754 (768)
T ss_dssp             CCCSCC--
T ss_pred             CCCCCccC
Confidence            88755443



>3rgz_A Protein brassinosteroid insensitive 1; phytohormone, leucine-rich RE receptor-like kinases, leucine-rich repeat; HET: NAG BLD; 2.28A {Arabidopsis thaliana} PDB: 3rgx_A* 3riz_A* 3rj0_A* Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>1ziw_A TOLL-like receptor 3; innate immunity, immune system; HET: NDG NAG; 2.10A {Homo sapiens} PDB: 2a0z_A* 3cig_A* 3ciy_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>3t6q_A CD180 antigen; protein-protein complex, leucine rich repeat, MD-2 related L recognition, receptor, innate immunity, glycosylation, IMMU; HET: NAG BMA MAN; 1.90A {Mus musculus} PDB: 3b2d_A* 3rg1_A* Back     alignment and structure
>3j0a_A TOLL-like receptor 5; membrane protein, leucine-rich repeat, asymmetric homodimer, glycoprotein, immune system; HET: NAG FUC; 26.00A {Homo sapiens} Back     alignment and structure
>3vq2_A TLR4, TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, secreted, immune SY; HET: NAG LP4 LP5 DAO MYR; 2.48A {Mus musculus} PDB: 3vq1_A* 2z64_A* Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>2z63_A TOLL-like receptor 4, variable lymphocyte recepto; TLR4, MD-2, LPS, immune system; HET: NAG FUL; 2.00A {Homo sapiens} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z81_A CD282 antigen, TOLL-like receptor 2, variable lymphocyte recepto; TLR2, PAM3CSK4, lipopeptide, innate immunity, cytoplasmic VE glycoprotein; HET: NAG BMA MAN PCJ; 1.80A {Mus musculus} PDB: 2z82_A* 3a7c_A* 3a79_A* 3a7b_A* 2z7x_A* Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>2z7x_B TOLL-like receptor 1, variable lymphocyte recepto; TLR2, TLR1, lipopeptide, innate immunity, glycoPro immune response, inflammatory response, leucine-rich repeat membrane, receptor; HET: NAG NDG MAN BMA PCJ; 2.10A {Homo sapiens} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4eco_A Uncharacterized protein; leucine-rich repeats, protein binding, structural genomics, center for structural genomics, JCSG; 2.70A {Bacteroides eggerthii dsm 20697} Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>4ecn_A Leucine-rich repeat protein; leucine-rich repeats, DUF4458 domain, protein binding, extra protein, structural genomics; 2.80A {Bacteroides thetaiotaomicron} Back     alignment and structure
>4g8a_A TOLL-like receptor 4; leucine rich repeat MD-2 related lipid recognition, receptor immunity, lipid binding, glycosylation, immune system; HET: NAG LP4 LP5 DAO MYR KDO; 2.40A {Homo sapiens} PDB: 3fxi_A* Back     alignment and structure
>3a79_B TLR6, VLRB.59, TOLL-like receptor 6, variable lymphocyte recepto; diacyl lipopeptide, innate immunity, Leu repeat, cell membrane, cytoplasmic vesicle; HET: PXS NAG BMA NDG; 2.90A {Mus musculus} Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>3v47_A TOLL-like receptor 5B and variable lymphocyte REC chimeric protein; innate immunity, leucine-rich repeat, innate immune receptor system; HET: NAG; 2.47A {Danio rerio} PDB: 3v44_A* Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>1jl5_A Outer protein YOPM; leucine-rich repeat, molecular pathogenesis, effector protein, virulence factor, toxin; 2.10A {Yersinia pestis} SCOP: c.10.2.6 PDB: 1g9u_A Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>2id5_A Lingo-1, leucine rich repeat neuronal 6A; CNS-specific LRR-IG containing, ligand binding protein,membr protein; HET: NAG MAN; 2.70A {Homo sapiens} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>1o6v_A Internalin A; bacterial infection, extracellular recognition, cell WALL attached, leucine rich repeat; 1.5A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 1o6s_A* 1o6t_A 2omz_A 2omy_A 2omw_A 2omv_A 2omt_A 2omx_A 2omu_A Back     alignment and structure
