Citrus Sinensis ID: 041914

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260----
MADSSMCNAKNKLEGKVAIITGGASGIGETTARLFADHGARMIVIADIQDELGRQVATSIGVGKCHYVHCDVTNECQVKALVDSTVQNYGQLDIMFSNAGILSSSDQTVLDLDFSAFDRLFAINVRGMAACVKHAARVMVEGGVRGSIVCTASVAGSCGGKRRTDYHMSKHAVIGLVRSASVQLGVHGIRVNCVSPHGLATPLTCHAYGMPADEVEKLFEPQTPLEGVVLRAGHVADAVLFLACRDSEFVTGHDLVVDGGFLIR
ccccccccccccccccEEEEcccccHHHHHHHHHHHHccccEEEEEEcccHHHHHHHHHHccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEEccccHHccccccccHHHHHHHHHHHHHHHHHHHHccccccEEcccccccccHHHHHHcccccHHHHHHHccccccccccccHHHHHHHHHHHHccccccccccEEEEccccccc
*************EGKVAIITGGASGIGETTARLFADHGARMIVIADIQDELGRQVATSIGVGKCHYVHCDVTNECQVKALVDSTVQNYGQLDIMFSNAGILSSSDQTVLDLDFSAFDRLFAINVRGMAACVKHAARVMVEGGVRGSIVCTASVAGSCGGKRRTDYHMSKHAVIGLVRSASVQLGVHGIRVNCVSPHGLATPLTCHAYGMPADEVEKLFEPQTPLEGVVLRAGHVADAVLFLACRDSEFVTGHDLVVDGGFLIR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MADSSMCNAKNKLEGKVAIITGGASGIGETTARLFADHGARMIVIADIQDELGRQVATSIGVGKCHYVHCDVTNECQVKALVDSTVQNYGQLDIMFSNAGILSSSDQTVLDLDFSAFDRLFAINVRGMAACVKHAARVMVEGGVRGSIVCTASVAGSCGGKRRTDYHMSKHAVIGLVRSASVQLGVHGIRVNCVSPHGLATPLTCHAYGMPADEVEKLFEPQTPLEGVVLRAGHVADAVLFLACRDSEFVTGHDLVVDGGFLIR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Short-chain dehydrogenase reductase 3b probableQ94K41
3-oxoacyl-[acyl-carrier-protein] reductase FabG Catalyzes the NADPH-dependent reduction of beta-ketoacyl-ACP substrates to beta-hydroxyacyl-ACP products, the first reductive step in the elongation cycle of fatty acid biosynthesis.probableQ9X248
Estradiol 17-beta-dehydrogenase 8 NAD-dependent 17-beta-hydroxysteroid dehydrogenase with highest activity towards estradiol. Has very low activity towards testosterone. The heteroteramer with CBR4 has NADH-dependent 3-ketoacyl-acyl carrier protein reductase activity. May play a role in biosynthesis of fatty acids in mitochondria.probableQ92506

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BGK, chain A
Confidence level:very confident
Coverage over the Query: 10-263
View the alignment between query and template
View the model in PyMOL