Citrus Sinensis ID: 041905

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-
MPRKKRLTKEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDLSKKGEMHKRASNAFESDEGRDPMERCPGRKK
ccccccccccccccccccEEccccEEEEEccccccccccccccccccccccccccEEcccccccccccccccEEccccccccccccccccEEEEccccccccccHHHHHHHHHccccccccccccccccccEEEEEHHHHHHHHHHHcccHHHHHHHHHHccccccccccccccccccccccccccccccc
cccccccccccccccEEEEEccccEEEEEccccccccccHHHccccccccccccccEcccccccccccccHHHHccccHHHHHHHccccEEEEccccccccHHHHHHHHHHHccccccccccEEccccccHHHHHHHHHHHHHHHHccccHHHHHHHHcHccccccccccccccccccccccccccccccc
mprkkrltkeeisenwcyvckdggklrlcdhlrcpkvyhsecvdkdesFLVAETKwtcnwhychvcgkaskfyclccpsavcktclyDAQFAVVKRNKGFCNSCLELAWLIETnkdvksvgcnidvnhpkttdyffNGYWQTIKqkegltskNVILAYDlskkgemhkrasnafesdegrdpmercpgrkk
mprkkrltkeeisenwcyvcKDGGKLRLCDHLRCPKVyhsecvdkdESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIkqkegltskNVILAYDlskkgemhkrasnafesdegrdpmercpgrkk
MPRKKRLTKEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDLSKKGEMHKRASNAFESDEGRDPMERCPGRKK
***********ISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDL*******************************
***************WCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETN*****V*CNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVI************************************
**********EISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDLSKKG***************************
************SENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDLS******************************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MPRKKRLTKEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFFNGYWQTIKQKEGLTSKNVILAYDLSKKGEMHKRASNAFESDEGRDPMERCPGRKK
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query191 2.2.26 [Sep-21-2011]
Q9SD34 1292 Zinc finger CCCH domain-c no no 0.701 0.103 0.388 3e-29
Q9SIV5 1773 Zinc finger CCCH domain-c no no 0.926 0.099 0.346 7e-29
O88491 2588 Histone-lysine N-methyltr yes no 0.413 0.030 0.4 7e-12
Q8BVE81365 Histone-lysine N-methyltr no no 0.450 0.063 0.382 1e-11
O960281365 Histone-lysine N-methyltr yes no 0.450 0.063 0.382 1e-11
Q96L73 2696 Histone-lysine N-methyltr no no 0.392 0.027 0.407 2e-11
Q6P2L61439 Histone-lysine N-methyltr no no 0.413 0.054 0.378 8e-11
Q9BZ951437 Histone-lysine N-methyltr no no 0.408 0.054 0.370 3e-10
Q22516 1787 Chromodomain-helicase-DNA yes no 0.523 0.055 0.260 2e-05
O97159 1982 Chromodomain-helicase-DNA no no 0.376 0.036 0.309 2e-05
>sp|Q9SD34|C3H44_ARATH Zinc finger CCCH domain-containing protein 44 OS=Arabidopsis thaliana GN=At3g51120 PE=2 SV=3 Back     alignment and function desciption
 Score =  128 bits (321), Expect = 3e-29,   Method: Composition-based stats.
 Identities = 52/134 (38%), Positives = 74/134 (55%)

Query: 17  CYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLC 76
           C++C DGG L LCD   CPK YH  C+ +DE+F     KW C WH C  C KAS + C  
Sbjct: 113 CFICFDGGDLVLCDRRNCPKAYHPACIKRDEAFFRTTAKWNCGWHICGTCQKASSYMCYT 172

Query: 77  CPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKTTDYFF 136
           C  +VCK C+ DA + +V+ N G C +C++   LIE      +    +D +   + +Y F
Sbjct: 173 CTFSVCKRCIKDADYVIVRGNMGLCGTCIKPIMLIENIAQGDNEAVKVDFDDKLSWEYLF 232

Query: 137 NGYWQTIKQKEGLT 150
             YW  +K++  LT
Sbjct: 233 KVYWLCLKEELSLT 246

Arabidopsis thaliana (taxid: 3702)
>sp|Q9SIV5|C3H19_ARATH Zinc finger CCCH domain-containing protein 19 OS=Arabidopsis thaliana GN=NERD PE=1 SV=3 Back     alignment and function description
>sp|O88491|NSD1_MOUSE Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Mus musculus GN=Nsd1 PE=1 SV=1 Back     alignment and function description
>sp|Q8BVE8|NSD2_MOUSE Histone-lysine N-methyltransferase NSD2 OS=Mus musculus GN=Whsc1 PE=1 SV=2 Back     alignment and function description
>sp|O96028|NSD2_HUMAN Histone-lysine N-methyltransferase NSD2 OS=Homo sapiens GN=WHSC1 PE=1 SV=1 Back     alignment and function description
>sp|Q96L73|NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 and H4 lysine-20 specific OS=Homo sapiens GN=NSD1 PE=1 SV=1 Back     alignment and function description
>sp|Q6P2L6|NSD3_MOUSE Histone-lysine N-methyltransferase NSD3 OS=Mus musculus GN=Whsc1l1 PE=1 SV=2 Back     alignment and function description
>sp|Q9BZ95|NSD3_HUMAN Histone-lysine N-methyltransferase NSD3 OS=Homo sapiens GN=WHSC1L1 PE=1 SV=1 Back     alignment and function description
>sp|Q22516|CHD3_CAEEL Chromodomain-helicase-DNA-binding protein 3 homolog OS=Caenorhabditis elegans GN=chd-3 PE=2 SV=2 Back     alignment and function description
>sp|O97159|CHDM_DROME Chromodomain-helicase-DNA-binding protein Mi-2 homolog OS=Drosophila melanogaster GN=Mi-2 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
357460667 814 hypothetical protein MTR_3g064280 [Medic 0.884 0.207 0.529 9e-48
357460665 964 Zinc finger CCCH domain-containing prote 0.900 0.178 0.502 7e-44
357460661 862 Zinc finger CCCH domain-containing prote 0.790 0.175 0.529 3e-42
255575932 517 conserved hypothetical protein [Ricinus 0.905 0.334 0.488 7e-41
357460663 814 Zinc finger CCCH domain-containing prote 0.858 0.201 0.494 9e-41
297739485 819 unnamed protein product [Vitis vinifera] 0.890 0.207 0.476 5e-40
449520998 471 PREDICTED: zinc finger CCCH domain-conta 0.963 0.390 0.454 9e-39
449431880 746 PREDICTED: zinc finger CCCH domain-conta 0.879 0.225 0.470 2e-38
48475176 620 unknown protein [Oryza sativa Japonica G 0.790 0.243 0.470 5e-37
356537823 520 PREDICTED: uncharacterized protein At5g0 0.795 0.292 0.493 2e-36
>gi|357460667|ref|XP_003600615.1| hypothetical protein MTR_3g064280 [Medicago truncatula] gi|355489663|gb|AES70866.1| hypothetical protein MTR_3g064280 [Medicago truncatula] Back     alignment and taxonomy information
 Score =  195 bits (495), Expect = 9e-48,   Method: Compositional matrix adjust.
 Identities = 90/170 (52%), Positives = 120/170 (70%), Gaps = 1/170 (0%)

Query: 12  ISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASK 71
           I+E WC+VCKDGG+LR+CD   C K YH++C+  D SF+  +  W C  HYC++CG+ASK
Sbjct: 13  IAEEWCFVCKDGGELRVCDFRDCLKTYHAKCLGHDASFMENDNNWCCGSHYCYLCGRASK 72

Query: 72  FYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNHPKT 131
           F CLCCP AVC  C YDA+FA VKRNKGFC  C +LA+LIETN DV S G  ID+  P T
Sbjct: 73  FMCLCCPIAVCGRCFYDAEFATVKRNKGFCRHCSKLAFLIETNADVDSDGEKIDMRDPDT 132

Query: 132 TDYFFNGYWQTIKQKEGLTSKNVILAYDLSKKGEMHKRASNAFESDEGRD 181
            + +F  Y+Q IK++EGL S+++ +A D+ K G+ +KR  + +E  EG D
Sbjct: 133 VESYFLEYYQVIKEREGLNSQDIYIARDIVKNGK-NKRDLDPYEIGEGED 181

Source: Medicago truncatula

Species: Medicago truncatula

Genus: Medicago

Family: Fabaceae

Order: Fabales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|357460665|ref|XP_003600614.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489662|gb|AES70865.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|357460661|ref|XP_003600612.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489660|gb|AES70863.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|255575932|ref|XP_002528863.1| conserved hypothetical protein [Ricinus communis] gi|223531714|gb|EEF33537.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|357460663|ref|XP_003600613.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] gi|355489661|gb|AES70864.1| Zinc finger CCCH domain-containing protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|297739485|emb|CBI29667.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449520998|ref|XP_004167519.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449431880|ref|XP_004133728.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|48475176|gb|AAT44245.1| unknown protein [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|356537823|ref|XP_003537424.1| PREDICTED: uncharacterized protein At5g08430-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query191
TAIR|locus:2060949 824 AT2G18090 "AT2G18090" [Arabido 0.910 0.211 0.370 6.8e-32
TAIR|locus:2080863 1292 AT3G51120 [Arabidopsis thalian 0.743 0.109 0.387 2.8e-30
TAIR|locus:2827287 1773 NERD "Needed for RDR2-independ 0.958 0.103 0.340 6.6e-28
UNIPROTKB|E1C7651372 WHSC1 "Uncharacterized protein 0.408 0.056 0.452 4.6e-15
ZFIN|ZDB-GENE-030131-25811461 whsc1 "Wolf-Hirschhorn syndrom 0.413 0.054 0.433 4.9e-15
UNIPROTKB|F1MMY41368 WHSC1 "Uncharacterized protein 0.502 0.070 0.382 4.1e-14
UNIPROTKB|J9NUG71359 WHSC1 "Uncharacterized protein 0.502 0.070 0.363 5.3e-14
UNIPROTKB|F1PK461362 WHSC1 "Uncharacterized protein 0.502 0.070 0.363 5.3e-14
UNIPROTKB|F1S8S01361 WHSC1 "Uncharacterized protein 0.502 0.070 0.363 6.7e-14
RGD|1307748 2381 Nsd1 "nuclear receptor binding 0.413 0.033 0.411 1.3e-13
TAIR|locus:2060949 AT2G18090 "AT2G18090" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 359 (131.4 bits), Expect = 6.8e-32, P = 6.8e-32
 Identities = 66/178 (37%), Positives = 94/178 (52%)

Query:     9 KEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGK 68
             K    E+ C+VC DGG L LCD   CPK YH  CV + E+F  + +KW C WH C  C K
Sbjct:    74 KRREDEDVCFVCFDGGSLVLCDRRGCPKAYHPACVKRTEAFFRSRSKWNCGWHICTTCQK 133

Query:    69 ASKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNH 128
              S + C  CP +VCK C+  +++ VV+ NKGFC  C++   LIE   +       +D + 
Sbjct:   134 DSFYMCYTCPYSVCKRCVRSSEYVVVRENKGFCGICMKTIMLIENAAEANKEKVQVDFDD 193

Query:   129 PKTTDYFFNGYWQTIKQKEGLTSKNVILAYD--LSKKGEMHKR--ASNAFESDEGRDP 182
               + +Y F  YW ++K+K GL+  ++  A +   S      KR   S   E D+G  P
Sbjct:   194 QGSWEYLFKIYWVSLKEKLGLSLDDLTKAKNPWKSSSSTAAKRRTTSRVHEKDDGNSP 251
GO:0003677 "DNA binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
GO:0008270 "zinc ion binding" evidence=IEA
TAIR|locus:2080863 AT3G51120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2827287 NERD "Needed for RDR2-independent DNA methylation" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|E1C765 WHSC1 "Uncharacterized protein" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-2581 whsc1 "Wolf-Hirschhorn syndrome candidate 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
UNIPROTKB|F1MMY4 WHSC1 "Uncharacterized protein" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|J9NUG7 WHSC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1PK46 WHSC1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|F1S8S0 WHSC1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
RGD|1307748 Nsd1 "nuclear receptor binding SET domain protein 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00035317001
SubName- Full=Chromosome undetermined scaffold_77, whole genome shotgun sequence; (431 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 191
KOG0383 696 consensus Predicted helicase [General function pre 99.56
KOG1244336 consensus Predicted transcription factor Requiem/N 99.12
KOG1512381 consensus PHD Zn-finger protein [General function 98.91
KOG4299 613 consensus PHD Zn-finger protein [General function 98.79
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 98.69
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 98.42
KOG4299 613 consensus PHD Zn-finger protein [General function 98.36
KOG0383 696 consensus Predicted helicase [General function pre 98.32
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 98.27
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 98.14
KOG1244336 consensus Predicted transcription factor Requiem/N 98.02
PF0062851 PHD: PHD-finger; InterPro: IPR019787 Zinc finger ( 97.97
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 97.97
PF15446175 zf-PHD-like: PHD/FYVE-zinc-finger like domain 97.84
smart0024947 PHD PHD zinc finger. The plant homeodomain (PHD) f 97.82
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.63
KOG1973274 consensus Chromatin remodeling protein, contains P 97.58
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 97.41
KOG1081 463 consensus Transcription factor NSD1 and related SE 97.26
KOG0825 1134 consensus PHD Zn-finger protein [General function 97.23
KOG0956 900 consensus PHD finger protein AF10 [General functio 97.2
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 97.13
KOG0957707 consensus PHD finger protein [General function pre 96.94
KOG1512381 consensus PHD Zn-finger protein [General function 96.89
KOG4443 694 consensus Putative transcription factor HALR/MLL3, 96.74
KOG0954 893 consensus PHD finger protein [General function pre 96.72
cd04718148 BAH_plant_2 BAH, or Bromo Adjacent Homology domain 96.58
KOG1973274 consensus Chromatin remodeling protein, contains P 96.15
COG5141 669 PHD zinc finger-containing protein [General functi 95.99
KOG0955 1051 consensus PHD finger protein BR140/LIN-49 [General 95.76
PF1377190 zf-HC5HC2H: PHD-like zinc-binding domain 95.69
KOG0957707 consensus PHD finger protein [General function pre 94.88
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 94.72
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 94.58
KOG1245 1404 consensus Chromatin remodeling complex WSTF-ISWI, 93.99
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 93.33
COG5141 669 PHD zinc finger-containing protein [General functi 92.59
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 92.54
PF1383136 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A. 92.43
KOG4323 464 consensus Polycomb-like PHD Zn-finger protein [Gen 91.68
COG5034271 TNG2 Chromatin remodeling protein, contains PhD zi 90.54
PF13832110 zf-HC5HC2H_2: PHD-zinc-finger like domain 89.04
PF1444654 Prok-RING_1: Prokaryotic RING finger family 1 88.78
KOG1473 1414 consensus Nucleosome remodeling factor, subunit NU 88.09
PF1179370 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A. 88.01
KOG0954 893 consensus PHD finger protein [General function pre 87.45
KOG3362156 consensus Predicted BBOX Zn-finger protein [Genera 86.97
KOG4628348 consensus Predicted E3 ubiquitin ligase [Posttrans 81.75
KOG0956 900 consensus PHD finger protein AF10 [General functio 81.7
PF10497105 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxida 81.66
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information 
Probab=99.56  E-value=6.1e-16  Score=147.84  Aligned_cols=141  Identities=21%  Similarity=0.401  Sum_probs=114.0

Q ss_pred             CCCCcccccccCccccccCCCCCeeec--------------------CcccccccCCc-eeeeccCCCCCCCcccCcccc
Q 041905           33 RCPKVYHSECVDKDESFLVAETKWTCN--------------------WHYCHVCGKAS-KFYCLCCPSAVCKTCLYDAQF   91 (191)
Q Consensus        33 ~CpkayH~~Cl~~~~~~~~~~g~W~Cp--------------------~h~C~~C~~~~-~~~C~~Cp~syh~~Cl~~~~l   91 (191)
                      .|+|+||..|++|.+.. .++++|.||                    +..|.+|++++ ++.|++|+.+||.+|+. +++
T Consensus         1 ~~~r~~~~~~~~p~~~~-~~~~~~k~~~~e~~~~~~~~~~~~~~~~~~e~c~ic~~~g~~l~c~tC~~s~h~~cl~-~pl   78 (696)
T KOG0383|consen    1 TCPRAYHRVCLDPKLKE-EPEMDPKCPGCESSSAQVEAKDDDWDDAEQEACRICADGGELLWCDTCPASFHASCLG-PPL   78 (696)
T ss_pred             CCCcccCcCCCCccccc-CCcCCccCcchhhcccccccccCCcchhhhhhhhhhcCCCcEEEeccccHHHHHHccC-CCC
Confidence            48999999999998865 568999999                    34799999987 79999999999999999 788


Q ss_pred             ccccCCcccCcCcH--HHHHHHhhhccccCCCCccC-------CCC-----CCccccC----CcceeEEeeecc-CCChh
Q 041905           92 AVVKRNKGFCNSCL--ELAWLIETNKDVKSVGCNID-------VNH-----PKTTDYF----FNGYWQTIKQKE-GLTSK  152 (191)
Q Consensus        92 ~~i~~~~w~C~~C~--~~~~~iek~~~~~~~~~~vd-------~~d-----~~~~E~~----~~~YW~~~k~k~-~l~~~  152 (191)
                      ..+|.+.|.|++|.  ....++++++.|.......+       +..     ...+|||    .++||||.|..+ .+...
T Consensus        79 ~~~p~~~~~c~Rc~~p~~~~k~~~il~~~~~~~~~~~~~~~~~~~~~~~~~~~~re~~vk~qg~s~~~c~~~~e~~~q~~  158 (696)
T KOG0383|consen   79 TPQPNGEFICPRCFCPKNAGKIEKILGWRWKPTPKPREGNQGVISPRRSNGIVEREFFVKWQGLSYWHCSWKSELLLQNP  158 (696)
T ss_pred             CcCCccceeeeeeccCCCcccccccceeEecCCCCccccCcCccCCcccccchhhhcccccccCCccchhHHHHHHhhhh
Confidence            88898889999996  45678999988733222211       111     2248888    789999999885 55556


Q ss_pred             hHHHHHhhhhCCCCCcCCCCCcCCC
Q 041905          153 NVILAYDLSKKGEMHKRASNAFESD  177 (191)
Q Consensus       153 ~~~~a~~~~r~~~~~~~~~~~~~~~  177 (191)
                      ...+.+++++..+++++  |.++++
T Consensus       159 ~~~~~~~~~~~~~~~~~--~~~~~~  181 (696)
T KOG0383|consen  159 LNTLPVELQRKHDTDQK--PEAEIG  181 (696)
T ss_pred             cccchHhhhhhhhcccC--cccccc
Confidence            78889999999999987  888886

>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG4299 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0383 consensus Predicted helicase [General function prediction only] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>KOG1244 consensus Predicted transcription factor Requiem/NEURO-D4 [Transcription] Back     alignment and domain information
>PF00628 PHD: PHD-finger; InterPro: IPR019787 Zinc finger (Znf) domains are relatively small protein motifs which contain multiple finger-like protrusions that make tandem contacts with their target molecule Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF15446 zf-PHD-like: PHD/FYVE-zinc-finger like domain Back     alignment and domain information
>smart00249 PHD PHD zinc finger Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1081 consensus Transcription factor NSD1 and related SET domain proteins [Transcription] Back     alignment and domain information
>KOG0825 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1512 consensus PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4443 consensus Putative transcription factor HALR/MLL3, involved in embryonic development [General function prediction only] Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>cd04718 BAH_plant_2 BAH, or Bromo Adjacent Homology domain, plant-specific sub-family with unknown function Back     alignment and domain information
>KOG1973 consensus Chromatin remodeling protein, contains PHD Zn-finger [Chromatin structure and dynamics] Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>KOG0955 consensus PHD finger protein BR140/LIN-49 [General function prediction only] Back     alignment and domain information
>PF13771 zf-HC5HC2H: PHD-like zinc-binding domain Back     alignment and domain information
>KOG0957 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG1245 consensus Chromatin remodeling complex WSTF-ISWI, large subunit (contains heterochromatin localization, PHD and BROMO domains) [Chromatin structure and dynamics] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>COG5141 PHD zinc finger-containing protein [General function prediction only] Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>PF13831 PHD_2: PHD-finger; PDB: 2L43_A 2KU3_A Back     alignment and domain information
>KOG4323 consensus Polycomb-like PHD Zn-finger protein [General function prediction only] Back     alignment and domain information
>COG5034 TNG2 Chromatin remodeling protein, contains PhD zinc finger [Chromatin structure and dynamics] Back     alignment and domain information
>PF13832 zf-HC5HC2H_2: PHD-zinc-finger like domain Back     alignment and domain information
>PF14446 Prok-RING_1: Prokaryotic RING finger family 1 Back     alignment and domain information
>KOG1473 consensus Nucleosome remodeling factor, subunit NURF301/BPTF [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF11793 FANCL_C: FANCL C-terminal domain; PDB: 3K1L_A Back     alignment and domain information
>KOG0954 consensus PHD finger protein [General function prediction only] Back     alignment and domain information
>KOG3362 consensus Predicted BBOX Zn-finger protein [General function prediction only] Back     alignment and domain information
>KOG4628 consensus Predicted E3 ubiquitin ligase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG0956 consensus PHD finger protein AF10 [General function prediction only] Back     alignment and domain information
>PF10497 zf-4CXXC_R1: Zinc-finger domain of monoamine-oxidase A repressor R1; InterPro: IPR018866 R1 is a transcription factor repressor that inhibits monoamine oxidase A gene expression Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
4gnd_A107 Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains 1e-10
2l5u_A61 Structure Of The First Phd Finger (Phd1) From Chd4 8e-04
>pdb|4GND|A Chain A, Crystal Structure Of Nsd3 Tandem Phd5-C5hch Domains Length = 107 Back     alignment and structure 
Iteration: 1

 Score = 62.4 bits (150), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 45/81 (55%), Gaps = 3/81 (3%)
Query: 3  RKKRLTKEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHY 62
          RK +   +++ E++C+ C DGG+L +CD   CPK YH  C++  +       KW C WH 
Sbjct: 4  RKIKTEPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQP---PYGKWECPWHQ 60
Query: 63 CHVCGKASKFYCLCCPSAVCK 83
          C  C  A+  +C  CP + CK
Sbjct: 61 CDECSSAAVSFCEFCPHSFCK 81
>pdb|2L5U|A Chain A, Structure Of The First Phd Finger (Phd1) From Chd4 (Mi2b) Length = 61 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query191
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 4e-08
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 1e-07
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 4e-07
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 3e-06
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 4e-06
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 4e-06
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 1e-05
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 3e-05
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 1e-04
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 1e-04
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 1e-04
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 5e-04
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 6e-04
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Length = 386 Back     alignment and structure
 Score = 51.1 bits (121), Expect = 4e-08
 Identities = 17/119 (14%), Positives = 34/119 (28%), Gaps = 11/119 (9%)

Query: 10  EEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKA 69
           ++  +++C +C  G  L +C +  C + Y  ECVD                         
Sbjct: 89  DDGYQSYCSICCSGETLLICGNPDCTRCYCFECVDS-----------LVGPGTSGKVHAM 137

Query: 70  SKFYCLCCPSAVCKTCLYDAQFAVVKRNKGFCNSCLELAWLIETNKDVKSVGCNIDVNH 128
           S + C  C  +     L   +    +    +         + ET    +     +    
Sbjct: 138 SNWVCYLCLPSSRSGLLQRRRKWRSQLKAFYDRESENPLEMFETVPVWRRQPVRVLSLF 196
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Length = 189 Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Length = 184 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Length = 61 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Length = 66 Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Length = 207 Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Length = 61 Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Length = 159 Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Length = 60 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 56 Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Length = 88 Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Length = 142 Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Length = 129 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 99.9
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 99.87
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 99.84
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 99.8
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.45
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 99.42
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 99.42
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 99.39
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.39
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 99.38
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.34
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 99.27
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 99.26
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.22
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 99.21
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 99.2
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 99.2
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.16
2yt5_A66 Metal-response element-binding transcription facto 99.15
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 99.14
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 99.13
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 99.11
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 99.11
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 99.1
2e6s_A77 E3 ubiquitin-protein ligase UHRF2; PHD domain, str 99.09
3asl_A70 E3 ubiquitin-protein ligase UHRF1; histone reader 99.05
2puy_A60 PHD finger protein 21A; PHD finger, histone CODE, 99.05
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 99.02
1mm2_A61 MI2-beta; PHD, zinc finger, protein scaffold, DNA 99.01
2lri_C66 Autoimmune regulator; Zn binding protein domain, a 99.0
1fp0_A88 KAP-1 corepressor; PHD domain, C3HC4 type zinc bin 98.97
2yql_A56 PHD finger protein 21A; PHD domain, structural gen 98.96
1xwh_A66 Autoimmune regulator; PHD domain, Zn binding domai 98.96
1f62_A51 Transcription factor WSTF; Zn-finger; NMR {Homo sa 98.94
2e6r_A92 Jumonji/ARID domain-containing protein 1D; PHD dom 98.92
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.92
2l5u_A61 Chromodomain-helicase-DNA-binding protein 4; CHD4, 98.92
2ysm_A111 Myeloid/lymphoid or mixed-lineage leukemia protein 98.86
3shb_A77 E3 ubiquitin-protein ligase UHRF1; unmodified hist 98.81
3v43_A112 Histone acetyltransferase KAT6A; MOZ, PHD finger, 98.81
2kwj_A114 Zinc finger protein DPF3; acetyl-lysine, transcrip 98.79
1wev_A88 Riken cDNA 1110020M19; structural genomics, PHD do 98.77
3ask_A226 E3 ubiquitin-protein ligase UHRF1; histone reader 98.73
2yt5_A66 Metal-response element-binding transcription facto 98.68
3o36_A184 Transcription intermediary factor 1-alpha; TRIM24, 98.68
3u5n_A207 E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, b 98.66
2ro1_A189 Transcription intermediary factor 1-beta; KAP, TIF 98.65
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.64
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 98.63
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 98.63
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 98.62
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 98.57
2ku3_A71 Bromodomain-containing protein 1; PHD finger, chro 98.49
1weu_A91 Inhibitor of growth family, member 4; structural g 98.49
2l43_A88 N-teminal domain from histone H3.3, linker, PHD1 f 98.48
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 98.38
4gne_A107 Histone-lysine N-methyltransferase NSD3; zinc fing 98.31
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 98.27
2lbm_A142 Transcriptional regulator ATRX; metal binding prot 98.23
2k16_A75 Transcription initiation factor TFIID subunit 3; p 98.17
3ql9_A129 Transcriptional regulator ATRX; zinc finger, trans 98.01
1wil_A89 KIAA1045 protein; ring finger domain, structural g 97.82
2vnf_A60 ING 4, P29ING4, inhibitor of growth protein 4; ace 97.77
1wen_A71 Inhibitor of growth family, member 4; ING1-like pr 97.77
1x4i_A70 Inhibitor of growth protein 3; structural genomics 97.74
2lv9_A98 Histone-lysine N-methyltransferase MLL5; zinc fing 97.7
1we9_A64 PHD finger family protein; structural genomics, PH 97.67
3c6w_A59 P28ING5, inhibitor of growth protein 5; chromatin, 97.66
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 97.65
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 97.62
2g6q_A62 Inhibitor of growth protein 2; protein-peptide com 97.61
2jmi_A90 Protein YNG1, ING1 homolog 1; PHD, histone, recogn 97.61
1weu_A91 Inhibitor of growth family, member 4; structural g 97.6
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 97.51
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 97.03
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 97.03
1x4i_A70 Inhibitor of growth protein 3; structural genomics 96.98
2ri7_A174 Nucleosome-remodeling factor subunit BPTF; zinc fi 96.97
3o70_A68 PHD finger protein 13; PHF13, structural genomics 96.94
1wee_A72 PHD finger family protein; structural genomics, PH 96.86
1wew_A78 DNA-binding family protein; structural genomics, P 96.81
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 96.72
1wil_A89 KIAA1045 protein; ring finger domain, structural g 96.7
1wem_A76 Death associated transcription factor 1; structura 96.68
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 96.22
1we9_A64 PHD finger family protein; structural genomics, PH 96.21
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 95.78
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 95.73
3a1b_A159 DNA (cytosine-5)-methyltransferase 3A, histone H3; 95.7
2xb1_A105 Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; 95.61
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 95.45
3o70_A68 PHD finger protein 13; PHF13, structural genomics 95.29
1wee_A72 PHD finger family protein; structural genomics, PH 95.21
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 95.15
2vpb_A65 Hpygo1, pygopus homolog 1; gene regulation, WNT si 95.05
1wep_A79 PHF8; structural genomics, PHD domain, riken struc 94.65
2kgg_A52 Histone demethylase jarid1A; PHD finger, histone m 94.48
1wem_A76 Death associated transcription factor 1; structura 94.11
2pv0_B 386 DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, 94.07
3kv5_D 488 JMJC domain-containing histone demethylation prote 93.86
3o7a_A52 PHD finger protein 13 variant; PHF13, zinc finger, 93.66
1wew_A78 DNA-binding family protein; structural genomics, P 93.62
3kqi_A75 GRC5, PHD finger protein 2; metal-binding, zinc-fi 92.56
4bbq_A117 Lysine-specific demethylase 2A; oxidoreductase, ub 92.56
2rsd_A68 E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant 91.97
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 91.54
2lq6_A87 Bromodomain-containing protein 1; PHD finger, meta 91.48
3pur_A 528 Lysine-specific demethylase 7 homolog; oxidoreduct 87.7
2d8s_A80 Cellular modulator of immune recognition; C-MIR, m 86.72
3lqh_A183 Histone-lysine N-methyltransferase MLL; PHD finger 85.39
3kv4_A 447 PHD finger protein 8; epigenetics, histone CODE, c 84.6
2kiz_A69 E3 ubiquitin-protein ligase arkadia; ring-H2 finge 83.82
3kv5_D 488 JMJC domain-containing histone demethylation prote 82.04
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
Probab=99.90  E-value=1.1e-24  Score=164.15  Aligned_cols=95  Identities=33%  Similarity=0.859  Sum_probs=80.8

Q ss_pred             CccccccccccccccceecccCceEeeCCCCCCCcccccccCccccccCCCCCeeecCcccccccCCceeeeccCCCCCC
Q 041905            3 RKKRLTKEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVCGKASKFYCLCCPSAVC   82 (191)
Q Consensus         3 ~~~~~~~~~~~ed~C~vC~dgGeLi~Cd~~~CpkayH~~Cl~~~~~~~~~~g~W~Cp~h~C~~C~~~~~~~C~~Cp~syh   82 (191)
                      |+.+...+..++++|++|++||+||+||.++||++||+.||++..   +|+|+|+||+|.|.+|++++.++|..||+|||
T Consensus         4 r~~~~~~~~~~~~~C~~C~~~G~ll~CD~~~Cp~~fH~~Cl~L~~---~P~g~W~Cp~c~C~~C~k~~~~~C~~Cp~sfC   80 (107)
T 4gne_A            4 RKIKTEPKQMHEDYCFQCGDGGELVMCDKKDCPKAYHLLCLNLTQ---PPYGKWECPWHQCDECSSAAVSFCEFCPHSFC   80 (107)
T ss_dssp             ------CCCSSCSSCTTTCCCSEEEECCSTTCCCEECTGGGTCSS---CCSSCCCCGGGBCTTTCSBCCEECSSSSCEEC
T ss_pred             ccccCCCcCCCCCCCCcCCCCCcEeEECCCCCCcccccccCcCCc---CCCCCEECCCCCCCcCCCCCCcCcCCCCcchh
Confidence            444555667899999999999999999977899999999999543   68999999999999999999999999999999


Q ss_pred             CcccCccccccccCCcccC
Q 041905           83 KTCLYDAQFAVVKRNKGFC  101 (191)
Q Consensus        83 ~~Cl~~~~l~~i~~~~w~C  101 (191)
                      .+|+. ..|..-+.+.|+|
T Consensus        81 ~~c~~-g~l~~~~~~~~~c   98 (107)
T 4gne_A           81 KDHEK-GALVPSALEGRLC   98 (107)
T ss_dssp             TTTCT-TSCEECTTTTCEE
T ss_pred             hhccC-CcceecCCCCcee
Confidence            99999 4455557888997
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>2e6s_A E3 ubiquitin-protein ligase UHRF2; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3asl_A E3 ubiquitin-protein ligase UHRF1; histone reader module, epigenetic regulation, LI binding protein complex; 1.41A {Homo sapiens} PDB: 3sou_A 3sow_A* 3sox_A 3zvy_A 2lgg_A 2lgk_A* 2lgl_A 3t6r_A 3zvz_B Back     alignment and structure
>2puy_A PHD finger protein 21A; PHD finger, histone CODE, BRAF-HDAC complex, transcription; 1.43A {Homo sapiens} Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1mm2_A MI2-beta; PHD, zinc finger, protein scaffold, DNA binding protein; NMR {Homo sapiens} SCOP: g.50.1.2 PDB: 2l75_A* 1mm3_A Back     alignment and structure
>2lri_C Autoimmune regulator; Zn binding protein domain, apeced, transcription; NMR {Homo sapiens} Back     alignment and structure
>1fp0_A KAP-1 corepressor; PHD domain, C3HC4 type zinc binding domain, -structure, transcription; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2yql_A PHD finger protein 21A; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1xwh_A Autoimmune regulator; PHD domain, Zn binding domain, apeced, nucleosome, E3 ligase, transcription; NMR {Homo sapiens} PDB: 2ke1_A 2kft_A Back     alignment and structure
>1f62_A Transcription factor WSTF; Zn-finger; NMR {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2e6r_A Jumonji/ARID domain-containing protein 1D; PHD domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2l5u_A Chromodomain-helicase-DNA-binding protein 4; CHD4, MI2B, MI2-beta, PHD, protein binding, peptide binding metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2ysm_A Myeloid/lymphoid or mixed-lineage leukemia protein 3 homolog; PHD domain, histone-lysine N-methyltransferase, H3 lysine-4 specific MLL3; NMR {Homo sapiens} Back     alignment and structure
>3shb_A E3 ubiquitin-protein ligase UHRF1; unmodified histone, methylation, UHRF1, PHD, ligase-NUCL protein complex; 1.80A {Homo sapiens} Back     alignment and structure
>3v43_A Histone acetyltransferase KAT6A; MOZ, PHD finger, transferase-structural protein; 1.47A {Homo sapiens} PDB: 2ln0_A Back     alignment and structure
>2kwj_A Zinc finger protein DPF3; acetyl-lysine, transcription regulation, nucleus, metal BIND protein; HET: ALY; NMR {Homo sapiens} PDB: 2kwk_A 2kwn_A* 2kwo_A* Back     alignment and structure
>1wev_A Riken cDNA 1110020M19; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>3ask_A E3 ubiquitin-protein ligase UHRF1; histone reader modules, epigenetic regulation, trimethylaion of lysine residue, ligase-DNA binding protein; HET: M3L; 2.90A {Homo sapiens} Back     alignment and structure
>2yt5_A Metal-response element-binding transcription factor 2; zinc-regulated factor 1, ZIRF1, metal-response element DNA-binding protein M96; NMR {Mus musculus} Back     alignment and structure
>3o36_A Transcription intermediary factor 1-alpha; TRIM24, PHD finger, bromodomain, H4K16 acetylation, breast C transcription-protein binding complex; HET: ALY; 1.70A {Homo sapiens} PDB: 3o33_A* 3o34_A* 3o35_A* 3o37_A Back     alignment and structure
>3u5n_A E3 ubiquitin-protein ligase TRIM33; TRIM33, PHD, bromodomain, TGF-beta, epigenetics, methylation, K9ME3, K14AC, transcription; HET: M3L ALY; 1.95A {Homo sapiens} PDB: 3u5m_A* 3u5o_A* 3u5p_A* Back     alignment and structure
>2ro1_A Transcription intermediary factor 1-beta; KAP, TIF, PHD finger, bromodomain, SUMO, acetylation, alternative splicing, metal-binding, nucleus; NMR {Homo sapiens} Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2ku3_A Bromodomain-containing protein 1; PHD finger, chromatin regulator, metal-binding, finger, signaling protein; NMR {Homo sapiens} Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2l43_A N-teminal domain from histone H3.3, linker, PHD1 from bromodomain-containing protein...; PHD finger, histone CODE, transcription; NMR {Homo sapiens} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>4gne_A Histone-lysine N-methyltransferase NSD3; zinc finger, transcription, nuclear protein, transf nuclear protein complex; 1.47A {Homo sapiens} PDB: 4gnd_A 4gnf_A 4gng_A* Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>2lbm_A Transcriptional regulator ATRX; metal binding protein-structural protein compl; HET: M3L; NMR {Homo sapiens} PDB: 2ld1_A Back     alignment and structure
>2k16_A Transcription initiation factor TFIID subunit 3; protein, alternative splicing, metal-binding, nucleus, phosphoprotein, transcription regulation; NMR {Mus musculus} PDB: 2k17_A* Back     alignment and structure
>3ql9_A Transcriptional regulator ATRX; zinc finger, transcription, lysine trimethylation, protein, histone-binding protein, transcription-structural complex; HET: M3L; 0.93A {Homo sapiens} PDB: 3qla_A* 3qlc_A 3qln_A 2jm1_A Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>2vnf_A ING 4, P29ING4, inhibitor of growth protein 4; acetylation, alternative splicing, anti-oncogene, cell cycle, coiled C nucleus, zinc, zinc-finger, ING4; HET: M3L; 1.76A {Homo sapiens} SCOP: g.50.1.2 PDB: 2k1j_A 2jmq_A 2qic_A* Back     alignment and structure
>1wen_A Inhibitor of growth family, member 4; ING1-like protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: g.50.1.2 PDB: 1wes_A Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lv9_A Histone-lysine N-methyltransferase MLL5; zinc finger, transcription, protein binding, NESG, northeast structural genomics consortium, SGC; NMR {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3c6w_A P28ING5, inhibitor of growth protein 5; chromatin, PHD, ING, epigenetics, alternative splicing, metal-binding, phosphoprotein, zinc; HET: M3L; 1.75A {Homo sapiens} PDB: 2pnx_A* Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2g6q_A Inhibitor of growth protein 2; protein-peptide complex, gene regulation, apoptosis; HET: M3L; 2.00A {Mus musculus} Back     alignment and structure
>2jmi_A Protein YNG1, ING1 homolog 1; PHD, histone, recognition, yeast, protein binding; NMR {Saccharomyces cerevisiae} PDB: 2jmj_A* Back     alignment and structure
>1weu_A Inhibitor of growth family, member 4; structural genomics, PHD domain, ING1-like protein, DNA binding protein, NPPSFA; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>1x4i_A Inhibitor of growth protein 3; structural genomics, PHD domain, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2ri7_A Nucleosome-remodeling factor subunit BPTF; zinc finger, alpha-helical bundle, dimethyl-lysine, bromodom chromatin regulator, metal-binding, nucleus; HET: MLY; 1.45A {Homo sapiens} PDB: 2fsa_A* 2f6n_A 2f6j_A* 3qzv_A* 3uv2_A* 3qzt_A* 3qzs_A* 2fui_A 2fuu_A* Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>1wil_A KIAA1045 protein; ring finger domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: g.50.1.3 Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>1we9_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>3a1b_A DNA (cytosine-5)-methyltransferase 3A, histone H3; zinc-finger, histone binding, chromosomal protein, DNA damag repair, DNA-binding, methylation; HET: DNA; 2.29A {Homo sapiens} PDB: 3a1a_A* Back     alignment and structure
>2xb1_A Pygopus homolog 2, B-cell CLL/lymphoma 9-like Pro; fusion protein, signal transduction, transcription, metal BI WNT proteins; 1.90A {Homo sapiens} Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>3o70_A PHD finger protein 13; PHF13, structural genomics consortium, SGC, structural genom type zinc finger, protein binding, zinc ION binding; 1.85A {Homo sapiens} Back     alignment and structure
>1wee_A PHD finger family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>2vpb_A Hpygo1, pygopus homolog 1; gene regulation, WNT signaling pathway, WNT signaling complex, chromosomal rearrangement, signaling protein; 1.59A {Homo sapiens} PDB: 2vpd_A 2yyr_A* 2dx8_A* 2vp7_A 2vpg_A* 2vpe_A* Back     alignment and structure
>1wep_A PHF8; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2kgg_A Histone demethylase jarid1A; PHD finger, histone modification, leukemia, alternative splicing, chromatin regulator, developmental protein; NMR {Homo sapiens} PDB: 2kgi_A* 3gl6_A* Back     alignment and structure
>1wem_A Death associated transcription factor 1; structural genomics, PHD domain, death inducer- obliterator 1(DIO-1); NMR {Mus musculus} SCOP: g.50.1.2 Back     alignment and structure
>2pv0_B DNA (cytosine-5)-methyltransferase 3-like; DNMT3L, unmethylated H3K4, de novo DNA methylation, transferase regulator; HET: DNA; 3.30A {Homo sapiens} PDB: 2pvc_B* Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure
>3o7a_A PHD finger protein 13 variant; PHF13, zinc finger, PHD domain, nuclear protein, structural structural genomics consortium, SGC, protein binding; HET: M3L; 1.67A {Homo sapiens} Back     alignment and structure
>1wew_A DNA-binding family protein; structural genomics, PHD domain, riken structural genomics/proteomics initiative, RSGI, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: g.50.1.2 Back     alignment and structure
>3kqi_A GRC5, PHD finger protein 2; metal-binding, zinc-finger, histone-binding, NUC protein; HET: M3L; 1.78A {Homo sapiens} SCOP: g.50.1.2 Back     alignment and structure
>4bbq_A Lysine-specific demethylase 2A; oxidoreductase, ubiquitin, ligase, ubiquitination, demethyla ZF-CXXC DNA binding domain, CPG island, chromatin; 2.24A {Homo sapiens} Back     alignment and structure
>2rsd_A E3 SUMO-protein ligase SIZ1; E3 SUMO ligase, plant homeodomain (PHD), histone binding; NMR {Oryza sativa japonica group} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>2lq6_A Bromodomain-containing protein 1; PHD finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3pur_A Lysine-specific demethylase 7 homolog; oxidoreductase-oxidoreductase inhibitor complex; HET: 2HG; 2.10A {Caenorhabditis elegans} PDB: 3n9l_A 3n9m_A* 3n9o_A* 3n9p_A* 3n9q_A* 3n9n_A* 3puq_A* Back     alignment and structure
>2d8s_A Cellular modulator of immune recognition; C-MIR, march8, ring domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3lqh_A Histone-lysine N-methyltransferase MLL; PHD finger, bromodomain, leukemia, apoptosis, chromati regulator, DNA-binding, isopeptide bond; 1.72A {Homo sapiens} PDB: 3lqi_A* 3lqj_A* 2kyu_A Back     alignment and structure
>3kv4_A PHD finger protein 8; epigenetics, histone CODE, covalent histone modifications, jumonji demethylase, mental retardation, metal-binding, zinc; HET: M3L MLY OGA; 2.19A {Homo sapiens} Back     alignment and structure
>2kiz_A E3 ubiquitin-protein ligase arkadia; ring-H2 finger, E3 ligase, Zn binding domain, metal zinc, zinc-finger, metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>3kv5_D JMJC domain-containing histone demethylation protein 1D; epigenetics, histone CODE, jumonji lysine demethylase, metal-binding, zinc, zinc-finger; HET: OGA; 2.39A {Homo sapiens} PDB: 3kv6_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 191
d1mm2a_61 g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens 6e-05
d1fp0a170 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF- 0.002
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Length = 61 Back     information, alignment and structure

class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Mi2-beta (CHD4)
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 37.2 bits (86), Expect = 6e-05
 Identities = 18/57 (31%), Positives = 25/57 (43%), Gaps = 3/57 (5%)

Query: 10 EEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHVC 66
           +    +C VCKDGG+L  CD   CP  YH  C++      +   +W C    C   
Sbjct: 5  SDHHMEFCRVCKDGGELLCCD--TCPSSYHIHCLNPPLPE-IPNGEWLCPRCTCPAL 58
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Length = 70 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query191
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 99.37
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 99.21
d1fp0a170 Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo 98.75
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.74
d1f62a_51 Williams-Beuren syndrome transcription factor, WST 98.7
d1mm2a_61 Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606 98.69
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.3
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 98.26
d1weva_88 PHD finger protein 22 {Mouse (Mus musculus) [TaxId 98.1
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 98.08
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.98
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.67
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 97.51
d1we9a_64 PHD finger protein At5g26210 {Thale cress (Arabido 97.43
d1wesa_71 PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mu 97.34
d1weea_72 PHD finger protein At1g33420 {Thale cress (Arabido 97.33
d1wema_76 Death associated transcription factor 1, Datf1 (DI 97.26
d2pnxa151 Inhibitor of growth protein 4, Ing4 {Homo sapiens 96.87
d1wema_76 Death associated transcription factor 1, Datf1 (DI 96.84
d1wepa_79 PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 96.69
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 96.33
d1wewa_78 Sumoylation ligase E3, SIZ1 {Thale cress (Arabidop 93.08
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 91.84
d1vyxa_60 IE1B protein (ORF K3), N-terminal domain {Kaposi's 89.12
d1wila_89 Hypothetical protein KIAA1045 {Human (Homo sapiens 86.57
d1iyma_55 EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 45 85.15
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Small proteins
fold: FYVE/PHD zinc finger
superfamily: FYVE/PHD zinc finger
family: PHD domain
domain: Mi2-beta (CHD4)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=99.37  E-value=1.2e-13  Score=91.91  Aligned_cols=54  Identities=33%  Similarity=0.847  Sum_probs=46.7

Q ss_pred             cccccccccceecccCceEeeCCCCCCCcccccccCccccccCCCCCeeecCccccc
Q 041905            9 KEEISENWCYVCKDGGKLRLCDHLRCPKVYHSECVDKDESFLVAETKWTCNWHYCHV   65 (191)
Q Consensus         9 ~~~~~ed~C~vC~dgGeLi~Cd~~~CpkayH~~Cl~~~~~~~~~~g~W~Cp~h~C~~   65 (191)
                      .++.++++|.+|+++|+||.||  +|+++||..||++.... .+++.|+||.+.+..
T Consensus         4 ~~d~~~~~C~~C~~~g~lv~Cd--~C~~~~H~~C~~~~~~~-~~~~~W~C~~C~~~~   57 (61)
T d1mm2a_           4 GSDHHMEFCRVCKDGGELLCCD--TCPSSYHIHCLNPPLPE-IPNGEWLCPRCTCPA   57 (61)
T ss_dssp             CSCSSCSSCTTTCCCSSCBCCS--SSCCCBCSSSSSSCCSS-CCSSCCCCTTTTTTC
T ss_pred             CccCCcCCCcCCCCCCeEEEeC--CCCccCchhhcCCCcCc-CCCCcEECCCCcCcc
Confidence            3578899999999999999999  99999999999988765 577899998765543
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1fp0a1 g.50.1.2 (A:19-88) Nuclear corepressor KAP-1 (TIF-1beta) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f62a_ g.50.1.2 (A:) Williams-Beuren syndrome transcription factor, WSTF {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1mm2a_ g.50.1.2 (A:) Mi2-beta (CHD4) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weva_ g.50.1.2 (A:) PHD finger protein 22 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we9a_ g.50.1.2 (A:) PHD finger protein At5g26210 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wesa_ g.50.1.2 (A:) PHD Inhibitor of growth protein 2, Ing2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1weea_ g.50.1.2 (A:) PHD finger protein At1g33420 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pnxa1 g.50.1.2 (A:195-245) Inhibitor of growth protein 4, Ing4 {Homo sapiens [TaxId: 9606]} Back     information, alignment and structure
>d1wema_ g.50.1.2 (A:) Death associated transcription factor 1, Datf1 (DIO-1) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wepa_ g.50.1.2 (A:) PHD finger protein 8 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wewa_ g.50.1.2 (A:) Sumoylation ligase E3, SIZ1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vyxa_ g.44.1.3 (A:) IE1B protein (ORF K3), N-terminal domain {Kaposi's sarcoma-associated herpesvirus, KSHV, HHV8 [TaxId: 37296]} Back     information, alignment and structure
>d1wila_ g.50.1.3 (A:) Hypothetical protein KIAA1045 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1iyma_ g.44.1.1 (A:) EL5 RING-H2 domain {Rice (Oryza sativa) [TaxId: 4530]} Back     information, alignment and structure