>3bz5_A Internalin-J, INLJ; leucine rich repeat (LRR), cysteine ladder, asparagine ladder, virulence factor, solenoid, cell WALL; 2.70A {Listeria monocytogenes} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>3o6n_A APL1; leucine-rich repeat, protein binding; HET: NAG; 1.85A {Anopheles gambiae} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>3oja_B Anopheles plasmodium-responsive leucine-rich REPE 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>4fmz_A Internalin; leucine rich repeat, structural genomic center for structural genomics, JCSG, protein structure INI PSI-biology; HET: MSE; 1.91A {Listeria monocytogenes serotype 4B} Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>2ft3_A Biglycan; proteoglycan, dimer interface, structural protein, signaling; HET: NAG FLC; 3.40A {Bos taurus} Back     alignment and structure
>1ogq_A PGIP-2, polygalacturonase inhibiting protein; inhibitor; HET: NAG; 1.7A {Phaseolus vulgaris} SCOP: c.10.2.8 Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1xku_A Decorin; proteoglycan, leucine-rich repeat, structural protein; HET: NAG; 2.15A {Bos taurus} SCOP: c.10.2.7 PDB: 1xec_A* 1xcd_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>1z7x_W Ribonuclease inhibitor; leucine-rich repeat, enzyme- inhibitor complex, structural genomics, protein structure initiative, PSI, CESG; HET: CIT; 1.95A {Homo sapiens} SCOP: c.10.1.1 PDB: 2q4g_W* 2bex_A 1a4y_A 2bnh_A 1dfj_I Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>2z66_A Variable lymphocyte receptor B, TOLL-like recepto; TLR4, TOLL-like receptor, MD-2, LPS, leucine-rich repeat, glycoprotein, immune response; HET: NAG BMA FUL; 1.90A {Eptatretus burgeri} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyj_A Leucine-rich repeat-containing protein 4C; cell adhesion, synapse; HET: NAG BMA MAN; 3.25A {Homo sapiens} Back     alignment and structure
>1ozn_A Reticulon 4 receptor; NOGO receptor, MAD, myelination inhibition, OMGP, MAG, NOGO- signal transduction, neuronal regeneration, ligand binding; HET: NDG MAN NAG BMA; 1.52A {Homo sapiens} SCOP: c.10.2.7 PDB: 1p8t_A* 3kj4_A* Back     alignment and structure
>3zyi_A Leucine-rich repeat-containing protein 4; cell adhesion, LRRC4 complex, synapse; HET: NAG; 2.60A {Homo sapiens} PDB: 3zyo_A* 3zyn_A* 2dl9_A Back     alignment and structure
>2z80_A TOLL-like receptor 2, variable lymphocyte recepto; TLR2, lipopeptide, innate immunity, glycoprotein, immune RES inflammatory response; HET: NAG; 1.80A {Homo sapiens} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3ogk_B Coronatine-insensitive protein 1; leucine rich repeat, ubiquitin ligase, SCF, protein binding; HET: OGK; 2.80A {Arabidopsis thaliana} PDB: 3ogl_B* 3ogm_B* Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>4fcg_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, LRR, N- and C-terminal helices; 2.00A {Xanthomonas campestris PV} Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>3o53_A Protein LRIM1, AGAP006348-PA; leucine-rich repeat, protein binding; HET: NAG; 2.00A {Anopheles gambiae} Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1wwl_A Monocyte differentiation antigen CD14; LPS, immune system; HET: NAG; 2.50A {Mus musculus} Back     alignment and structure
>3g06_A SSPH2 (leucine-rich repeat protein); E3 ubiquitin ligase, leucine rich repeat domain, type three effector, salmonella virulence factor; 1.90A {Salmonella typhimurium} Back     alignment and structure
>2z62_A TOLL-like receptor 4, variable lymphocyte recepto; TLR, VLR hybrid, MD-2, LPS, glycoprotein response, inflammatory response, innate immunity; HET: NAG FUL BMA; 1.70A {Homo sapiens} PDB: 2z65_A* 3ul8_A* 3ula_A* 3ul7_A* Back     alignment and structure
>3oja_A Leucine-rich immune molecule 1; coiled-coil, helix-loop-helix, leucine-rich repeat, protein; HET: NAG MAN; 2.70A {Anopheles gambiae} Back     alignment and structure
>2o6q_A Variable lymphocyte receptor A; leucine-rich repeat protein, LRR, immune system; 2.50A {Eptatretus burgeri} Back     alignment and structure
>2p1m_B Transport inhibitor response 1 protein; F-BOX, leucine rich repeat, signaling protein; HET: IHP; 1.80A {Arabidopsis thaliana} PDB: 2p1n_B* 2p1o_B* 2p1p_B* 2p1q_B* 3c6n_B* 3c6o_B* 3c6p_B* Back     alignment and structure
>1p9a_G Platelet glycoprotein IB alpha chain precursor; platelet receptors, glycocalicin, leucine rich repeats, BLOO clotting; HET: NAG BMA; 1.70A {Homo sapiens} SCOP: c.10.2.7 PDB: 1ook_G* 1qyy_A* 3pmh_G* 1m0z_A 1m10_B 1sq0_B 1gwb_A* 1p8v_A* 1u0n_D 3p72_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3m19_A Variable lymphocyte receptor A diversity region; adaptive immunity, antibody, T cell, leucine-rich repeat, immune system; 1.70A {Petromyzon marinus} PDB: 3m18_A Back     alignment and structure
>3rfs_A Internalin B, repeat modules, variable lymphocyte B; LRR, protein binding, plasma; 1.70A {Listeria monocytogenes} PDB: 3rfj_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2xwt_C Thyrotropin receptor; signaling protein-immune system complex, GPCR, graves' disea autoimmunity, receptor-autoantibody complex; HET: NAG BMA MAN; 1.90A {Homo sapiens} PDB: 3g04_C* Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>3goz_A Leucine-rich repeat-containing protein; LEGL7, NESG, LGR148, structural genomics, PSI-2, protein structure initiative; 2.10A {Legionella pneumophila subsp} Back     alignment and structure
>4glp_A Monocyte differentiation antigen CD14; alpha beta BENT solenoid, LRR, lipopolysaccharide, serum, CD leucine-rich repeat, pattern recognition; 4.00A {Homo sapiens} Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>1h6u_A Internalin H; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.8A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>4ay9_X Follicle-stimulating hormone receptor; hormone-receptor complex, leucine-rich repeats, LRR, GPCR; HET: TYS NAG; 2.50A {Homo sapiens} PDB: 1xwd_C* Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2ca6_A RAN GTPase-activating protein 1; GAP, GTPase activation, hemihedral twinning, leucine-rich repeat protein, LRR, merohedral twinning; 2.2A {Schizosaccharomyces pombe} SCOP: c.10.1.2 PDB: 1k5g_C* 1k5d_C 1yrg_A Back     alignment and structure
>2ast_B S-phase kinase-associated protein 2; SCF-substrate complex, LRR, cell cycle, protein turnover COM ligase-ligase inhibitor complex; HET: TPO; 2.30A {Homo sapiens} SCOP: a.158.1.1 c.10.1.3 PDB: 2ass_B 1fqv_A* 1fs2_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>2v9t_B SLIT homolog 2 protein N-product; structural protein-receptor complex, developmental protein, domain, roundabout, chemotaxis, LRR domain; 1.70A {Homo sapiens} PDB: 2v9s_A Back     alignment and structure
>2v70_A SLIT-2, SLIT homolog 2 protein N-product; neurogenesis, glycoprotein, secreted, chemotaxis, LRR structural protein, differentiation; HET: NAG; 3.01A {Homo sapiens} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3e6j_A Variable lymphocyte receptor diversity region; variable lymphocyte receptors, VLR, leucine-rich repeat, LRR adaptive immunity, immune system; HET: DR2; 1.67A {Petromyzon marinus} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>2xot_A Amphoterin-induced protein 1; cell adhesion, neuronal protein, neurite growth regulation; HET: NAG BMA; 2.00A {Mus musculus} Back     alignment and structure
>2o6s_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 1.50A {Eptatretus burgeri} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>1h6t_A Internalin B; cell adhesion, leucine rich repeat, IG-like domain, EF-hand domain; 1.6A {Listeria monocytogenes} SCOP: b.1.18.15 c.10.2.1 PDB: 2wqu_A 2uzy_A 2uzx_A 2wqv_A* 2wqw_A 2wqx_A 1d0b_A 1otn_A 1oto_A 1otm_A Back     alignment and structure
>3cvr_A Invasion plasmid antigen; leucine rich repeat and alpha fold, ligase; 2.80A {Shigella flexneri 2A} Back     alignment and structure
>1w8a_A SLIT protein; signaling protein, secreted protein, AXON guidance, leucine-rich repeat glycoprotein, EGF-like domain, signal protein; 2.8A {Drosophila melanogaster} SCOP: c.10.2.7 Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1m9s_A Internalin B; cell invasion, GW domains, SH3 domains, signaling protein; 2.65A {Listeria monocytogenes} SCOP: b.1.18.15 b.34.11.1 b.34.11.1 b.34.11.1 c.10.2.1 PDB: 2y5q_A Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>4ezg_A Putative uncharacterized protein; internalin-A, leucine-rich repeat protein, structural genomi center for structural genomics, JCSG; HET: MSE; 1.50A {Listeria monocytogenes} Back     alignment and structure
>3sb4_A Hypothetical leucine rich repeat protein; LRR, right-handed beta-alpha superhelix, leucine-rich repeat structural genomics; HET: MSE PG4; 1.99A {Bacteroides thetaiotaomicron} Back     alignment and structure
