Citrus Sinensis ID: 041937

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MEYSGQRTSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYAQNDTSNEKR
cccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
cccccccccccccccccHHHHHHHHHHHHHccccccHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHccccccccccccccccccc
meysgqrtstisgsswTAKKNKLFENALaiydkdtpDRWQIIAKIVGGTSEEEVKRRYEMLVDDIksiesdrvplpdyaqndtsnekr
meysgqrtstisgsswtakKNKLFENALaiydkdtpdrWQIIAkivggtseeevKRRYEMLVDDiksiesdrvplpdyaqndtsnekr
MEYSGQRTSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYAQNDTSNEKR
*******************KNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDD************************
********************NKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPL*************
**************SWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYA*********
**************SWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYA*********
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooohhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEYSGQRTSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYAQNDTSNEKR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
F4JVB8100 Protein RADIALIS-like 1 O yes no 0.715 0.63 0.666 7e-21
Q1A17397 Protein RADIALIS-like 6 O no no 0.761 0.690 0.626 9e-20
Q58FS393 Transcription factor RADI N/A no 0.875 0.827 0.575 9e-20
Q9SIJ5101 Protein RADIALIS-like 2 O no no 0.818 0.712 0.575 5e-19
Q6NNN081 Protein RADIALIS-like 3 O no no 0.795 0.864 0.571 6e-19
Q8GW75100 Protein RADIALIS-like 5 O no no 0.795 0.7 0.6 1e-18
Q1G3C477 Protein RADIALIS-like 4 O no no 0.681 0.779 0.616 8e-15
Q8S9H7 307 Transcription factor DIVA N/A no 0.727 0.208 0.5 7e-14
P54103621 DnaJ homolog subfamily C yes no 0.659 0.093 0.396 8e-07
Q6P2Y3620 DnaJ homolog subfamily C yes no 0.613 0.087 0.425 2e-06
>sp|F4JVB8|RADL1_ARATH Protein RADIALIS-like 1 OS=Arabidopsis thaliana GN=RL1 PE=2 SV=1 Back     alignment and function desciption
 Score = 99.4 bits (246), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 42/63 (66%), Positives = 51/63 (80%)

Query: 16 WTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPL 75
          WTAK+NK FE ALA YD+DTP+RWQ +AK+VGG + EEVKR YE+LV DI SIE+  VP 
Sbjct: 14 WTAKQNKAFEQALATYDQDTPNRWQNVAKVVGGKTTEEVKRHYELLVQDINSIENGHVPF 73

Query: 76 PDY 78
          P+Y
Sbjct: 74 PNY 76
Probable transcription factor.
Arabidopsis thaliana (taxid: 3702)
>sp|Q1A173|RADL6_ARATH Protein RADIALIS-like 6 OS=Arabidopsis thaliana GN=RL6 PE=2 SV=1 Back     alignment and function description
>sp|Q58FS3|RAD_ANTMA Transcription factor RADIALIS OS=Antirrhinum majus GN=RAD PE=1 SV=1 Back     alignment and function description
>sp|Q9SIJ5|RADL2_ARATH Protein RADIALIS-like 2 OS=Arabidopsis thaliana GN=RL2 PE=2 SV=1 Back     alignment and function description
>sp|Q6NNN0|RADL3_ARATH Protein RADIALIS-like 3 OS=Arabidopsis thaliana GN=RL3 PE=2 SV=1 Back     alignment and function description
>sp|Q8GW75|RADL5_ARATH Protein RADIALIS-like 5 OS=Arabidopsis thaliana GN=RL5 PE=3 SV=1 Back     alignment and function description
>sp|Q1G3C4|RADL4_ARATH Protein RADIALIS-like 4 OS=Arabidopsis thaliana GN=RL4 PE=2 SV=1 Back     alignment and function description
>sp|Q8S9H7|DIV_ANTMA Transcription factor DIVARICATA OS=Antirrhinum majus GN=DIVARICATA PE=2 SV=1 Back     alignment and function description
>sp|P54103|DNJC2_MOUSE DnaJ homolog subfamily C member 2 OS=Mus musculus GN=Dnajc2 PE=1 SV=2 Back     alignment and function description
>sp|Q6P2Y3|DNJC2_XENTR DnaJ homolog subfamily C member 2 OS=Xenopus tropicalis GN=dnajc2 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
25556039081 DNA binding protein, putative [Ricinus c 0.852 0.925 0.68 3e-23
22409478192 predicted protein [Populus trichocarpa] 0.829 0.793 0.698 8e-23
22543073479 PREDICTED: dnaJ homolog subfamily C memb 0.886 0.987 0.653 2e-22
29773514374 unnamed protein product [Vitis vinifera] 0.806 0.959 0.704 3e-22
22545827791 PREDICTED: dnaJ homolog subfamily C memb 0.852 0.824 0.64 7e-22
356495413104 PREDICTED: dnaJ homolog subfamily C memb 0.75 0.634 0.727 8e-22
22409478590 predicted protein [Populus trichocarpa] 0.909 0.888 0.612 9e-22
110931770100 MYB transcription factor MYB164 [Glycine 0.806 0.71 0.676 2e-21
22406212399 predicted protein [Populus trichocarpa] 0.806 0.717 0.690 2e-21
35655388398 PREDICTED: dnaJ homolog subfamily C memb 0.761 0.683 0.701 3e-21
>gi|255560390|ref|XP_002521210.1| DNA binding protein, putative [Ricinus communis] gi|223539575|gb|EEF41162.1| DNA binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  112 bits (280), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 51/75 (68%), Positives = 65/75 (86%)

Query: 12 SGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESD 71
          S S+WTA++NKLFE+ALAIYDKDTPDRW+ IAKIVGGT+EEEVK+++E+LV+DI  IESD
Sbjct: 5  SSSNWTAEQNKLFEDALAIYDKDTPDRWRTIAKIVGGTTEEEVKKQFEILVNDINHIESD 64

Query: 72 RVPLPDYAQNDTSNE 86
          ++PLP+Y     S E
Sbjct: 65 KIPLPNYKNERRSKE 79

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|224094781|ref|XP_002310232.1| predicted protein [Populus trichocarpa] gi|222853135|gb|EEE90682.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|225430734|ref|XP_002266235.1| PREDICTED: dnaJ homolog subfamily C member 1-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|297735143|emb|CBI17505.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225458277|ref|XP_002282461.1| PREDICTED: dnaJ homolog subfamily C member 2 [Vitis vinifera] gi|302142498|emb|CBI19701.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|356495413|ref|XP_003516572.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Glycine max] Back     alignment and taxonomy information
>gi|224094785|ref|XP_002310233.1| predicted protein [Populus trichocarpa] gi|222853136|gb|EEE90683.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|110931770|gb|ABH02884.1| MYB transcription factor MYB164 [Glycine max] Back     alignment and taxonomy information
>gi|224062123|ref|XP_002300766.1| predicted protein [Populus trichocarpa] gi|222842492|gb|EEE80039.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356553883|ref|XP_003545280.1| PREDICTED: dnaJ homolog subfamily C member 2-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
TAIR|locus:2016417100 RL5 "RAD-like 5" [Arabidopsis 0.920 0.81 0.592 2.1e-22
TAIR|locus:2049374101 MEE3 "MATERNAL EFFECT EMBRYO A 0.943 0.821 0.564 8e-21
TAIR|locus:2136283100 RL1 "RAD-like 1" [Arabidopsis 0.795 0.7 0.642 1e-20
UNIPROTKB|Q58FS393 RAD "Transcription factor RADI 0.875 0.827 0.575 7.2e-20
TAIR|locus:211526081 RL3 "RAD-like 3" [Arabidopsis 0.875 0.950 0.558 9.2e-20
TAIR|locus:202518297 RL6 "RAD-like 6" [Arabidopsis 0.795 0.721 0.614 1.9e-19
TAIR|locus:401071363177 RL4 "RAD-like 4" [Arabidopsis 0.806 0.922 0.619 5.1e-19
TAIR|locus:2042872 298 AT2G38090 [Arabidopsis thalian 0.784 0.231 0.478 5e-15
TAIR|locus:2154508 288 AT5G58900 [Arabidopsis thalian 0.75 0.229 0.5 5.4e-15
UNIPROTKB|Q8S9H7 307 DIVARICATA "Transcription fact 0.772 0.221 0.485 6.9e-14
TAIR|locus:2016417 RL5 "RAD-like 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 260 (96.6 bits), Expect = 2.1e-22, P = 2.1e-22
 Identities = 48/81 (59%), Positives = 61/81 (75%)

Query:     8 TSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKS 67
             +S  S SSWT+K+NK+FE ALA+YDKDTPDRWQ +AK VG  S EEVKR Y++LV+D+ +
Sbjct:     4 SSMSSSSSWTSKQNKMFERALAVYDKDTPDRWQNVAKAVGSKSAEEVKRHYDILVEDLMN 63

Query:    68 IESDRVPLPDYAQNDTSNEKR 88
             IE D VPLP Y   D  ++ R
Sbjct:    64 IEQDLVPLPKYKTVDVGSKSR 84
GO:0003677 "DNA binding" evidence=IEA;ISS
GO:0003700 "sequence-specific DNA binding transcription factor activity" evidence=ISS
GO:0006355 "regulation of transcription, DNA-dependent" evidence=ISS
TAIR|locus:2049374 MEE3 "MATERNAL EFFECT EMBRYO ARREST 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2136283 RL1 "RAD-like 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q58FS3 RAD "Transcription factor RADIALIS" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms
TAIR|locus:2115260 RL3 "RAD-like 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025182 RL6 "RAD-like 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:4010713631 RL4 "RAD-like 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2042872 AT2G38090 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2154508 AT5G58900 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q8S9H7 DIVARICATA "Transcription factor DIVARICATA" [Antirrhinum majus (taxid:4151)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q58FS3RAD_ANTMANo assigned EC number0.5750.8750.8279N/Ano
F4JVB8RADL1_ARATHNo assigned EC number0.66660.71590.63yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
gw1.VII.3529.1
hypothetical protein (92 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
cd0016745 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA- 1e-04
smart0071749 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIII 3e-04
pfam0024947 pfam00249, Myb_DNA-binding, Myb-like DNA-binding d 0.001
>gnl|CDD|238096 cd00167, SANT, 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information 
 Score = 35.6 bits (83), Expect = 1e-04
 Identities = 13/48 (27%), Positives = 27/48 (56%), Gaps = 3/48 (6%)

Query: 15 SWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLV 62
           WT ++++L   A+  Y K+    W+ IAK + G + ++ + R+  L+
Sbjct: 1  PWTEEEDELLLEAVKKYGKN---NWEKIAKELPGRTPKQCRERWRNLL 45

Tandem copies of the domain bind telomeric DNA tandem repeatsas part of the capping complex. Binding is sequence dependent for repeats which contain the G/C rich motif [C2-3 A (CA)1-6]. The domain is also found in regulatory transcriptional repressor complexes where it also binds DNA. Length = 45
>gnl|CDD|197842 smart00717, SANT, SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>gnl|CDD|215818 pfam00249, Myb_DNA-binding, Myb-like DNA-binding domain Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
PF0024948 Myb_DNA-binding: Myb-like DNA-binding domain; Inte 99.62
smart0071749 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-bindi 99.43
cd0016745 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding do 99.37
PF1392160 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 99.21
PLN03212249 Transcription repressor MYB5; Provisional 99.16
PLN03212 249 Transcription repressor MYB5; Provisional 99.09
PLN03091 459 hypothetical protein; Provisional 99.04
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.98
PLN03091 459 hypothetical protein; Provisional 98.91
KOG0048 238 consensus Transcription factor, Myb superfamily [T 98.84
KOG0457 438 consensus Histone acetyltransferase complex SAGA/A 98.83
TIGR0155757 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF c 98.62
COG5259 531 RSC8 RSC chromatin remodeling complex subunit RSC8 98.5
KOG0049 939 consensus Transcription factor, Myb superfamily [T 98.45
KOG1279 506 consensus Chromatin remodeling factor subunit and 98.31
KOG0724 335 consensus Zuotin and related molecular chaperones 98.21
COG5114 432 Histone acetyltransferase complex SAGA/ADA, subuni 98.16
KOG0049 939 consensus Transcription factor, Myb superfamily [T 97.83
PF1383790 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; 97.8
KOG4167 907 consensus Predicted DNA-binding protein, contains 97.75
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.61
PF1387378 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain 97.34
KOG0050 617 consensus mRNA splicing protein CDC5 (Myb superfam 97.3
COG5147 512 REB1 Myb superfamily proteins, including transcrip 97.18
PF09111118 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain 97.08
KOG0051 607 consensus RNA polymerase I termination factor, Myb 96.97
PF1277696 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; 96.82
KOG0051607 consensus RNA polymerase I termination factor, Myb 96.37
COG5118507 BDP1 Transcription initiation factor TFIIIB, Bdp1 96.28
TIGR02894161 DNA_bind_RsfA transcription factor, RsfA family. I 96.1
KOG1194 534 consensus Predicted DNA-binding protein, contains 95.98
COG5147 512 REB1 Myb superfamily proteins, including transcrip 95.71
PF0891465 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR0150 95.52
KOG4282 345 consensus Transcription factor GT-2 and related pr 95.46
PLN03142 1033 Probable chromatin-remodeling complex ATPase chain 95.43
KOG4468 782 consensus Polycomb-group transcriptional regulator 95.23
PF11035 344 SnAPC_2_like: Small nuclear RNA activating complex 94.9
smart0059589 MADF subfamily of SANT domain. 94.58
PRK13923170 putative spore coat protein regulator protein YlbO 94.26
KOG4329445 consensus DNA-binding protein [General function pr 93.97
KOG3554 693 consensus Histone deacetylase complex, MTA1 compon 93.73
PF1340442 HTH_AsnC-type: AsnC-type helix-turn-helix domain; 93.1
KOG2656 445 consensus DNA methyltransferase 1-associated prote 92.84
PF1054585 MADF_DNA_bdg: Alcohol dehydrogenase transcription 92.28
PF0450498 DUF573: Protein of unknown function, DUF573; Inter 91.16
PF13325199 MCRS_N: N-terminal region of micro-spherule protei 88.82
PRK11179153 DNA-binding transcriptional regulator AsnC; Provis 88.72
PRK11169164 leucine-responsive transcriptional regulator; Prov 87.42
smart0042668 TEA TEA domain. 86.69
PLN031421033 Probable chromatin-remodeling complex ATPase chain 86.66
PF05263130 DUF722: Protein of unknown function (DUF722); Inte 84.69
PF1162687 Rap1_C: TRF2-interacting telomeric protein/Rap1 - 83.35
KOG3841 455 consensus TEF-1 and related transcription factor, 82.69
KOG2009 584 consensus Transcription initiation factor TFIIIB, 82.58
PF06461145 DUF1086: Domain of Unknown Function (DUF1086); Int 82.42
PF0454550 Sigma70_r4: Sigma-70, region 4; InterPro: IPR00763 82.26
PF07750162 GcrA: GcrA cell cycle regulator; InterPro: IPR0116 82.15
>PF00249 Myb_DNA-binding: Myb-like DNA-binding domain; InterPro: IPR014778 The retroviral oncogene v-myb, and its cellular counterpart c-myb, encode nuclear DNA-binding proteins Back     alignment and domain information 
Probab=99.62  E-value=1.3e-15  Score=87.29  Aligned_cols=45  Identities=31%  Similarity=0.661  Sum_probs=41.0

Q ss_pred             CCCCHHHHHHHHHHHHhcCCCCChhHHHHHHHcC-CCCHHHHHHHHHHH
Q 041937           14 SSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVG-GTSEEEVKRRYEML   61 (88)
Q Consensus        14 ~~WT~eE~k~Le~al~~~~~~~~~rW~kIA~~vp-gRT~~qc~~ry~~L   61 (88)
                      ..||.+|+.+|.+|+.+|+.+   +|..||..|| |||..||+.||+.+
T Consensus         2 ~~Wt~eE~~~l~~~v~~~g~~---~W~~Ia~~~~~~Rt~~qc~~~~~~~   47 (48)
T PF00249_consen    2 GPWTEEEDEKLLEAVKKYGKD---NWKKIAKRMPGGRTAKQCRSRYQNL   47 (48)
T ss_dssp             -SS-HHHHHHHHHHHHHSTTT---HHHHHHHHHSSSSTHHHHHHHHHHH
T ss_pred             CCCCHHHHHHHHHHHHHhCCc---HHHHHHHHcCCCCCHHHHHHHHHhh
Confidence            589999999999999999876   8999999999 99999999999876

These belong to the SANT domain family that specifically recognise the sequence YAAC(G/T)G [, ]. In myb, one of the most conserved regions consisting of three tandem repeats has been shown to be involved in DNA-binding [].; PDB: 1X41_A 2XAF_B 2XAG_B 2XAH_B 2UXN_B 2Y48_B 2XAQ_B 2X0L_B 2IW5_B 2XAJ_B ....
>smart00717 SANT SANT SWI3, ADA2, N-CoR and TFIIIB'' DNA-binding domains Back     alignment and domain information
>cd00167 SANT 'SWI3, ADA2, N-CoR and TFIIIB' DNA-binding domains Back     alignment and domain information
>PF13921 Myb_DNA-bind_6: Myb-like DNA-binding domain; PDB: 1A5J_A 1MBH_A 1GV5_A 1H89_C 1IDY_A 1MBK_A 1IDZ_A 1H88_C 1GVD_A 1MBG_A Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03212 Transcription repressor MYB5; Provisional Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PLN03091 hypothetical protein; Provisional Back     alignment and domain information
>KOG0048 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG0457 consensus Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>TIGR01557 myb_SHAQKYF myb-like DNA-binding domain, SHAQKYF class Back     alignment and domain information
>COG5259 RSC8 RSC chromatin remodeling complex subunit RSC8 [Chromatin structure and dynamics / Transcription] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>KOG1279 consensus Chromatin remodeling factor subunit and related transcription factors [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0724 consensus Zuotin and related molecular chaperones (DnaJ superfamily), contains DNA-binding domains [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG5114 Histone acetyltransferase complex SAGA/ADA, subunit ADA2 [Chromatin structure and dynamics] Back     alignment and domain information
>KOG0049 consensus Transcription factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF13837 Myb_DNA-bind_4: Myb/SANT-like DNA-binding domain; PDB: 2EBI_A 2JMW_A Back     alignment and domain information
>KOG4167 consensus Predicted DNA-binding protein, contains SANT and ELM2 domains [Transcription] Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PF13873 Myb_DNA-bind_5: Myb/SANT-like DNA-binding domain Back     alignment and domain information
>KOG0050 consensus mRNA splicing protein CDC5 (Myb superfamily) [RNA processing and modification; Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF09111 SLIDE: SLIDE; InterPro: IPR015195 The SLIDE domain adopts a secondary structure comprising a main core of three alpha-helices Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>PF12776 Myb_DNA-bind_3: Myb/SANT-like DNA-binding domain; InterPro: IPR024752 This domain, found in a range of uncharacterised proteins, may be related to Myb/SANT-like DNA binding domains Back     alignment and domain information
>KOG0051 consensus RNA polymerase I termination factor, Myb superfamily [Transcription] Back     alignment and domain information
>COG5118 BDP1 Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>TIGR02894 DNA_bind_RsfA transcription factor, RsfA family Back     alignment and domain information
>KOG1194 consensus Predicted DNA-binding protein, contains Myb-like, SANT and ELM2 domains [Transcription] Back     alignment and domain information
>COG5147 REB1 Myb superfamily proteins, including transcription factors and mRNA splicing factors [Transcription / RNA processing and modification / Cell division and chromosome partitioning] Back     alignment and domain information
>PF08914 Myb_DNA-bind_2: Rap1 Myb domain; InterPro: IPR015010 Rap1 Myb adopts a canonical three-helix bundle tertiary structure, with the second and third helices forming a helix-turn-helix variant motif Back     alignment and domain information
>KOG4282 consensus Transcription factor GT-2 and related proteins, contains trihelix DNA-binding/SANT domain [Transcription] Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>KOG4468 consensus Polycomb-group transcriptional regulator [Transcription] Back     alignment and domain information
>PF11035 SnAPC_2_like: Small nuclear RNA activating complex subunit 2-like; InterPro: IPR021281 This family of proteins is SnAPC subunit 2-like Back     alignment and domain information
>smart00595 MADF subfamily of SANT domain Back     alignment and domain information
>PRK13923 putative spore coat protein regulator protein YlbO; Provisional Back     alignment and domain information
>KOG4329 consensus DNA-binding protein [General function prediction only] Back     alignment and domain information
>KOG3554 consensus Histone deacetylase complex, MTA1 component [Chromatin structure and dynamics] Back     alignment and domain information
>PF13404 HTH_AsnC-type: AsnC-type helix-turn-helix domain; PDB: 2ZNY_E 2ZNZ_G 1RI7_A 2CYY_A 2E1C_A 2VC1_B 2QZ8_A 2W29_C 2IVM_B 2VBX_B Back     alignment and domain information
>KOG2656 consensus DNA methyltransferase 1-associated protein-1 [Chromatin structure and dynamics; Transcription] Back     alignment and domain information
>PF10545 MADF_DNA_bdg: Alcohol dehydrogenase transcription factor Myb/SANT-like; InterPro: IPR006578 The MADF (myb/SANT-like domain in Adf-1) domain is an approximately 80-amino-acid module that directs sequence specific DNA binding to a site consisting of multiple tri-nucleotide repeats Back     alignment and domain information
>PF04504 DUF573: Protein of unknown function, DUF573; InterPro: IPR007592 This is a family of uncharacterised proteins Back     alignment and domain information
>PF13325 MCRS_N: N-terminal region of micro-spherule protein Back     alignment and domain information
>PRK11179 DNA-binding transcriptional regulator AsnC; Provisional Back     alignment and domain information
>PRK11169 leucine-responsive transcriptional regulator; Provisional Back     alignment and domain information
>smart00426 TEA TEA domain Back     alignment and domain information
>PLN03142 Probable chromatin-remodeling complex ATPase chain; Provisional Back     alignment and domain information
>PF05263 DUF722: Protein of unknown function (DUF722); InterPro: IPR007927 This entry is represented by Bacteriophage bIL285, Orf38 Back     alignment and domain information
>PF11626 Rap1_C: TRF2-interacting telomeric protein/Rap1 - C terminal domain; InterPro: IPR021661 This family of proteins represents the C-terminal domain of the protein Rap-1, which plays a distinct role in silencing at the silent mating-type loci and telomeres [] Back     alignment and domain information
>KOG3841 consensus TEF-1 and related transcription factor, TEAD family [Transcription] Back     alignment and domain information
>KOG2009 consensus Transcription initiation factor TFIIIB, Bdp1 subunit [Transcription] Back     alignment and domain information
>PF06461 DUF1086: Domain of Unknown Function (DUF1086); InterPro: IPR009462 This entry represents several eukaryotic domains of unknown function, which are present in chromodomain helicase DNA binding proteins Back     alignment and domain information
>PF04545 Sigma70_r4: Sigma-70, region 4; InterPro: IPR007630 The bacterial core RNA polymerase complex, which consists of five subunits, is sufficient for transcription elongation and termination but is unable to initiate transcription Back     alignment and domain information
>PF07750 GcrA: GcrA cell cycle regulator; InterPro: IPR011681 GcrA, together with CtrA (see IPR001789 from INTERPRO and IPR001867 from INTERPRO), form a master cell cycle regulator Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
2cjj_A93 Crystal Structure Of The Myb Domain Of The Rad Tran 7e-21
4eef_G74 Crystal Structure Of The Designed Inhibitor Protein 4e-08
2m2e_A73 Solution Nmr Structure Of The Sant Domain Of Human 4e-07
2cqr_A73 Solution Structure Of Rsgi Ruh-043, A Myb Dna-Bindi 4e-04
>pdb|2CJJ|A Chain A, Crystal Structure Of The Myb Domain Of The Rad Transcription Factor From Antirrhinum Majus Length = 93 Back     alignment and structure 
Iteration: 1

 Score = 95.5 bits (236), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 46/80 (57%), Positives = 59/80 (73%), Gaps = 3/80 (3%)
Query: 12 SGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESD 71
          SG  W+AK+NK FE ALA+YDKDTPDRW  +A+ V G + EEVK+ YE+LV+DIK IES 
Sbjct: 7  SGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESG 66
Query: 72 RVPLPDY---AQNDTSNEKR 88
          +VP P+Y     N  ++EKR
Sbjct: 67 KVPFPNYRTTGGNMKTDEKR 86
>pdb|4EEF|G Chain G, Crystal Structure Of The Designed Inhibitor Protein F-Hb80.4 In Complex With The 1918 Influenza Virus Hemagglutinin. Length = 74 Back     alignment and structure
>pdb|2M2E|A Chain A, Solution Nmr Structure Of The Sant Domain Of Human Dnajc2, Northeast Structural Genomics Consortium Target Hr8254a Length = 73 Back     alignment and structure
>pdb|2CQR|A Chain A, Solution Structure Of Rsgi Ruh-043, A Myb Dna-Binding Domain In Human Cdna Length = 73 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
2cjj_A93 Radialis; plant development, DNA-binding protein, 3e-31
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 2e-24
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 2e-19
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 1e-07
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 4e-05
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 4e-04
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 9e-04
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Length = 93 Back     alignment and structure
 Score =  104 bits (260), Expect = 3e-31
 Identities = 42/79 (53%), Positives = 57/79 (72%)

Query: 8  TSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKS 67
          ++  SG  W+AK+NK FE ALA+YDKDTPDRW  +A+ V G + EEVK+ YE+LV+DIK 
Sbjct: 3  STRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKY 62

Query: 68 IESDRVPLPDYAQNDTSNE 86
          IES +VP P+Y     + +
Sbjct: 63 IESGKVPFPNYRTTGGNMK 81
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Length = 74 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 73 Back     alignment and structure
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Length = 72 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Length = 79 Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Length = 89 Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Length = 58 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
2cjj_A93 Radialis; plant development, DNA-binding protein, 99.95
2cqq_A72 RSGI RUH-037, DNAJ homolog subfamily C member 1; m 99.94
1wgx_A73 KIAA1903 protein; MYB DNA-binding domain, human cD 99.84
2cqr_A73 RSGI RUH-043, DNAJ homolog subfamily C member 1; m 99.84
4eef_G74 F-HB80.4, designed hemagglutinin binding protein; 99.8
2yum_A75 ZZZ3 protein, zinc finger ZZ-type-containing prote 99.76
2din_A66 Cell division cycle 5-like protein; MYB_DNA-bindin 99.72
1x41_A60 Transcriptional adaptor 2-like, isoform B; transcr 99.71
2yus_A79 SWI/SNF-related matrix-associated actin- dependent 99.68
2elk_A58 SPCC24B10.08C protein; hypothetical protein, struc 99.67
2cu7_A72 KIAA1915 protein; nuclear protein, SANT domain, DN 99.67
2d9a_A60 B-MYB, MYB-related protein B; DNA binding, structu 99.65
1guu_A52 C-MYB, MYB proto-oncogene protein; transcription, 99.64
2dim_A70 Cell division cycle 5-like protein; MYB_DNA-bindin 99.61
1gvd_A52 MYB proto-oncogene protein; transcription, transcr 99.6
1w0t_A53 Telomeric repeat binding factor 1; telomere, DNA-b 99.56
3sjm_A64 Telomeric repeat-binding factor 2; human telomeric 99.53
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.53
1ity_A69 TRF1; helix-turn-helix, telomeres, DNA binding, MY 99.52
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.47
2llk_A73 Cyclin-D-binding MYB-like transcription factor 1; 99.47
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.47
2ltp_A89 Nuclear receptor corepressor 2; SMRT, TRAC, SGC, s 99.2
2eqr_A61 N-COR1, N-COR, nuclear receptor corepressor 1; SAN 99.46
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.42
2k9n_A107 MYB24; R2R3 domain, DNA-binding, nucleus, DNA bind 99.4
1gv2_A105 C-MYB, MYB proto-oncogene protein; transcription, 99.39
1h8a_C128 AMV V-MYB, MYB transforming protein; transcription 99.38
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.34
3osg_A126 MYB21; transcription-DNA complex, MYB2, R2R3 domai 99.31
2ckx_A83 NGTRF1, telomere binding protein TBP1; nuclear pro 99.31
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.3
1h89_C159 C-MYB, MYB proto-oncogene protein; transcription/D 99.3
3zqc_A131 MYB3; transcription-DNA complex, DNA-binding prote 99.29
2yqk_A63 Arginine-glutamic acid dipeptide repeats protein; 99.25
2crg_A70 Metastasis associated protein MTA3; transcription 99.15
2aje_A105 Telomere repeat-binding protein; DNA-binding, Trp, 99.12
2roh_A122 RTBP1, telomere binding protein-1; plant, nucleus, 99.1
2juh_A121 Telomere binding protein TBP1; helix, nucleus, nuc 99.09
2iw5_B235 Protein corest, REST corepressor 1; oxidoreductase 99.09
1x58_A62 Hypothetical protein 4930532D21RIK; MUS musculus a 99.08
1ign_A 246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 99.01
4a69_C94 Nuclear receptor corepressor 2; transcription, hyd 98.97
2xag_B482 REST corepressor 1; amine oxidase, chromatin regul 98.66
3hm5_A93 DNA methyltransferase 1-associated protein 1; DNA 98.6
1ug2_A95 2610100B20RIK gene product; hypothetical protein, 98.6
2lr8_A70 CAsp8-associated protein 2; structural genomics, n 97.81
1fex_A59 TRF2-interacting telomeric RAP1 protein; helix tur 98.39
1ofc_X 304 ISWI protein; nuclear protein, chromatin remodelin 98.34
4iej_A93 DNA methyltransferase 1-associated protein 1; DNA 97.94
2ebi_A86 DNA binding protein GT-1; DNA-binding domain, phos 97.87
2xag_B 482 REST corepressor 1; amine oxidase, chromatin regul 97.71
1irz_A64 ARR10-B; helix-turn-helix, DNA binding protein; NM 97.54
4b4c_A 211 Chromodomain-helicase-DNA-binding protein 1; chrom 97.34
1ign_A246 Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, 97.32
1ofc_X304 ISWI protein; nuclear protein, chromatin remodelin 97.0
2y9y_A374 Imitation switch protein 1 (DEL_ATPase); transcrip 96.43
2y9y_A 374 Imitation switch protein 1 (DEL_ATPase); transcrip 95.72
4b4c_A211 Chromodomain-helicase-DNA-binding protein 1; chrom 95.07
2xb0_X 270 Chromo domain-containing protein 1; hydrolase, DNA 94.16
2ecc_A76 Homeobox and leucine zipper protein homez; homeobo 91.32
2cxy_A125 BAF250B subunit, HBAF250B; DNA-binding domain, str 89.04
2xb0_X270 Chromo domain-containing protein 1; hydrolase, DNA 88.74
2dn0_A76 Zinc fingers and homeoboxes protein 3; triple home 85.66
2ys8_A90 RAB-related GTP-binding protein RABJ; DNAJ domain, 84.82
2hzd_A82 Transcriptional enhancer factor TEF-1; DNA-binding 81.42
>2cjj_A Radialis; plant development, DNA-binding protein, MYB transcription FA DNA-binding, nuclear protein, floral asymmetry; 1.9A {Antirrhinum majus} SCOP: a.4.1.3 Back     alignment and structure
Probab=99.95  E-value=8.2e-28  Score=156.00  Aligned_cols=75  Identities=56%  Similarity=0.982  Sum_probs=61.8

Q ss_pred             CCCCCCCCCCHHHHHHHHHHHHhcCCCCChhHHHHHHHcCCCCHHHHHHHHHHHHHHHhhhcCCCCCCCCCCCCC
Q 041937            8 TSTISGSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPLPDYAQND   82 (88)
Q Consensus         8 ~~~~s~~~WT~eE~k~Le~al~~~~~~~~~rW~kIA~~vpgRT~~qc~~ry~~L~~dv~~ie~g~v~~P~y~~~~   82 (88)
                      +|..+...||.+||++|++||++|+.++++||.+||++|||||++||++||+.|+++|+.||+|.||+|.|...+
T Consensus         3 ~~~~~~~~WT~eEd~~L~~al~~~~~~~~~rW~~IA~~vpGRT~~q~k~ry~~l~~dv~~iesg~vp~P~y~~~~   77 (93)
T 2cjj_A            3 STRGSGRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPFPNYRTTG   77 (93)
T ss_dssp             -----CCSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC-------
T ss_pred             CCCCCCCCCCHHHHHHHHHHHHHcCCCCCchHHHHHHHcCCCCHHHHHHHHHHHHHHHHHhhcCCCCCCCCCCCC
Confidence            345567899999999999999999998889999999999999999999999999999999999999999998875
>2cqq_A RSGI RUH-037, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>1wgx_A KIAA1903 protein; MYB DNA-binding domain, human cDNA, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2cqr_A RSGI RUH-043, DNAJ homolog subfamily C member 1; membrane protein, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>4eef_G F-HB80.4, designed hemagglutinin binding protein; immunoglobulin, fusion of virus membrane with membrane, membrane fusion, sialic acid, virion; HET: NAG BMA; 2.70A {Artificial gene} Back     alignment and structure
>2yum_A ZZZ3 protein, zinc finger ZZ-type-containing protein 3; transcription, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2din_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1x41_A Transcriptional adaptor 2-like, isoform B; transcriptional adaptor protein2, transcriptional activation, MYB domain, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2yus_A SWI/SNF-related matrix-associated actin- dependent regulator of chromatin subfamily...; SWI/SNF complex 155 kDa subunit, BRG1-associated factor 155; NMR {Homo sapiens} Back     alignment and structure
>2elk_A SPCC24B10.08C protein; hypothetical protein, structural genomics, NPPSFA; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2cu7_A KIAA1915 protein; nuclear protein, SANT domain, DNA binding, regulation of transcription, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.3 Back     alignment and structure
>2d9a_A B-MYB, MYB-related protein B; DNA binding, structural genomics, unknown function, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1guu_A C-MYB, MYB proto-oncogene protein; transcription, transcription regulation, DNA binding, ION bindi proto-oncogene, nuclear protein, activator; 1.6A {Mus musculus} SCOP: a.4.1.3 PDB: 1mbe_A 1mbf_A Back     alignment and structure
>2dim_A Cell division cycle 5-like protein; MYB_DNA-binding domain, cell cycle, DNA binding, spliceosome, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1gvd_A MYB proto-oncogene protein; transcription, transcription regulation, C-MYB, DNA binding, ION binding, nuclear protein; 1.45A {Mus musculus} SCOP: a.4.1.3 PDB: 1gv5_A 1mbg_A 1mbh_A Back     alignment and structure
>1w0t_A Telomeric repeat binding factor 1; telomere, DNA-binding protein, homeodomain, mitosis, cell cycle; 2.00A {Homo sapiens} SCOP: a.4.1.4 PDB: 1ba5_A Back     alignment and structure
>3sjm_A Telomeric repeat-binding factor 2; human telomeric repeat binding protein 2, telomere, telomeri homeodomain proteins amino acid sequence; HET: DNA; 1.35A {Homo sapiens} PDB: 1xg1_A 1vfc_A 1vf9_A 1w0u_A Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1ity_A TRF1; helix-turn-helix, telomeres, DNA binding, MYB domain, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: a.4.1.4 PDB: 1iv6_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>2llk_A Cyclin-D-binding MYB-like transcription factor 1; helix bundle, SGC, structural genomics consortium, NESG, NOR structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ltp_A Nuclear receptor corepressor 2; SMRT, TRAC, SGC, structural genomics consortium, NESG, north structural genomics consortium; NMR {Homo sapiens} Back     alignment and structure
>2eqr_A N-COR1, N-COR, nuclear receptor corepressor 1; SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>2k9n_A MYB24; R2R3 domain, DNA-binding, nucleus, DNA binding protein; NMR {Trichomonas vaginalis} PDB: 2kdz_A Back     alignment and structure
>1gv2_A C-MYB, MYB proto-oncogene protein; transcription, DNA binding, ION binding; 1.68A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 PDB: 1mse_C* 1msf_C* 1a5j_A 1idy_A 1idz_A 1mbj_A 1mbk_A Back     alignment and structure
>1h8a_C AMV V-MYB, MYB transforming protein; transcription/DNA; 2.23A {Avian myeloblastosis virus} SCOP: a.4.1.3 a.4.1.3 Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>3osg_A MYB21; transcription-DNA complex, MYB2, R2R3 domain, DNA binding PR transcription factor; 2.00A {Trichomonas vaginalis} PDB: 3osf_A Back     alignment and structure
>2ckx_A NGTRF1, telomere binding protein TBP1; nuclear protein; 1.9A {Nicotiana tabacum} SCOP: a.4.1.3 PDB: 2qhb_A Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>1h89_C C-MYB, MYB proto-oncogene protein; transcription/DNA; 2.45A {Mus musculus} SCOP: a.4.1.3 a.4.1.3 a.4.1.3 PDB: 1h88_C Back     alignment and structure
>3zqc_A MYB3; transcription-DNA complex, DNA-binding protein, nucleus; 2.90A {Trichomonas vaginalis} Back     alignment and structure
>2yqk_A Arginine-glutamic acid dipeptide repeats protein; structure genomics, SANT domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2crg_A Metastasis associated protein MTA3; transcription factor, helix turn helix, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2aje_A Telomere repeat-binding protein; DNA-binding, Trp, MYB motif, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.3 Back     alignment and structure
>2roh_A RTBP1, telomere binding protein-1; plant, nucleus, DNA binding protein; NMR {Oryza sativa} Back     alignment and structure
>2juh_A Telomere binding protein TBP1; helix, nucleus, nuclear protein; NMR {Nicotiana glutinosa} Back     alignment and structure
>2iw5_B Protein corest, REST corepressor 1; oxidoreductase-transcription regulator complex, oxidoreductase/repressor complex, histone demethylase, FAD; HET: FAD; 2.57A {Homo sapiens} SCOP: a.4.1.3 PDB: 2uxn_B* 2uxx_B* 2y48_B* 2v1d_B* 2x0l_B* Back     alignment and structure
>1x58_A Hypothetical protein 4930532D21RIK; MUS musculus adult MALE testis cDNA, riken FULL-length enriched library, structural genomics, NPPSFA; NMR {Mus musculus} SCOP: a.4.1.1 Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>4a69_C Nuclear receptor corepressor 2; transcription, hydrolase; HET: I0P; 2.06A {Homo sapiens} PDB: 1xc5_A Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>3hm5_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin, structural genomics consortium, SGC, activator, chromatin regulator; HET: DNA; 1.80A {Homo sapiens} Back     alignment and structure
>1ug2_A 2610100B20RIK gene product; hypothetical protein, MYB-like DNA binding domain, structural genomics, riken structural genomics/proteomics initiative; NMR {Mus musculus} SCOP: a.4.1.3 Back     alignment and structure
>2lr8_A CAsp8-associated protein 2; structural genomics, northeast structural genomics consortiu PSI-biology, apoptosis; NMR {Homo sapiens} Back     alignment and structure
>1fex_A TRF2-interacting telomeric RAP1 protein; helix turn helix, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Synthetic} SCOP: a.4.1.3 Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>4iej_A DNA methyltransferase 1-associated protein 1; DNA methylation, chromatin regulator, repressor, structural joint center for structural genomics; HET: DNA; 1.45A {Homo sapiens} PDB: 3hm5_A* Back     alignment and structure
>2ebi_A DNA binding protein GT-1; DNA-binding domain, phosphorylation; HET: DNA; NMR {Arabidopsis thaliana} PDB: 2jmw_A* Back     alignment and structure
>2xag_B REST corepressor 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_B* 2xah_B* 2xaj_B* 2xaq_B* 2xas_B* Back     alignment and structure
>1irz_A ARR10-B; helix-turn-helix, DNA binding protein; NMR {Arabidopsis thaliana} SCOP: a.4.1.11 Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>1ign_A Protein (RAP1); RAP1,yeast,telomeres,homoeodomain, DNA binding protein/DNA complex; HET: DNA; 2.25A {Saccharomyces cerevisiae} SCOP: a.4.1.6 a.4.1.6 PDB: 3ukg_A Back     alignment and structure
>1ofc_X ISWI protein; nuclear protein, chromatin remodeling factor, ATPase, SANT domain, nucleosome recognition; HET: GLC G4D; 1.9A {Drosophila melanogaster} SCOP: a.4.1.3 a.4.1.13 a.187.1.1 PDB: 2nog_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>2y9y_A Imitation switch protein 1 (DEL_ATPase); transcription, nuclear protein complex, chromatin remodeling nucleosome remodeling; 3.25A {Saccharomyces cerevisiae} PDB: 2y9z_A Back     alignment and structure
>4b4c_A Chromodomain-helicase-DNA-binding protein 1; chromatin-remodeling, histone acetylation COMP chromatin regulation, transcription; 1.62A {Homo sapiens} Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2ecc_A Homeobox and leucine zipper protein homez; homeobox domain, transcription factor, leucine zipper- containing factor, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: a.4.1.1 Back     alignment and structure
>2cxy_A BAF250B subunit, HBAF250B; DNA-binding domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; 1.60A {Homo sapiens} PDB: 2eh9_A 1ryu_A Back     alignment and structure
>2xb0_X Chromo domain-containing protein 1; hydrolase, DNA-binding protein, transcription, chromatin REG; HET: GOL; 2.00A {Saccharomyces cerevisiae} PDB: 3ted_A Back     alignment and structure
>2dn0_A Zinc fingers and homeoboxes protein 3; triple homeobox 1 protein, KIAA0395, TIX1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2ys8_A RAB-related GTP-binding protein RABJ; DNAJ domain, RAS-associated protein RAP1, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2hzd_A Transcriptional enhancer factor TEF-1; DNA-binding, helix-turn-helix, gene regulation; NMR {Homo sapiens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d2cjja163 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Anti 9e-19
d2cqqa159 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 4e-16
d2cqra160 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 1e-07
d1xc5a168 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 4e-04
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Length = 63 Back     information, alignment and structure

class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

 Score = 70.7 bits (173), Expect = 9e-19
 Identities = 39/62 (62%), Positives = 49/62 (79%)

Query: 13 GSSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDR 72
          G  W+AK+NK FE ALA+YDKDTPDRW  +A+ V G + EEVK+ YE+LV+DIK IES +
Sbjct: 1  GRPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGK 60

Query: 73 VP 74
          VP
Sbjct: 61 VP 62
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 59 Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 60 Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Length = 68 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d2cjja163 Radialis {Garden snapdragon (Antirrhinum majus) [T 99.92
d2cqqa159 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.82
d2cqra160 DnaJ homolog subfamily C member 1 {Human (Homo sap 99.79
d1x41a147 Transcriptional adaptor 2-like, TADA2L, isoform b 99.66
d1guua_50 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.61
d1gvda_52 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.6
d1gv2a247 c-Myb, DNA-binding domain {Mouse (Mus musculus) [T 99.58
d2cu7a165 MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 960 99.55
d1w0ta_52 DNA-binding domain of human telomeric protein, hTR 99.47
d2iw5b165 REST corepressor 1, CoREST {Human (Homo sapiens) [ 99.47
d1w0ua_55 Telomeric repeat binding factor 2, TRF2 {Human (Ho 99.44
d1igna186 DNA-binding domain of rap1 {Baker's yeast (Sacchar 99.41
d1xc5a168 Nuclear receptor corepressor 2 {Human (Homo sapien 99.38
d2ckxa183 Telomere binding protein TBP1 {Tobacco (Nicotiana 99.29
d1ug2a_95 2610100b20rik gene product {Mouse (Mus musculus) [ 99.24
d2crga157 Metastasis associated protein MTA3 {Mouse (Mus mus 99.1
d1wgxa_73 Hypothetical protein C14orf106 (KIAA1903) {Human ( 99.02
d1irza_64 Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId 98.23
d1ofcx152 SANT domain of the nucleosome remodeling ATPase IS 98.01
d1fexa_59 Rap1 {Human (Homo sapiens) [TaxId: 9606]} 96.6
d1ofcx2128 SLIDE domain of the nucleosome remodeling ATPase I 95.55
d1x58a149 Hypothetical protein 4930532d21rik {Mouse (Mus mus 94.97
d2ecca176 Homeobox-leucine zipper protein Homez {Human (Homo 94.61
d2cg4a163 Regulatory protein AsnC {Escherichia coli [TaxId: 90.65
d1fs1b155 Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sa 90.34
d2cfxa163 Transcriptional regulator LrpC {Bacillus subtilis 89.16
d2cyya160 Putative transcriptional regulator PH1519 {Archaeo 88.84
d1i1ga160 LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} 87.55
d1nexa170 Centromere DNA-binding protein complex Cbf3 subuni 85.29
d1lvaa364 C-terminal fragment of elongation factor SelB {Moo 84.48
d1au7a158 Pit-1 POU homeodomain {Rat (Rattus norvegicus) [Ta 84.18
d1kkxa_102 Transcription regulator Adr6 (Swi1) {Baker's yeast 84.14
d1ig7a_58 Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10 82.67
>d2cjja1 a.4.1.3 (A:8-70) Radialis {Garden snapdragon (Antirrhinum majus) [TaxId: 4151]} Back     information, alignment and structure
class: All alpha proteins
fold: DNA/RNA-binding 3-helical bundle
superfamily: Homeodomain-like
family: Myb/SANT domain
domain: Radialis
species: Garden snapdragon (Antirrhinum majus) [TaxId: 4151]

Probab=99.92  E-value=8.8e-26  Score=134.95  Aligned_cols=62  Identities=61%  Similarity=1.055  Sum_probs=60.4

Q ss_pred             CCCCHHHHHHHHHHHHhcCCCCChhHHHHHHHcCCCCHHHHHHHHHHHHHHHhhhcCCCCCC
Q 041937           14 SSWTAKKNKLFENALAIYDKDTPDRWQIIAKIVGGTSEEEVKRRYEMLVDDIKSIESDRVPL   75 (88)
Q Consensus        14 ~~WT~eE~k~Le~al~~~~~~~~~rW~kIA~~vpgRT~~qc~~ry~~L~~dv~~ie~g~v~~   75 (88)
                      ++||.+||++|+.||.+|+.+.+++|.+||++|||||++||++||+.|+++|+.||+|+|||
T Consensus         2 ~~WT~eEd~~L~~~v~~~~~~~~~~W~~Ia~~l~gRt~~qc~~r~~~L~~dik~iesg~vpf   63 (63)
T d2cjja1           2 RPWSAKENKAFERALAVYDKDTPDRWANVARAVEGRTPEEVKKHYEILVEDIKYIESGKVPF   63 (63)
T ss_dssp             CSCCHHHHHHHHHHHHHSCTTCTTHHHHHHHHSTTCCHHHHHHHHHHHHHHHHHHHHSSCCC
T ss_pred             cCCCHHHHHHHHHHHHHHCCCCchHHHHHHHHcCCCCHHHHHHHHHHHHHHhhccccCCCCC
Confidence            68999999999999999999888999999999999999999999999999999999999997
>d2cqqa1 a.4.1.3 (A:8-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cqra1 a.4.1.3 (A:7-66) DnaJ homolog subfamily C member 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1x41a1 a.4.1.1 (A:8-54) Transcriptional adaptor 2-like, TADA2L, isoform b {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1guua_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gvda_ a.4.1.3 (A:) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gv2a2 a.4.1.3 (A:144-190) c-Myb, DNA-binding domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2cu7a1 a.4.1.3 (A:8-72) MYSM1 (KIAA1915) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ta_ a.4.1.4 (A:) DNA-binding domain of human telomeric protein, hTRF1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2iw5b1 a.4.1.3 (B:376-440) REST corepressor 1, CoREST {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w0ua_ a.4.1.4 (A:) Telomeric repeat binding factor 2, TRF2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1igna1 a.4.1.6 (A:360-445) DNA-binding domain of rap1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1xc5a1 a.4.1.3 (A:413-480) Nuclear receptor corepressor 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ckxa1 a.4.1.3 (A:578-660) Telomere binding protein TBP1 {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
>d1ug2a_ a.4.1.3 (A:) 2610100b20rik gene product {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2crga1 a.4.1.3 (A:8-64) Metastasis associated protein MTA3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgxa_ a.4.1.3 (A:) Hypothetical protein C14orf106 (KIAA1903) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1irza_ a.4.1.11 (A:) Arr10-B {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ofcx1 a.4.1.3 (X:799-850) SANT domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1fexa_ a.4.1.3 (A:) Rap1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ofcx2 a.4.1.13 (X:851-978) SLIDE domain of the nucleosome remodeling ATPase ISWI {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1x58a1 a.4.1.1 (A:8-56) Hypothetical protein 4930532d21rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ecca1 a.4.1.1 (A:1-76) Homeobox-leucine zipper protein Homez {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cg4a1 a.4.5.32 (A:4-66) Regulatory protein AsnC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fs1b1 a.157.1.1 (B:86-140) Cyclin A/CDK2-associated p45, Skp1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2cfxa1 a.4.5.32 (A:1-63) Transcriptional regulator LrpC {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2cyya1 a.4.5.32 (A:5-64) Putative transcriptional regulator PH1519 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1i1ga1 a.4.5.32 (A:2-61) LprA {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1nexa1 a.157.1.1 (A:116-185) Centromere DNA-binding protein complex Cbf3 subunit D, CBF3D {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1lvaa3 a.4.5.35 (A:511-574) C-terminal fragment of elongation factor SelB {Moorella thermoacetica [TaxId: 1525]} Back     information, alignment and structure
>d1au7a1 a.4.1.1 (A:103-160) Pit-1 POU homeodomain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1kkxa_ a.4.3.1 (A:) Transcription regulator Adr6 (Swi1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ig7a_ a.4.1.1 (A:) Msx-1 homeodomain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure