Citrus Sinensis ID: 041937

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MEYSGQRTSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYAQNDTSNEKR
cccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
*******************KNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPL*************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYSGQRTSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYAQNDTSNEKR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor RADIALIS Involved in the dorsovental asymmetry of flowers. Promotes dorsal identity.probableQ58FS3
Protein RADIALIS-like 1 Probable transcription factor.probableF4JVB8

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 2CJJ, chain A
Confidence level:very confident
Coverage over the Query: 13-75
View the alignment between query and template
View the model in PyMOL