Citrus Sinensis ID: 041871

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-----

MLFHVEAQSIADDSPSPDTVSNFKPSLAVVIGILCVMFILTFILLLYAKFCHRASSLFANTQIHNPALIRSTSRFSGIDKAVIESLPFFRFSSLKGSKQGLECAVCLSKFEDTEILRLLPKCKHAFHISCIDQWLEKHSSCPLCRLKVNAEDPTIFAYSNSMRFMFNNSERREDSNIELFIQREEEHRGSSRFSIGSSFRKNKEPNKEEELLIQEEAVDGDDDERILHKHNHKIIVSDVIFKNRWSSASSSDLMLLNSELINDMSSNRFSNPNDFGQFSTKRAIENNEQILKIKEEMEMKRLFENKFSTISKTSPGVLVPNVPSSSGSNKIISSLNTSRTINPTTDRKSMSEITAVSRFQDLGMKNRIRESSIDGNERTRRLWLPIARRTVQWFADRERRSRQQSQDRTQPPLDV

ccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccHHHHHHccEEEEEcccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccccccccccccccHHcccccccccccccCCccccccccccccccHHHHHHcccccccccHHcccccccEEEEcccccccccccccccHHHHHHHHHHHHcccccccccccccccccccccHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccEEEEEcccccccccccccccccccHHHHHHHcccHHHHHHHHHHHcccccHHccccccccccccc

MLFH*******************KPSLAVVIGILCVMFILTFILLLYAKFCHRAS*********************GIDKAVIESLPFFRFSSLKGSKQGLECAVCLSKFEDTEILRLLPKCKHAFHISCIDQWLEKHSSCPLCRLKVN*****************************************************************************LHKHNHKIIVSDVIFKNRWS***********************************************************************************************************TAVS*********************TRRLWLPIARRTVQWFA********************

xxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
E3 ubiquitin-protein ligase ATL42	E3 ubiquitin-protein ligase able to catalyze polyubiquitination with ubiquitin-conjugating enzyme E2 UBC8 in vitro.	probable	Q5XF85

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L0B, chain A
Confidence level:very confident
Coverage over the Query: 71-150
View the alignment between query and template
View the model in PyMOL

Template: 3IHP, chain A
Confidence level:probable
Coverage over the Query: 140-232
View the alignment between query and template
View the model in PyMOL