>1xeu_A Internalin C; cellular invasion, leucine-rich repeat, cell invasion; 2.05A {Listeria monocytogenes} Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>4fdw_A Leucine rich hypothetical protein; putative cell surface protein, BIG3 domain, LRR domain, STRU genomics; 2.05A {Bacteroides ovatus} PDB: 4fd0_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>1dce_A Protein (RAB geranylgeranyltransferase alpha subunit); 2.0 A resolution, N-formylmethionine, alpha subunit; HET: FME; 2.00A {Rattus norvegicus} SCOP: a.118.6.1 b.7.4.1 c.10.2.2 PDB: 1ltx_A* Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>2o6r_A Variable lymphocyte receptor B; leucine-rich repeat protein, LRR, immune system; 2.30A {Eptatretus burgeri} Back     alignment and structure
>2wfh_A SLIT homolog 2 protein C-product; developmental protein, neurogenesis, splicing, glycoprotein, leucine-rich repeat, disulfide bond, differentiation; 1.80A {Homo sapiens} Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>4fs7_A Uncharacterized protein; leucine-rich repeats, protein binding, extracellular protein structural genomics; HET: MSE; 1.19A {Bacteroides ovatus} Back     alignment and structure
>2ell_A Acidic leucine-rich nuclear phosphoprotein 32 FAM B; phapi2 protein, silver-stainable protein SSP29, acidic prote in leucines, structural genomics; NMR {Homo sapiens} PDB: 2rr6_A 2jqd_A Back     alignment and structure
>4b8c_D Glucose-repressible alcohol dehydrogenase transcr effector; hydrolase-cell cycle complex; 3.41A {Saccharomyces cerevisiae S288C} Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>2je0_A Acidic leucine-rich nuclear phosphoprotein 32 FAM member A; nuclear protein; 2.40A {Homo sapiens} PDB: 2je1_A Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>3g39_A Variable lymphocyte receptor VLRB.2D; antibody, X-RAY, crystallography, immune system; 1.55A {Petromyzon marinus} PDB: 3g3a_A 3g3b_A 3twi_D Back     alignment and structure
>1a9n_A U2A', U2A'; complex (nuclear protein/RNA), RNA, snRNP, ribonucleoprotein, RNA binding protein/RNA complex; 2.38A {Homo sapiens} SCOP: c.10.2.4 Back     alignment and structure
>2r9u_A Variable lymphocyte receptor; adaptive immunity, VLR, leucine-rich repeat, LRR, system; 2.10A {Petromyzon marinus} Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>1ds9_A Outer arm dynein; leucine-rich repeat, beta-BETA-alpha cylinder, flagella, contractIle protein; NMR {Chlamydomonas reinhardtii} SCOP: c.10.3.1 PDB: 1m9l_A Back     alignment and structure
>4gt6_A Cell surface protein; leucine rich repeats, putative protein binding, extracellula protein, structural genomics; HET: MSE; 1.80A {Faecalibacterium prausnitzii a2-165} Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>2ifg_A High affinity nerve growth factor receptor; TRK, TRKA, receptor-ligand complex transferase; HET: NAG NDG MAN BMA; 3.40A {Homo sapiens} SCOP: b.1.1.4 b.1.1.4 c.10.2.7 Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>3un9_A NLR family member X1; leucine rich repeat (LRR), antiviral signaling, MAVS, TRAF6, UQCRC2, immune system; 2.65A {Homo sapiens} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>4h09_A Hypothetical leucine rich repeat protein; two LRR_5 domains, PF13306 family, structural genomics, JOIN for structural genomics, JCSG; 2.50A {Eubacterium ventriosum} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>2ra8_A Uncharacterized protein Q64V53_bacfr; WGR domain, LRR domain, leucine rich repeats, BFR43, structural genomics, PSI-2; 1.95A {Bacteroides fragilis} Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>1io0_A Tropomodulin; LRR protein, right-handed super-helix, protein binding; 1.45A {Gallus gallus} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3rw6_A Nuclear RNA export factor 1; retroviral constitutive transport element (CTE), RNA recogni motif (RRM); HET: GTP CCC; 2.30A {Homo sapiens} PDB: 3rw7_A 1koo_A 1koh_A 1ft8_A 1fo1_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>3e4g_A ATP synthase subunit S, mitochondrial; leucine-rich repeat, CF0, hydrogen ION transport, inner membrane, ION transport, membrane, mitochondrion; 0.96A {Bos taurus} PDB: 3e3z_A 3dze_A 3e2j_A Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>1pgv_A TMD-1, tropomodulin TMD-1; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics secsg; 1.80A {Caenorhabditis elegans} SCOP: c.10.1.1 Back     alignment and structure
>3rfe_A Platelet glycoprotein IB beta chain; platelet surface receptor, GPIX, cell adhesion; HET: NAG; 1.25A {Homo sapiens} PDB: 3rez_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 776
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 1e-19
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-15
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-14
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 5e-10
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 6e-07
d2omza2384 c.10.2.1 (A:33-416) Internalin A {Listeria monocyt 2e-05
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 8e-16
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-10
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-09
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 4e-07
d1xkua_305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 2e-06
d1xkua_ 305 c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 99 1e-05
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 9e-15
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 8e-13
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 1e-11
d1ogqa_313 c.10.2.8 (A:) Polygalacturonase inhibiting protein 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 5e-09
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 2e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 7e-07
d1ozna_284 c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 recept 1e-05
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 3e-08
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 9e-07
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 5e-06
d1jl5a_353 c.10.2.6 (A:) Leucine rich effector protein YopM { 8e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-07
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 1e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 2e-04
d1h6ua2227 c.10.2.1 (A:36-262) Internalin H {Listeria monocyt 8e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-07
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 1e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 8e-05
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 2e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 5e-04
d2astb2284 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p1 0.004
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 4e-07
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 8e-05
d1p9ag_266 c.10.2.7 (G:) von Willebrand factor binding domain 2e-04
d1h6ta2210 c.10.2.1 (A:31-240) Internalin B {Listeria monocyt 6e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 6e-07
d2ca6a1344 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal dom 1e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 8e-07
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 4e-06
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 2e-05
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 6e-04
d1z7xw1460 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human ( 9e-04
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 2e-05
d2ifga3156 c.10.2.7 (A:36-191) High affinity nerve growth fac 0.003
d1a9na_162 c.10.2.4 (A:) Splicesomal U2A' protein {Human (Hom 3e-05
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 4e-04
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.002
d1xwdc1242 c.10.2.7 (C:18-259) Follicle-stimulating hormone r 0.003
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1dcea3124 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase 0.001
d1w8aa_192 c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanoga 0.002
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Internalin LRR domain
domain: Internalin A
species: Listeria monocytogenes [TaxId: 1639]
 Score = 89.3 bits (220), Expect = 1e-19
 Identities = 63/383 (16%), Positives = 121/383 (31%), Gaps = 37/383 (9%)

