Citrus Sinensis ID: 041883

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30---
MNDAGEIDPRDKIWAASHRWGTVVIAYKKKASH
ccccccccccHHHHHHccccEEEEEEEEccccc
cccccccccccHEEEEcccccEEEEEEEEcccc
mndageidprdkiWAASHRWGTVVIAYKKKASH
mndageidprdkiwaashrwgTVVIAYKKKASH
MNDAGEIDPRDKIWAASHRWGTVVIAYKKKASH
***********KIWAASHRWGTVVIAY******
********PRDKIWAASHRWGTVVIAYKK****
********PRDKIWAASHRWGTVVIAYKKKASH
*****EIDPRDKIWAASHRWGTVVIAYKKKA**
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooo
ooooooooohhhhhhhhhhhhhhhhhhhiiiii
iiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDAGEIDPRDKIWAASHRWGTVVIAYKKKASH
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

No hits with e-value below 0.001 by BLAST

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

No hits with e-value below 0.001 by BLAST

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

No confident hit detected by STRING

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 33
COG0687 363 PotD Spermidine/putrescine-binding periplasmic pro 98.6
PRK10682 370 putrescine transporter subunit: periplasmic-bindin 98.04
PRK09501 348 potD spermidine/putrescine ABC transporter peripla 97.95
PF13416 281 SBP_bac_8: Bacterial extracellular solute-binding 97.6
TIGR03850 437 bind_CPR_0540 carbohydrate ABC transporter substra 97.4
PRK09474 396 malE maltose ABC transporter periplasmic protein; 97.3
PRK10974 438 glycerol-3-phosphate transporter periplasmic bindi 97.13
COG1653 433 UgpB ABC-type sugar transport system, periplasmic 96.72
TIGR03851 450 chitin_NgcE carbohydrate ABC transporter, N-acetyl 96.68
PRK11622 401 hypothetical protein; Provisional 96.18
TIGR01276 309 thiB thiamine ABC transporter, periplasmic binding 95.89
TIGR01254 304 sfuA ABC transporter periplasmic binding protein, 95.38
PRK11205 330 tbpA thiamine transporter substrate binding subuni 94.71
PF02030 493 Lipoprotein_8: Hypothetical lipoprotein (MG045 fam 94.47
PF13343 242 SBP_bac_6: Bacterial extracellular solute-binding 94.28
TIGR03227 367 PhnS 2-aminoethylphosphonate ABC transporter, peri 93.22
PRK15046 349 2-aminoethylphosphonate ABC transporter substrate- 92.24
PF01547 315 SBP_bac_1: Bacterial extracellular solute-binding 92.04
COG2182 420 MalE Maltose-binding periplasmic proteins/domains 88.23
TIGR03261 334 phnS2 putative 2-aminoethylphosphonate ABC transpo 82.37
>COG0687 PotD Spermidine/putrescine-binding periplasmic protein [Amino acid transport and metabolism] Back     alignment and domain information 
Probab=98.60  E-value=3.8e-08  Score=61.32  Aligned_cols=26  Identities=23%  Similarity=0.358  Sum_probs=23.9

Q ss_pred             CCCCcEEEeeecccceEEEEeCCCCC
Q 041883            8 DPRDKIWAASHRWGTVVIAYKKKASH   33 (33)
Q Consensus         8 d~~G~iwgvPyrWG~t~IaYr~dkf~   33 (33)
                      +..|..|+|||.||+++|+||++++.
T Consensus       124 ~d~g~~y~vPy~~g~t~i~Yn~~~~~  149 (363)
T COG0687         124 FDPGNKYSVPYFWGTTGIAYNTDKVK  149 (363)
T ss_pred             CCCCCEeeeeEEeeeeEEEEeccccC
Confidence            56799999999999999999999974

>PRK10682 putrescine transporter subunit: periplasmic-binding component of ABC superfamily; Provisional Back     alignment and domain information
>PRK09501 potD spermidine/putrescine ABC transporter periplasmic substrate-binding protein; Reviewed Back     alignment and domain information
>PF13416 SBP_bac_8: Bacterial extracellular solute-binding protein; PDB: 2FNC_A 1ELJ_A 3TTM_B 3TTK_C 2W7Y_A 3RPW_A 2GHB_C 2GHA_A 1POY_3 1POT_A Back     alignment and domain information
>TIGR03850 bind_CPR_0540 carbohydrate ABC transporter substrate-binding protein, CPR_0540 family Back     alignment and domain information
>PRK09474 malE maltose ABC transporter periplasmic protein; Reviewed Back     alignment and domain information
>PRK10974 glycerol-3-phosphate transporter periplasmic binding protein; Provisional Back     alignment and domain information
>COG1653 UgpB ABC-type sugar transport system, periplasmic component [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03851 chitin_NgcE carbohydrate ABC transporter, N-acetylglucosamine/diacetylchitobiose-binding protein Back     alignment and domain information
>PRK11622 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01276 thiB thiamine ABC transporter, periplasmic binding protein Back     alignment and domain information
>TIGR01254 sfuA ABC transporter periplasmic binding protein, thiB subfamily Back     alignment and domain information
>PRK11205 tbpA thiamine transporter substrate binding subunit; Provisional Back     alignment and domain information
>PF02030 Lipoprotein_8: Hypothetical lipoprotein (MG045 family) Back     alignment and domain information
>PF13343 SBP_bac_6: Bacterial extracellular solute-binding protein; PDB: 2QRY_D 1XVX_A 1SI1_A 1SI0_A 1Q35_A 1Y9U_A 2OWS_A 2OWT_A 2VP1_A 2VOZ_A Back     alignment and domain information
>TIGR03227 PhnS 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate binding protein Back     alignment and domain information
>PRK15046 2-aminoethylphosphonate ABC transporter substrate-binding protein; Provisional Back     alignment and domain information
>PF01547 SBP_bac_1: Bacterial extracellular solute-binding protein; InterPro: IPR006059 Bacterial high affinity transport systems are involved in active transport of solutes across the cytoplasmic membrane Back     alignment and domain information
>COG2182 MalE Maltose-binding periplasmic proteins/domains [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03261 phnS2 putative 2-aminoethylphosphonate ABC transporter, periplasmic 2-aminoethylphosphonate-binding protein Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query33
4eqb_A 330 Spermidine/putrescine ABC superfamily ATP binding 98.15
1pot_A 325 POTD, spermidine/putrescine-binding protein; polya 98.07
4gl0_A 333 LMO0810 protein; structural genomics, IDP05673, sp 98.06
1elj_A 381 Maltodextrin-binding protein; protein-carbohydrate 98.0
3ttm_A 346 Polyamine transport protein; polyamine binding, pu 97.86
3ttn_A 340 Polyamine transport protein; polyamine binding pro 97.86
4hs7_A 420 Bacterial extracellular solute-binding protein, P; 97.84
2gha_A 382 Maltose ABC transporter, periplasmic maltose-BIND 97.83
2v84_A 343 Spermidine/putrescine ABC transporter, periplasmi 97.77
2xd3_A 416 MALX, maltose/maltodextrin-binding protein; solute 97.76
1mh3_A 421 Maltose binding-A1 homeodomain protein chimera; MA 97.76
4hw8_A 420 Bacterial extracellular solute-binding protein, P; 97.72
2zyo_A 397 Solute-binding protein; open form, sugar binding p 97.69
3thi_A 371 Protein (thiaminase I); thiamin degradation, trans 97.69
3dm0_A 694 Maltose-binding periplasmic protein fused with RAC 97.69
1urs_A 402 Maltose-binding protein; maltodextrin-binding prot 97.68
1a99_A 344 POTF, putrescine-binding protein; transport, perip 97.67
3iot_A 449 Maltose-binding protein, huntingtin fusion protei; 97.66
3mq9_A 471 Bone marrow stromal antigen 2 fused to maltose-BI 97.63
2gh9_A 386 Maltose/maltodextrin-binding protein; MBP, maltose 97.61
3o3u_N 581 Maltose-binding periplasmic protein, advanced Gly 97.61
3oai_A 507 Maltose-binding periplasmic protein, myelin prote; 97.61
3csg_A 461 MBP, maltose-binding protein monobody YS1 fusion, 97.59
3n94_A 475 Fusion protein of maltose-binding periplasmic Pro 97.59
4dxb_A 637 RG13, maltose-binding periplasmic protein, beta-la 97.58
2xz3_A 463 Maltose ABC transporter periplasmic protein, ENVE 97.57
3ob4_A 500 Conglutin, maltose ABC transporter periplasmic pro 97.57
1hsj_A 487 Fusion protein consisting of staphylococcus access 97.56
3oo8_A 415 ABC transporter binding protein ACBH; class 2 SBP 97.55
4exk_A 487 Maltose-binding periplasmic protein, uncharacteri 97.53
4b3n_A 602 Maltose-binding periplasmic protein, tripartite mo 97.51
2pt1_A 334 Iron transport protein; C-clamp, iron-binding prot 97.49
2vgq_A 477 Maltose-binding periplasmic protein, mitochondrial 97.49
1r6z_P 509 Chimera of maltose-binding periplasmic protein AN 97.47
3k01_A 412 Acarbose/maltose binding protein GACH; ABC transpo 97.46
2zxt_A 465 Maltose-binding periplasmic protein, linker, MITO 97.46
1y4c_A 494 Maltose binding protein fused with designed helica 97.46
3py7_A 523 Maltose-binding periplasmic protein,paxillin LD1, 97.43
4aq4_A 419 SN-glycerol-3-phosphate-binding periplasmic prote; 97.41
3quf_A 414 Extracellular solute-binding protein, family 1; st 97.4
2nvu_B 805 Maltose binding protein/NEDD8-activating enzyme E1 97.39
2z8f_A 412 Galacto-N-biose/lacto-N-biose I transporter subst 97.38
4h1g_A 715 Maltose binding protein-cakar3 motor domain fusio; 97.37
3mp6_A 522 MBP, SGF29, maltose-binding periplasmic protein, l 97.36
3h3g_A 539 Fusion protein of maltose-binding periplasmic DOM 97.36
4gqo_A 433 LMO0859 protein; virulence, pathogenesis, vaccine 97.35
2heu_A 401 Sugar ABC transporter, sugar-binding protein; peri 97.35
2uvj_A 408 TOGB, ABC type periplasmic sugar-binding protein; 97.33
4g68_A 456 ABC transporter; transport protein; HET: XYS; 1.80 97.28
3h4z_A 568 Maltose-binding periplasmic protein fused with Al 97.27
3f5f_A 658 Maltose-binding periplasmic protein, heparan sulfa 97.26
3rpw_A 365 ABC transporter; structural genomics, PSI-biology, 97.26
1eu8_A 409 Trehalose/maltose binding protein; protein-carbohy 97.24
3osr_A 653 Maltose-binding periplasmic protein, green fluore 97.24
3uor_A 458 ABC transporter sugar binding protein; ALFA/beta p 97.23
2w7y_A 430 FCSSBP, probable sugar ABC transporter, sugar-bind 97.21
2b3f_A 400 Glucose-binding protein; protein-carbohydrate comp 97.2
4i1d_A 324 ABC transporter substrate-binding protein; structu 97.18
3i3v_A 405 Probable secreted solute-binding lipoprotein; tran 97.15
3osq_A 661 Maltose-binding periplasmic protein, green fluore 97.12
3pu5_A 333 Extracellular solute-binding protein; structural g 96.93
1xvx_A 312 YFUA; periplasmic iron binding protein, iron bindi 96.9
4euo_A 320 ABC transporter, substrate binding protein (polya; 96.68
2qry_A 330 Thiamine-binding periplasmic protein; thiamin bind 96.64
1y9u_A 323 Putative iron binding protein; periplasmic binding 96.64
1q35_A 320 Iron binding protein FBPA; metal binding protein; 96.63
3a09_A 490 ALGQ1; sugar binding protein, alginate; HET: MAW B 96.54
1nnf_A 309 Iron-utilization periplasmic protein; iron-binding 96.35
4edp_A 351 ABC transporter, substrate-binding protein; clostr 96.32
3vlv_A 502 ALGQ1; sugar binding protein, alginate; HET: MAW L 96.26
3omb_A 535 Extracellular solute-binding protein, family 1; PS 96.23
2voz_A 346 FUTA2, periplasmic iron-binding protein; ferric bi 96.04
3e13_X 322 Putative iron-uptake ABC transport system, peripla 95.49
3c9h_A 355 ABC transporter, substrate binding protein; struct 92.41
1sbp_A 310 Sulfate-binding protein; 1.70A {Salmonella typhimu 83.66
3cg1_A 296 UPF0100 protein PF0080; ABC transporter, binding p 82.64
2k1g_A135 Lipoprotein SPR; solution structure, bacterial lip 80.16
>4eqb_A Spermidine/putrescine ABC superfamily ATP binding transporter, binding protein; structural genomics, niaid; HET: EPE; 1.50A {Streptococcus pneumoniae TCH8431} Back     alignment and structure
Probab=98.15  E-value=3.7e-07  Score=52.69  Aligned_cols=24  Identities=21%  Similarity=0.436  Sum_probs=22.3

Q ss_pred             CCcEEEeeecccceEEEEeCCCCC
Q 041883           10 RDKIWAASHRWGTVVIAYKKKASH   33 (33)
Q Consensus        10 ~G~iwgvPyrWG~t~IaYr~dkf~   33 (33)
                      +|++||+||.|++++|+||+|.|+
T Consensus       102 ~g~~y~vP~~~~~~~l~Ynkd~~~  125 (330)
T 4eqb_A          102 PGNKFSIPYFWGTLGIVYNETMVD  125 (330)
T ss_dssp             GGGSSCEEEEEEEEEEEEEGGGCS
T ss_pred             CCCeEEEEEecccEEEEEEHHHcC
Confidence            589999999999999999999874
>1pot_A POTD, spermidine/putrescine-binding protein; polyamine transport protein; HET: SPD; 1.80A {Escherichia coli} SCOP: c.94.1.1 PDB: 1poy_1* Back     alignment and structure
>4gl0_A LMO0810 protein; structural genomics, IDP05673, spermidine, putrescine, ABC transporter, niaid; HET: MSE PGE PG4; 1.92A {Listeria monocytogenes} Back     alignment and structure
>1elj_A Maltodextrin-binding protein; protein-carbohydrate complex, maltose binding protein, MBP fold, ABC transporter fold, thermophilic protein; HET: CME GLC; 1.85A {Pyrococcus furiosus} SCOP: c.94.1.1 Back     alignment and structure
>3ttm_A Polyamine transport protein; polyamine binding, putrescine; 2.00A {Pseudomonas aeruginosa} PDB: 3ttk_A Back     alignment and structure
>3ttn_A Polyamine transport protein; polyamine binding protein, spermidine; HET: SPD; 2.00A {Pseudomonas aeruginosa} PDB: 3ttl_A* Back     alignment and structure
>4hs7_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: P33; 2.60A {Staphylococcus aureus subsp} Back     alignment and structure
>2gha_A Maltose ABC transporter, periplasmic maltose-BIND protein; periplasmic binding protein, MBP, maltotriose; HET: MLR; 1.60A {Thermotoga maritima} PDB: 2ghb_A 2fnc_A* Back     alignment and structure
>2v84_A Spermidine/putrescine ABC transporter, periplasmi binding protein; polyamine binding, SYPH spermidine, lipoprotein, transport protein; HET: MES; 1.78A {Treponema pallidum} Back     alignment and structure
>2xd3_A MALX, maltose/maltodextrin-binding protein; solute-binding protein, sugar binding protein, virulence, alpha-glucan, sugar transport; HET: GLC; 2.00A {Streptococcus pneumoniae} PDB: 2xd2_A* Back     alignment and structure
>1mh3_A Maltose binding-A1 homeodomain protein chimera; MATA1, binding cooperativity, maltose binding protein, MBP, sugar binding, DNA binding protein; 2.10A {Escherichia coli} SCOP: a.4.1.1 c.94.1.1 PDB: 1mh4_A 1le8_A Back     alignment and structure
>4hw8_A Bacterial extracellular solute-binding protein, P; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: MAL; 2.25A {Staphylococcus aureus subsp} PDB: 4hs7_A* Back     alignment and structure
>2zyo_A Solute-binding protein; open form, sugar binding protein; HET: GLC; 1.55A {Thermoactinomyces vulgaris} PDB: 2zyk_A* 2zym_A* 2zyn_A* 2dfz_A* Back     alignment and structure
>3thi_A Protein (thiaminase I); thiamin degradation, transferase; 2.00A {Bacillus subtilis} SCOP: c.94.1.1 PDB: 2thi_A 4thi_A Back     alignment and structure
>3dm0_A Maltose-binding periplasmic protein fused with RACK1; MBP RACK1A, receptor for activiated protein C-kinase 1, beta-propeller WD40 repeat; HET: GLC; 2.40A {Escherichia coli} Back     alignment and structure
>1urs_A Maltose-binding protein; maltodextrin-binding protein, acidophIle, thermoacidophIle, hyperthermophIle, thermophIle; HET: MLR; 1.45A {Alicyclobacillus acidocaldarius} SCOP: c.94.1.1 PDB: 1urg_A* 1urd_A* Back     alignment and structure
>1a99_A POTF, putrescine-binding protein; transport, periplasmic putrescine binding protein (POTF); 2.20A {Escherichia coli} SCOP: c.94.1.1 Back     alignment and structure
>3iot_A Maltose-binding protein, huntingtin fusion protei; HTT-EX1, HD, sugar transport, transport, apoptos disease mutation, nucleus; 3.50A {Escherichia coli k-12} PDB: 3io6_A 3io4_A 3ior_A 3iou_A 3iov_A 3iow_A Back     alignment and structure
>3mq9_A Bone marrow stromal antigen 2 fused to maltose-BI periplasmic protein; HIV, antiviral protein; 2.80A {Escherichia coli} Back     alignment and structure
>2gh9_A Maltose/maltodextrin-binding protein; MBP, maltose binding protein, thermoph protein, periplasmic binding protein, sugar binding protein; HET: MLR; 1.95A {Thermus thermophilus} Back     alignment and structure
>3o3u_N Maltose-binding periplasmic protein, advanced Gly END product-specific receptor; RAGE, AGER, scavenger receptor; HET: MLR; 1.50A {Escherichia coli} PDB: 3s59_A 3s58_A 3cjj_A 2l7u_A* 2e5e_A Back     alignment and structure
>3oai_A Maltose-binding periplasmic protein, myelin prote; schwann cell membrane protein, immunoglobulin-folding, inter adhesion, tetramer; HET: MAL; 2.10A {Escherichia coli} Back     alignment and structure
>3csg_A MBP, maltose-binding protein monobody YS1 fusion, MMBP; engineered binding protein, antibody mimic, synthetic protein interface; 1.80A {Escherichia coli} PDB: 2obg_A 3csb_A* 3a3c_A* 3d4g_A* 3d4c_A* 3ef7_A* Back     alignment and structure
>3n94_A Fusion protein of maltose-binding periplasmic Pro pituitary adenylate cyclase 1 receptor-short...; G-protein coupled receptor; HET: MAL; 1.80A {Escherichia coli} PDB: 3ehs_A* 3ehu_A* 3eht_A* 3n93_A* 3n95_A* 3n96_A* Back     alignment and structure
>4dxb_A RG13, maltose-binding periplasmic protein, beta-lactama chimera; TEM, beta-lactamase, MBP, allosteric regulation, zinc bindin maltose binding; 2.29A {Escherichia coli} PDB: 4dxc_A Back     alignment and structure
>2xz3_A Maltose ABC transporter periplasmic protein, ENVE glycoprotein; viral protein, viral membrane fusion, hairpin, chimera; HET: MAL; 1.95A {Escherichia coli} PDB: 1mg1_A* Back     alignment and structure
>3ob4_A Conglutin, maltose ABC transporter periplasmic protein, ARAH; alpha-amylase inhibitors (AAI), lipid transfer (LT) and SEED (SS) protein family; HET: MLR; 2.71A {Escherichia coli} Back     alignment and structure
>1hsj_A Fusion protein consisting of staphylococcus accessary regulator protein R and maltose...; novel fold for DNA binding; HET: GLC; 2.30A {Escherichia coli} SCOP: a.4.5.28 c.94.1.1 Back     alignment and structure
>3oo8_A ABC transporter binding protein ACBH; class 2 SBP fold, ABC transporter extracellular solute bindi protein, D-galactose binding; 1.60A {Actinoplanes} PDB: 3oo6_A* 3oo7_A 3oo9_A 3ooa_A Back     alignment and structure
>4exk_A Maltose-binding periplasmic protein, uncharacteri protein chimera; MCSG, pcsep, MBP-fused target, structural genomics; HET: MTT; 1.28A {Escherichia coli} PDB: 3g7v_A* 3g7w_A* 3sev_A* 3ser_A* 3sew_A* 3set_A* 3ses_A* 3seu_A* 3sex_A* 3sey_A* 3q27_A* 3q28_A* 3q26_A* 3q25_A* 3q29_A* 1nmu_A* 2ok2_A* 3pgf_A* 1t0k_A* 3rum_A* ... Back     alignment and structure
>4b3n_A Maltose-binding periplasmic protein, tripartite motif-containing protein 5; sugar binding protein-ligase complex; HET: MAL MES; 3.30A {Escherichia coli} PDB: 2lm3_A Back     alignment and structure
>2pt1_A Iron transport protein; C-clamp, iron-binding protein, solute-binding protein, perip binding protein, ABC transporter, metal transport; 2.00A {Synechocystis SP} PDB: 2pt2_A 3f11_A Back     alignment and structure
>2vgq_A Maltose-binding periplasmic protein, mitochondrial antiviral-signaling protein; immune system/transport, IPS1/MAVS/VISA/cardif; HET: MTT; 2.1A {Escherichia coli} Back     alignment and structure
>1r6z_P Chimera of maltose-binding periplasmic protein AN argonaute 2; deviant OB fold, RNAI, gene regulation; HET: MAL; 2.80A {Escherichia coli} SCOP: b.34.14.1 c.94.1.1 Back     alignment and structure
>3k01_A Acarbose/maltose binding protein GACH; ABC transporter, acarbose-binding protein, transport protein; 1.35A {Streptomyces glaucescens} PDB: 3jzj_A* 3k00_A* 3k02_A* Back     alignment and structure
>2zxt_A Maltose-binding periplasmic protein, linker, MITO intermembrane space import AND...; disulfide bond, alpha helix, fusion, sugar transport; HET: MAL; 3.00A {Escherichia coli} Back     alignment and structure
>1y4c_A Maltose binding protein fused with designed helical protein; de novo designed helical protein, maltose binding protein fusion, de novo protein; HET: GLC; 1.90A {Escherichia coli} Back     alignment and structure
>3py7_A Maltose-binding periplasmic protein,paxillin LD1, chimera; viral protein; HET: MLR; 2.29A {Escherichia coli} Back     alignment and structure
>4aq4_A SN-glycerol-3-phosphate-binding periplasmic prote; diester-binding protein; HET: G3P; 1.80A {Escherichia coli} Back     alignment and structure
>3quf_A Extracellular solute-binding protein, family 1; structural genomics, PSI-biology, midwest center for structu genomics, MCSG; HET: MSE; 1.70A {Bifidobacterium longum subsp} Back     alignment and structure
>2nvu_B Maltose binding protein/NEDD8-activating enzyme E1 catalytic subunit chimera; multifunction macromolecular complex, ubiquitin, ATP, conformational change, thioester, switch, adenylation, protein turnover, ligase; HET: ATP; 2.80A {Homo sapiens} SCOP: c.111.1.2 c.94.1.1 Back     alignment and structure
>2z8f_A Galacto-N-biose/lacto-N-biose I transporter subst binding protein; ABC transporter, mucin core-1, human MILK oligosacchalide; HET: BGC GAL NAG MES; 1.65A {Bifidobacterium longum} PDB: 2z8e_A* 2z8d_A* Back     alignment and structure
>4h1g_A Maltose binding protein-cakar3 motor domain fusio; kinesin motor domain, motor protein, chimera; HET: MTT ADP EDO; 2.15A {Escherichia coli} Back     alignment and structure
>3mp6_A MBP, SGF29, maltose-binding periplasmic protein, linker, SAGA associated factor 29; histone, tudor domain, histone binding protei; HET: MLY MAL; 1.48A {Escherichia coli} PDB: 3mp1_A* 3mp8_A* Back     alignment and structure
>3h3g_A Fusion protein of maltose-binding periplasmic DOM human parathyroid hormone receptor...; GPCR, extracellular domain, PTHRP, PTH, PThr1, sugar transpo transport, membrane protein; HET: MAL; 1.94A {Escherichia coli} PDB: 3c4m_A* 3l2j_A* Back     alignment and structure
>4gqo_A LMO0859 protein; virulence, pathogenesis, vaccine candidate, center for struc genomics of infectious diseases, csgid, niaid; HET: MSE PGE; 2.10A {Listeria monocytogenes} Back     alignment and structure
>2heu_A Sugar ABC transporter, sugar-binding protein; periplasmic binding protein, transport protein; 1.04A {Streptococcus pneumoniae} PDB: 2hq0_A 2i58_A* 2hfb_A Back     alignment and structure
>2uvj_A TOGB, ABC type periplasmic sugar-binding protein; periplasmic binding protein, pectin degradation, trigalacturonic acid; HET: ADA; 1.8A {Yersinia enterocolitica} PDB: 2uvi_A* 2uvh_A* 2uvg_A 3u1o_A Back     alignment and structure
>4g68_A ABC transporter; transport protein; HET: XYS; 1.80A {Caldanaerobius} PDB: 4g68_B* Back     alignment and structure
>3h4z_A Maltose-binding periplasmic protein fused with Al DERP7; MBP fusion, AHA1/BPI domain-like, super roll, sugar T transport, allergen; HET: GLC; 2.35A {Escherichia coli} Back     alignment and structure
>3f5f_A Maltose-binding periplasmic protein, heparan sulfate 2-O-sulfotransferase 1; maltose binding protein, fusion, heparan sulfate biosynthesis; HET: GLC A3P; 2.65A {Escherichia coli k-12} Back     alignment and structure
>3rpw_A ABC transporter; structural genomics, PSI-biology, protein structure initiati midwest center for structural genomics, MCSG; HET: MSE; 1.65A {Rhodopseudomonas palustris} Back     alignment and structure
>1eu8_A Trehalose/maltose binding protein; protein-carbohydrate complex, MBP 2 fold, ABC transporter fold, thermophilic protein; HET: TRE; 1.90A {Thermococcus litoralis} SCOP: c.94.1.1 Back     alignment and structure
>3osr_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 2.00A {Escherichia coli} Back     alignment and structure
>3uor_A ABC transporter sugar binding protein; ALFA/beta protein, periplasmic-binding protein, maltose, SUG binding protein; 2.20A {Xanthomonas axonopodis PV} Back     alignment and structure
>2w7y_A FCSSBP, probable sugar ABC transporter, sugar-binding protein; solute-binding protein, blood group antigen, carbohydrate transport; HET: A2G GAL FUC; 2.35A {Streptococcus pneumoniae} Back     alignment and structure
>2b3f_A Glucose-binding protein; protein-carbohydrate complex, periplasmic binding protein, galactose, GBP, sugar binding protein; HET: GAL; 1.56A {Thermus thermophilus HB27} PDB: 2b3b_A* Back     alignment and structure
>4i1d_A ABC transporter substrate-binding protein; structural genomics, PSI-biology; 2.20A {Bradyrhizobium japonicum} Back     alignment and structure
>3i3v_A Probable secreted solute-binding lipoprotein; transporter, PSI-II, structural genomics, protein structure initiative; 2.30A {Streptomyces coelicolor} Back     alignment and structure
>3osq_A Maltose-binding periplasmic protein, green fluore protein; engineered protein, sensor protein, fluorescent protein, MBP maltose sensor; HET: C12 MAL; 1.90A {Escherichia coli} Back     alignment and structure
>3pu5_A Extracellular solute-binding protein; structural genomics, PSI-2, protein structure initiative; 2.05A {Bordetella parapertussis} Back     alignment and structure
>1xvx_A YFUA; periplasmic iron binding protein, iron binding protein; 1.53A {Yersinia enterocolitica} SCOP: c.94.1.1 PDB: 1xvy_A* Back     alignment and structure
>4euo_A ABC transporter, substrate binding protein (polya; class D of PBP, GABA-binding, transport protein; 1.28A {Agrobacterium tumefaciens} PDB: 4eq7_A Back     alignment and structure
>2qry_A Thiamine-binding periplasmic protein; thiamin binding protein, ABC transporter, transport protein; HET: TPS; 2.25A {Escherichia coli} Back     alignment and structure
>1y9u_A Putative iron binding protein; periplasmic binding protein, iron tyrosinate interaction, metal binding protein; 1.39A {Bordetella pertussis tohama I} SCOP: c.94.1.1 PDB: 2ows_A 2owt_A Back     alignment and structure
>1q35_A Iron binding protein FBPA; metal binding protein; 1.20A {Mannheimia haemolytica} SCOP: c.94.1.1 PDB: 1si0_A 1si1_A Back     alignment and structure
>3a09_A ALGQ1; sugar binding protein, alginate; HET: MAW BEM MAV; 1.40A {Sphingomonas} PDB: 1y3p_A* 1y3q_A 1y3n_A* 3vlv_A* 3vlu_A* 3vlw_A* 1j1n_A* 1kwh_A Back     alignment and structure
>1nnf_A Iron-utilization periplasmic protein; iron-binding protein, EDTA-Fe-protein complex, metal binding protein; HET: EDT; 1.10A {Haemophilus influenzae} SCOP: c.94.1.1 PDB: 1mrp_A 1d9v_A 3od7_A 3odb_A 1qvs_A 2o6a_A 2o68_A 3kn8_A 3kn7_A 2o69_A 1qw0_A 1o7t_A* 1xc1_A* 1r1n_A* 1d9y_A Back     alignment and structure
>4edp_A ABC transporter, substrate-binding protein; clostridium PERF ATCC 13124, center for structural genomics of infectious DI csgid; 1.85A {Clostridium perfringens} Back     alignment and structure
>3vlv_A ALGQ1; sugar binding protein, alginate; HET: MAW LGU; 1.50A {Sphingomonas SP} SCOP: c.94.1.1 PDB: 3vlu_A* 3vlw_A* 1y3n_A* 1y3p_A* 1y3q_A 1j1n_A* 1kwh_A Back     alignment and structure
>3omb_A Extracellular solute-binding protein, family 1; PSI-2, midwest center for structural genomics, protein struc initiative, MCSG; 2.10A {Bifidobacterium longum subsp} Back     alignment and structure
>2voz_A FUTA2, periplasmic iron-binding protein; ferric binding protein, metal-binding protein, TAT; 1.70A {Synechocystis SP} PDB: 2vp1_A* Back     alignment and structure
>3e13_X Putative iron-uptake ABC transport system, periplasmic iron-binding protein; beta sheet surrounded by alpha helices; 1.60A {Campylobacter jejuni} SCOP: c.94.1.1 PDB: 1y4t_A Back     alignment and structure
>3c9h_A ABC transporter, substrate binding protein; structural genom MCSG, PSI-2, protein structure initiative; HET: CIT; 1.90A {Agrobacterium tumefaciens str} Back     alignment and structure
>1sbp_A Sulfate-binding protein; 1.70A {Salmonella typhimurium} SCOP: c.94.1.1 Back     alignment and structure
>3cg1_A UPF0100 protein PF0080; ABC transporter, binding protein, molybdate, tungstate, ligand, unknown function, transport protein; 1.60A {Pyrococcus furiosus} PDB: 3cg3_A Back     alignment and structure
>2k1g_A Lipoprotein SPR; solution structure, bacterial lipoprotein, cysteine PEPT NPLC/P60 family, construct optimized, membrane, palmitate; NMR {Escherichia coli} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query33
d1laxa_ 369 D-maltodextrin-binding protein, MBP {Escherichia c 97.79
d1elja_ 380 D-maltodextrin-binding protein, MBP {Archaeon Pyro 97.75
d3thia_ 362 Thiaminase I {Paenibacillus thiaminolyticus [TaxId 97.73
d1ursa_ 367 D-maltodextrin-binding protein, MBP {Alicyclobacil 97.66
d1pota_ 322 Spermidine/putrescine-binding protein PotD {Escher 97.34
d1eu8a_ 407 D-maltodextrin-binding protein, MBP {Archaeon Ther 97.26
d1a99a_ 341 Putrescine receptor (PotF) {Escherichia coli [TaxI 96.33
d1j1na_ 492 Alginate-binding periplasmic protein AlgQ2 {Sphing 95.96
d1xvxa_ 311 Ferric-binding protein FbpA {Yersinia enterocoliti 94.87
d1q35a_ 318 Ferric-binding protein FbpA {Mannheimia haemolytic 94.52
d1y4ta_ 317 Ferric-binding protein FbpA {Campylobacter jejuni 84.94
d1tz7a1 485 Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363] 82.67
d1y9ua_ 318 Ferric-binding protein FbpA {Bordetella pertussis 81.33
>d1laxa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Periplasmic binding protein-like II
superfamily: Periplasmic binding protein-like II
family: Phosphate binding protein-like
domain: D-maltodextrin-binding protein, MBP
species: Escherichia coli [TaxId: 562]

Probab=97.79  E-value=4.2e-06  Score=46.51  Aligned_cols=24  Identities=17%  Similarity=0.145  Sum_probs=22.8

Q ss_pred             CCcEEEeeecccceEEEEeCCCCC
Q 041883           10 RDKIWAASHRWGTVVIAYKKKASH   33 (33)
Q Consensus        10 ~G~iwgvPyrWG~t~IaYr~dkf~   33 (33)
                      ||++||+|+.+.+.++.||++.|+
T Consensus       100 dG~~ygiP~~~~~~~~~ynkd~~~  123 (369)
T d1laxa_         100 NGKLIAYPIAVEALSLIYNKDLLP  123 (369)
T ss_dssp             TTEECSEEEEEECCEEEEETTTCS
T ss_pred             CCEEEEEeeeccceeeEEeccccc
Confidence            899999999999999999999884
>d1elja_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d3thia_ c.94.1.1 (A:) Thiaminase I {Paenibacillus thiaminolyticus [TaxId: 49283]} Back     information, alignment and structure
>d1ursa_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Alicyclobacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1pota_ c.94.1.1 (A:) Spermidine/putrescine-binding protein PotD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1eu8a_ c.94.1.1 (A:) D-maltodextrin-binding protein, MBP {Archaeon Thermococcus litoralis [TaxId: 2265]} Back     information, alignment and structure
>d1a99a_ c.94.1.1 (A:) Putrescine receptor (PotF) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1j1na_ c.94.1.1 (A:) Alginate-binding periplasmic protein AlgQ2 {Sphingomonas sp. [TaxId: 28214]} Back     information, alignment and structure
>d1xvxa_ c.94.1.1 (A:) Ferric-binding protein FbpA {Yersinia enterocolitica, YfuA [TaxId: 630]} Back     information, alignment and structure
>d1q35a_ c.94.1.1 (A:) Ferric-binding protein FbpA {Mannheimia haemolytica [TaxId: 75985]} Back     information, alignment and structure
>d1y4ta_ c.94.1.1 (A:) Ferric-binding protein FbpA {Campylobacter jejuni [TaxId: 197]} Back     information, alignment and structure
>d1tz7a1 c.1.8.1 (A:1-485) Amylomaltase MalQ {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d1y9ua_ c.94.1.1 (A:) Ferric-binding protein FbpA {Bordetella pertussis [TaxId: 520]} Back     information, alignment and structure