Citrus Sinensis ID: 041905


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MPRKKRLTKEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDLSKKGEMHKRASNAFESDEGRDPMERCPGRKK
ccccccccccccccccccEEccccEEEEEccccccccccccccccccccccccccCEcccccccccccccccEEccccccccccccccccEEEEccccccccccHHHHHHHHHccccccccccccccccccEEEEEHHHHHHHHHHccccHHHHHHHHHHccccccccccccccccccccccccccccccc
************SENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDL*******************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRKKRLTKEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDLSKKGEMHKRASNAFESDEGRDPMERCPGRKK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

No confident close homologs for annotation transfering were detected in SWISSPROT

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2L5U, chain A
Confidence level:very confident
Coverage over the Query: 9-60
View the alignment between query and template
View the model in PyMOL
Template: 2PUY, chain A
Confidence level:confident
Coverage over the Query: 62-111
View the alignment between query and template
View the model in PyMOL
Template: 2RI7, chain A
Confidence level:probable
Coverage over the Query: 71-150
View the alignment between query and template
View the model in PyMOL