Query: 290 LDISNNNFRGHIPIEIGDVLPSLYLFNNSMNALDGSIPSSLGNMKFLQILDLSNNHLTGE 349
             +   N    +     D + +L      + ++DG     +  +  L  ++ SNN LT  
Sbjct: 27  TVLGKTNVTDTVSQTDLDQVTTLQADRLGIKSIDG-----VEYLNNLTQINFSNNQLTDI 81

Query: 350 IP-------EHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMP 402
            P         + +    +  +    N          N+    I          +  +  
Sbjct: 82  TPLKNLTKLVDILMNNNQIADITPLANLTNLTGLTLFNNQITDIDPLKNLTNLNRLELSS 141

Query: 403 NNHLEGPIPVEFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKR--- 459
           N   +         L  L   +   +    +  +    L I    +S   +  +L     
Sbjct: 142 NTISDISALSGLTSLQQLSFGNQVTDLKPLANLTTLERLDISSNKVSDISVLAKLTNLES 201

Query: 460 -DLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEGEVLVQLCELNQLQLLDLSNNNLHGPI 518
              + N+++   P  +   + L  L L  N L+   +  L  L  L  LDL+NN +    
Sbjct: 202 LIATNNQISDITPLGIL--TNLDELSLNGNQLKD--IGTLASLTNLTDLDLANNQISNLA 257

Query: 519 PPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVYIYQGKVL 578
           P            S  + L E       I +             E     +  I     L
Sbjct: 258 P-----------LSGLTKLTELKLGANQISNISPLAGLTALTNLELNENQLEDISPISNL 306

Query: 579 SLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNK 638
             L+ L L  N +    P  + +LT++Q L  ++N +     S+ +NL ++  L   +N+
Sbjct: 307 KNLTYLTLYFNNISDISP--VSSLTKLQRLFFANNKVSD--VSSLANLTNINWLSAGHNQ 362

Query: 639 LNGKIPHQLVELKTLEVFSVAYN 661
           ++   P  L  L  +    +   
Sbjct: 363 ISDLTP--LANLTRITQLGLNDQ 383


>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Length = 384 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Length = 305 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 313 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Length = 353 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Length = 227 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Length = 284 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Length = 210 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Length = 344 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Length = 460 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 156 Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Length = 162 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Length = 242 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 124 Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 192 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query776
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.96
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d2omza2384 Internalin A {Listeria monocytogenes [TaxId: 1639] 99.94
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.93
d1ogqa_313 Polygalacturonase inhibiting protein PGIP {Kidney 99.93
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1xkua_305 Decorin {Cow (Bos taurus) [TaxId: 9913]} 99.92
d1ozna_284 Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Huma 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.91
d1p9ag_266 von Willebrand factor binding domain of glycoprote 99.89
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.77
d1jl5a_353 Leucine rich effector protein YopM {Yersinia pesti 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1w8aa_192 Slit {Fruit fly (Drosophila melanogaster) [TaxId: 99.74
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.72
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.72
d1z7xw1460 Ribonuclease inhibitor {Human (Homo sapiens) [TaxI 99.71
d1xwdc1242 Follicle-stimulating hormone receptor {Human (Homo 99.7
d1h6ua2227 Internalin H {Listeria monocytogenes [TaxId: 1639] 99.69
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.67
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2omxa2199 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d1h6ta2210 Internalin B {Listeria monocytogenes [TaxId: 1639] 99.64
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.55
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.52
d2astb2284 Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sa 99.5
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.48
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.45
d1a9na_162 Splicesomal U2A' protein {Human (Homo sapiens) [Ta 99.42
d1dcea3124 Rab geranylgeranyltransferase alpha-subunit, C-ter 99.42
d2ifga3156 High affinity nerve growth factor receptor, N-term 99.37
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.36
d2ca6a1344 Rna1p (RanGAP1), N-terminal domain {Fission yeast 99.35
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.24
d1m9la_198 Outer arm dynein light chain 1 {Green algae (Chlam 99.2
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.27
d1koha1162 mRNA export factor tap {Human (Homo sapiens) [TaxI 98.21
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.98
d1pgva_167 Tropomodulin C-terminal domain {nematode (Caenorha 97.79
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.31
d1io0a_166 Tropomodulin C-terminal domain {Chicken (Gallus ga 97.25
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Leucine-rich repeat, LRR (right-handed beta-alpha superhelix)
superfamily: L domain-like
family: Polygalacturonase inhibiting protein PGIP
domain: Polygalacturonase inhibiting protein PGIP
species: Kidney bean (Phaseolus vulgaris) [TaxId: 3885]
Probab=99.96  E-value=2.9e-29  Score=257.44  Aligned_cols=260  Identities=34%  Similarity=0.543  Sum_probs=198.3

Q ss_pred             CCCEEEccCCcCCC--cCchhhhhcCCCCcEEEccCccccceEecCCCcCCCCCCccccCCCCCCEEeccCCccccCCCc
Q 041867          335 FLQILDLSNNHLTG--EIPEHLAVGCVNLQSLALSNNNLQEGLYLNNNSLSGKIPRWLGNLTWLQYIIMPNNHLEGPIPV  412 (776)
Q Consensus       335 ~L~~L~l~~n~l~~--~~~~~~~~~l~~L~~L~ls~n~l~~~l~l~~n~l~~~~~~~~~~l~~L~~L~l~~n~i~~~~~~  412 (776)
                      +++.|++++|.+.+  .+|..+. .+++|++|+++++          |.+.|.+|..|+++++|++|++++|++.+..+.
T Consensus        51 ~v~~L~L~~~~l~g~~~lp~~l~-~L~~L~~L~Ls~~----------N~l~g~iP~~i~~L~~L~~L~Ls~N~l~~~~~~  119 (313)
T d1ogqa_          51 RVNNLDLSGLNLPKPYPIPSSLA-NLPYLNFLYIGGI----------NNLVGPIPPAIAKLTQLHYLYITHTNVSGAIPD  119 (313)
T ss_dssp             CEEEEEEECCCCSSCEECCGGGG-GCTTCSEEEEEEE----------TTEESCCCGGGGGCTTCSEEEEEEECCEEECCG
T ss_pred             EEEEEECCCCCCCCCCCCChHHh-cCccccccccccc----------cccccccccccccccccchhhhccccccccccc
Confidence            45566666666554  2344433 3555555553220          223334455555555555555555555554454


Q ss_pred             ccCCCCCCcEEEccccccCCCCCCCCCCCcccEEEcCCcccCcccccccCCccccccCChhhccCccCCEEEcccccCCc
Q 041867          413 EFCQLDLLQILDISDNNISGSLPSCFHPLSIKQVHLSKNMLHGQLKRDLSYNRLNGSIPDWVDGLSQLSHLILGHNNLEG  492 (776)
Q Consensus       413 ~~~~l~~L~~L~ls~n~l~~~~~~~~~~~~L~~L~l~~n~l~~~~~~~l~~n~l~~~~~~~~~~l~~L~~L~L~~n~l~~  492 (776)
                      .+..+.+|+.+++++|.+.                                    +.+|..+..+++++.+++++|.+.+
T Consensus       120 ~~~~~~~L~~l~l~~N~~~------------------------------------~~~p~~l~~l~~L~~l~l~~n~l~~  163 (313)
T d1ogqa_         120 FLSQIKTLVTLDFSYNALS------------------------------------GTLPPSISSLPNLVGITFDGNRISG  163 (313)
T ss_dssp             GGGGCTTCCEEECCSSEEE------------------------------------SCCCGGGGGCTTCCEEECCSSCCEE
T ss_pred             cccchhhhccccccccccc------------------------------------ccCchhhccCcccceeecccccccc
Confidence            4555555555555544433                                    3667778899999999999999999


Q ss_pred             cchhhhcCCCCC-CEEeCCCCcccCCCCCCCcCCcccccccCCCCcchhhhcccccCCCCCCccccccceeeeeecceEE
Q 041867          493 EVLVQLCELNQL-QLLDLSNNNLHGPIPPCFDNTTLYESYSNSSSLDEQFEIFFSIESPQGNVEKQIHEIFEFTTKNIVY  571 (776)
Q Consensus       493 ~~~~~~~~l~~L-~~L~Ls~n~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  571 (776)
                      ..|..+..+..+ +.+++++|++++..|..+..+                                              
T Consensus       164 ~ip~~~~~l~~l~~~l~~~~n~l~~~~~~~~~~l----------------------------------------------  197 (313)
T d1ogqa_         164 AIPDSYGSFSKLFTSMTISRNRLTGKIPPTFANL----------------------------------------------  197 (313)
T ss_dssp             ECCGGGGCCCTTCCEEECCSSEEEEECCGGGGGC----------------------------------------------
T ss_pred             cccccccccccccccccccccccccccccccccc----------------------------------------------
Confidence            899888888876 899999999998887766543                                              


Q ss_pred             EeccccccccceEEccCCcCCCCChhhhccCccCCeeecccccccccCccccCCCCCCCEEECcCCccCCcCCccccCCC
Q 041867          572 IYQGKVLSLLSGLDLSCNKLIGPIPPQIGNLTRIQTLNLSHNDLIGLIPSTFSNLKHVESLDLSNNKLNGKIPHQLVELK  651 (776)
Q Consensus       572 ~~~~~~~~~L~~L~Ls~n~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~~~~l~~L~~L~Ls~N~l~~~~~~~l~~l~  651 (776)
                              ....++++++...+.+|..+..+++++.+++++|.+.+.++ .+..+++|+.|+|++|++++.+|+.+..++
T Consensus       198 --------~~~~l~l~~~~~~~~~~~~~~~~~~l~~l~~~~~~l~~~~~-~~~~~~~L~~L~Ls~N~l~g~iP~~l~~L~  268 (313)
T d1ogqa_         198 --------NLAFVDLSRNMLEGDASVLFGSDKNTQKIHLAKNSLAFDLG-KVGLSKNLNGLDLRNNRIYGTLPQGLTQLK  268 (313)
T ss_dssp             --------CCSEEECCSSEEEECCGGGCCTTSCCSEEECCSSEECCBGG-GCCCCTTCCEEECCSSCCEECCCGGGGGCT
T ss_pred             --------ccccccccccccccccccccccccccccccccccccccccc-ccccccccccccCccCeecccCChHHhCCC
Confidence                    35579999999999999999999999999999999987655 688899999999999999999999999999


Q ss_pred             CCCEEecccccCcccCCCccccccccCcccccCCCCCCCCCCCCCC
Q 041867          652 TLEVFSVAYNNLSGEIPEWTAQFATFNESSYEGNTFLCGLPLPICR  697 (776)
Q Consensus       652 ~L~~L~l~~N~l~~~~p~~~~~~~~l~~~~~~~n~~~c~~~~~~c~  697 (776)
                      +|++|+|++|+|+|.+|+ +..+++|+.+++.+|+.+|+.|++.|.
T Consensus       269 ~L~~L~Ls~N~l~g~iP~-~~~L~~L~~l~l~~N~~l~g~plp~c~  313 (313)
T d1ogqa_         269 FLHSLNVSFNNLCGEIPQ-GGNLQRFDVSAYANNKCLCGSPLPACT  313 (313)
T ss_dssp             TCCEEECCSSEEEEECCC-STTGGGSCGGGTCSSSEEESTTSSCCC
T ss_pred             CCCEEECcCCcccccCCC-cccCCCCCHHHhCCCccccCCCCCCCC
Confidence            999999999999999997 578999999999999999999988874



>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omza2 c.10.2.1 (A:33-416) Internalin A {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogqa_ c.10.2.8 (A:) Polygalacturonase inhibiting protein PGIP {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1xkua_ c.10.2.7 (A:) Decorin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1ozna_ c.10.2.7 (A:) Reticulon 4 receptor (Nogo-66 receptor, Ngr) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1p9ag_ c.10.2.7 (G:) von Willebrand factor binding domain of glycoprotein Ib alpha {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1jl5a_ c.10.2.6 (A:) Leucine rich effector protein YopM {Yersinia pestis [TaxId: 632]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1w8aa_ c.10.2.7 (A:) Slit {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z7xw1 c.10.1.1 (W:1-460) Ribonuclease inhibitor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwdc1 c.10.2.7 (C:18-259) Follicle-stimulating hormone receptor {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1h6ua2 c.10.2.1 (A:36-262) Internalin H {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2omxa2 c.10.2.1 (A:37-235) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d1h6ta2 c.10.2.1 (A:31-240) Internalin B {Listeria monocytogenes [TaxId: 1639]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2astb2 c.10.1.3 (B:2136-2419) Cyclin A/CDK2-associated p19, Skp2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1a9na_ c.10.2.4 (A:) Splicesomal U2A' protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dcea3 c.10.2.2 (A:444-567) Rab geranylgeranyltransferase alpha-subunit, C-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2ifga3 c.10.2.7 (A:36-191) High affinity nerve growth factor receptor, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2ca6a1 c.10.1.2 (A:2-345) Rna1p (RanGAP1), N-terminal domain {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1m9la_ c.10.3.1 (A:) Outer arm dynein light chain 1 {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1koha1 c.10.2.3 (A:201-362) mRNA export factor tap {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1pgva_ c.10.1.1 (A:) Tropomodulin C-terminal domain {nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1io0a_ c.10.1.1 (A:) Tropomodulin C-terminal domain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure