Citrus Sinensis ID: 041959

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170--
MRTAIPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLASFNPATSFSSPQNSGSPTPIAAVSSRAYKKLSKTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLST
cccccccEEccccccccccccEEEEEccccHHHHHHHHHHHHcccccccccccccccHHHHHHHHHHHHHcccccccccccccccccccHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccEEEEccccccccccccccccccHHHHHHHHHHHcccHHHHHHHHHcccc
cccccccEEcccccccccEEEcEEEccccccccHHHHHHHHHHcccEEEccHHHccHHHHHHHHHHHHHccccccHHHHHHHHHHHHHccccccEccccccccccccHHHHHHHHHHHHHccEEEEEEcccccccccccccHHcccHHHHHHHHHccccHHHHHHHHHHHcc
mrtaipeeplgstgksiplvgfgtveyplneAFKERVLHAIKLGYRhfdtaaaypseqpLGEALAEALRLasfnpatsfsspqnsgsptpiaAVSSRAYKKlsktnpiwqQKKLREYRKEkgihfsacsplgavgtnwghnrVMENEVLKQIAEANGKTVAQLIHNSFFLST
mrtaipeeplgstgksiplvgFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLASFNPAtsfsspqnsgspTPIAAVSSRAykklsktnpiwqqkKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLST
MRTAIPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPlgealaealrlaSFNPATSFSSPQNSGSPTPIAAVSSRAYKKLSKTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLST
****************IPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYP****************************************************IWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFF***
****IPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLASFNPATSFSSPQNSGSPTPIAAVSSRAYKKLSKTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLS*
MRTAIPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLASFNPA***************AAVSSRAYKKLSKTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLST
****IPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLASFNPATSFSSPQNSGSPTPIAAVSSRAYKKLSKTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLST
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTAIPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLASFNPATSFSSPQNSGSPTPIAAVSSRAYKKLSKTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLST
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query172 2.2.26 [Sep-21-2011]
Q9SQ64321 Non-functional NADPH-depe N/A no 0.337 0.180 0.566 2e-13
Q7G764321 Probable NAD(P)H-dependen no no 0.372 0.199 0.454 2e-11
P26690315 NAD(P)H-dependent 6'-deox no no 0.604 0.330 0.420 2e-11
Q7G765322 Probable NAD(P)H-dependen no no 0.343 0.183 0.475 6e-11
Q9SQ69 321 NADPH-dependent codeinone N/A no 0.343 0.183 0.557 1e-10
Q9SQ68 321 NADPH-dependent codeinone N/A no 0.343 0.183 0.540 2e-10
Q9SQ67 321 NADPH-dependent codeinone N/A no 0.343 0.183 0.540 3e-10
B9VRJ2 321 NADPH-dependent codeinone N/A no 0.343 0.183 0.540 3e-10
Q9SQ70 321 NADPH-dependent codeinone N/A no 0.343 0.183 0.524 4e-10
P28475 310 NADP-dependent D-sorbitol N/A no 0.331 0.183 0.517 2e-09
>sp|Q9SQ64|COR2_PAPSO Non-functional NADPH-dependent codeinone reductase 2 OS=Papaver somniferum GN=COR2 PE=1 SV=1 Back     alignment and function desciption
 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 34/60 (56%), Positives = 45/60 (75%)

Query: 104 KTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQL 163
           + NPIWQQ+KLR+Y K   I  +A SPLGA GT WG + VM++EVL QI++  GK+VAQ+
Sbjct: 189 EMNPIWQQQKLRDYCKTNNIMVTAYSPLGAKGTMWGSSGVMDSEVLNQISQVRGKSVAQV 248

Papaver somniferum (taxid: 3469)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|Q7G764|NADO1_ORYSJ Probable NAD(P)H-dependent oxidoreductase 1 OS=Oryza sativa subsp. japonica GN=Os10g0113000 PE=1 SV=1 Back     alignment and function description
>sp|P26690|6DCS_SOYBN NAD(P)H-dependent 6'-deoxychalcone synthase OS=Glycine max PE=1 SV=1 Back     alignment and function description
>sp|Q7G765|NADO2_ORYSJ Probable NAD(P)H-dependent oxidoreductase 2 OS=Oryza sativa subsp. japonica GN=Os10g0113100 PE=2 SV=1 Back     alignment and function description
>sp|Q9SQ69|COR12_PAPSO NADPH-dependent codeinone reductase 1-2 OS=Papaver somniferum GN=COR1.2 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ68|COR13_PAPSO NADPH-dependent codeinone reductase 1-3 OS=Papaver somniferum GN=COR1.3 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ67|COR14_PAPSO NADPH-dependent codeinone reductase 1-4 OS=Papaver somniferum GN=COR1.4 PE=1 SV=2 Back     alignment and function description
>sp|B9VRJ2|COR15_PAPSO NADPH-dependent codeinone reductase 1-5 OS=Papaver somniferum GN=COR1.5 PE=1 SV=1 Back     alignment and function description
>sp|Q9SQ70|COR11_PAPSO NADPH-dependent codeinone reductase 1-1 OS=Papaver somniferum GN=COR1.1 PE=1 SV=1 Back     alignment and function description
>sp|P28475|S6PD_MALDO NADP-dependent D-sorbitol-6-phosphate dehydrogenase OS=Malus domestica GN=S6PDH PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
147779297212 hypothetical protein VITISV_043025 [Viti 0.848 0.688 0.362 1e-17
297737568 642 unnamed protein product [Vitis vinifera] 0.343 0.091 0.666 5e-16
147862769 314 hypothetical protein VITISV_013445 [Viti 0.337 0.184 0.666 5e-16
225424502 321 PREDICTED: probable NAD(P)H-dependent ox 0.343 0.183 0.666 6e-16
255561785 325 aldo-keto reductase, putative [Ricinus c 0.395 0.209 0.563 6e-16
147862768 321 hypothetical protein VITISV_013444 [Viti 0.343 0.183 0.666 6e-16
225424504 314 PREDICTED: probable NAD(P)H-dependent ox 0.337 0.184 0.666 6e-16
297737567 302 unnamed protein product [Vitis vinifera] 0.337 0.192 0.666 7e-16
225424506 320 PREDICTED: probable NAD(P)H-dependent ox 0.331 0.178 0.65 3e-15
297737566 430 unnamed protein product [Vitis vinifera] 0.331 0.132 0.65 3e-15
>gi|147779297|emb|CAN76799.1| hypothetical protein VITISV_043025 [Vitis vinifera] Back     alignment and taxonomy information
 Score = 94.7 bits (234), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/196 (36%), Positives = 92/196 (46%), Gaps = 50/196 (25%)

Query: 10  LGSTGKSIPLVGFGTVEYPL--NEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEA 67
           LGSTGK+IPLVG  T  YP   +E   + +L AI+LGYRHFD  AAY SE+PLGEA+ +A
Sbjct: 3   LGSTGKAIPLVGMVTTVYPFAPSETMIDSILTAIELGYRHFDCVAAYLSEKPLGEAIKKA 62

Query: 68  LRL-------------------------------ASFNPATSFSSPQNSGSPTPIAAVS- 95
           ++L                                S  P  ++  P N     PI   S 
Sbjct: 63  VKLGLIKSRDELFITLQALNLQLDYLDLYLIHWSVSLKPG-NYELPVNKDDHLPIDLGSV 121

Query: 96  ---SRAYKKLSKTNPI----WQQKKLREYRKEKGIHFSACSPLGAVGT-NWGHNRVMENE 147
                 ++KLS T  I    +   KL E            S L AV   +WG +RVME E
Sbjct: 122 WKAMEDFQKLSLTKAIGVSNFSCNKLEEL-------LQTASILPAVNQEHWGTDRVMECE 174

Query: 148 VLKQIAEANGKTVAQL 163
           VLK+IA   G ++AQ+
Sbjct: 175 VLKKIARETGNSIAQM 190

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297737568|emb|CBI26769.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|147862769|emb|CAN83197.1| hypothetical protein VITISV_013445 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424502|ref|XP_002285211.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255561785|ref|XP_002521902.1| aldo-keto reductase, putative [Ricinus communis] gi|223538940|gb|EEF40538.1| aldo-keto reductase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|147862768|emb|CAN83196.1| hypothetical protein VITISV_013444 [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424504|ref|XP_002285219.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737567|emb|CBI26768.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225424506|ref|XP_002285221.1| PREDICTED: probable NAD(P)H-dependent oxidoreductase 1 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297737566|emb|CBI26767.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query172
UNIPROTKB|E7C196327 E7C196 "2-carbomethoxy-3-tropi 0.337 0.177 0.551 1.1e-24
TAIR|locus:2025926320 AT1G59950 [Arabidopsis thalian 0.337 0.181 0.586 5.1e-24
UNIPROTKB|Q9SQ64321 COR2 "Non-functional NADPH-dep 0.337 0.180 0.586 2.8e-23
TAIR|locus:2025936326 AT1G59960 [Arabidopsis thalian 0.337 0.177 0.534 1.6e-22
UNIPROTKB|Q9SQ69321 COR1.2 "NADPH-dependent codein 0.337 0.180 0.534 6.8e-20
UNIPROTKB|Q9SQ67321 COR1.4 "NADPH-dependent codein 0.337 0.180 0.534 1.1e-19
UNIPROTKB|Q9SQ70321 COR1.1 "NADPH-dependent codein 0.337 0.180 0.551 3.8e-19
UNIPROTKB|Q9SQ68321 COR1.3 "NADPH-dependent codein 0.337 0.180 0.517 1.1e-18
UNIPROTKB|B9VRJ2321 COR1.5 "NADPH-dependent codein 0.337 0.180 0.534 1.8e-18
TAIR|locus:2154164316 AT5G62420 [Arabidopsis thalian 0.337 0.183 0.431 5.3e-17
UNIPROTKB|E7C196 E7C196 "2-carbomethoxy-3-tropinone reductase" [Erythroxylum coca (taxid:289672)] Back     alignment and assigned GO terms
 Score = 168 (64.2 bits), Expect = 1.1e-24, Sum P(2) = 1.1e-24
 Identities = 32/58 (55%), Positives = 42/58 (72%)

Query:   106 NPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQL 163
             N  WQQKKLRE+  +KGIH +A SPL  +G  WG   V+E++ LK+IA A GK+VAQ+
Sbjct:   197 NVAWQQKKLREFCSKKGIHVTAWSPLAGIGAFWGSTVVIESKTLKEIAAAKGKSVAQV 254
GO:1901868 "ecgonine methyl ester catabolic process" evidence=IDA
GO:1901869 "ecgonine methyl ester biosynthetic process" evidence=IDA
GO:1901871 "ecgonone methyl ester catabolic process" evidence=IDA
GO:1901872 "ecgonone methyl ester biosynthetic process" evidence=IDA
TAIR|locus:2025926 AT1G59950 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ64 COR2 "Non-functional NADPH-dependent codeinone reductase 2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
TAIR|locus:2025936 AT1G59960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ69 COR1.2 "NADPH-dependent codeinone reductase 1-2" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ67 COR1.4 "NADPH-dependent codeinone reductase 1-4" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ70 COR1.1 "NADPH-dependent codeinone reductase 1-1" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|Q9SQ68 COR1.3 "NADPH-dependent codeinone reductase 1-3" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
UNIPROTKB|B9VRJ2 COR1.5 "NADPH-dependent codeinone reductase 1-5" [Papaver somniferum (taxid:3469)] Back     alignment and assigned GO terms
TAIR|locus:2154164 AT5G62420 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
COG0656 280 COG0656, ARA1, Aldo/keto reductases, related to di 2e-13
cd06660 285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 1e-12
COG0656280 COG0656, ARA1, Aldo/keto reductases, related to di 7e-10
COG1453 391 COG1453, COG1453, Predicted oxidoreductases of the 5e-09
pfam00248 277 pfam00248, Aldo_ket_red, Aldo/keto reductase famil 7e-07
PRK11565 275 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A 2e-05
PRK11172 267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 4e-05
PRK11172267 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B 6e-05
COG0667 316 COG0667, Tas, Predicted oxidoreductases (related t 8e-05
cd06660285 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) 0.002
PLN02587 314 PLN02587, PLN02587, L-galactose dehydrogenase 0.004
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information 
 Score = 65.7 bits (161), Expect = 2e-13
 Identities = 22/56 (39%), Positives = 33/56 (58%)

Query: 12 STGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEA 67
          + G  IP +G GT +   +E     V  A++LGYR  DTA  Y +E+ +GEA+ E+
Sbjct: 9  NNGVEIPAIGLGTWQIGDDEWAVRAVRAALELGYRLIDTAEIYGNEEEVGEAIKES 64

Length = 280
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|223729 COG0656, ARA1, Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>gnl|CDD|224370 COG1453, COG1453, Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>gnl|CDD|215817 pfam00248, Aldo_ket_red, Aldo/keto reductase family Back     alignment and domain information
>gnl|CDD|183203 PRK11565, dkgA, 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|183012 PRK11172, dkgB, 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>gnl|CDD|223739 COG0667, Tas, Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>gnl|CDD|119408 cd06660, Aldo_ket_red, Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>gnl|CDD|178198 PLN02587, PLN02587, L-galactose dehydrogenase Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 172
KOG1577300 consensus Aldo/keto reductase family proteins [Gen 100.0
COG0656280 ARA1 Aldo/keto reductases, related to diketogulona 100.0
COG0667316 Tas Predicted oxidoreductases (related to aryl-alc 100.0
KOG1575336 consensus Voltage-gated shaker-like K+ channel, su 100.0
PRK11565275 dkgA 2,5-diketo-D-gluconate reductase A; Provision 100.0
PRK09912346 L-glyceraldehyde 3-phosphate reductase; Provisiona 100.0
PRK11172267 dkgB 2,5-diketo-D-gluconate reductase B; Provision 100.0
TIGR01293317 Kv_beta voltage-dependent potassium channel beta s 100.0
PLN02587314 L-galactose dehydrogenase 100.0
PRK10625346 tas putative aldo-keto reductase; Provisional 100.0
cd06660285 Aldo_ket_red Aldo-keto reductases (AKRs) are a sup 99.97
PRK10376290 putative oxidoreductase; Provisional 99.97
PRK14863292 bifunctional regulator KidO; Provisional 99.97
COG4989298 Predicted oxidoreductase [General function predict 99.97
PF00248283 Aldo_ket_red: Aldo/keto reductase family; InterPro 99.96
COG1453 391 Predicted oxidoreductases of the aldo/keto reducta 99.93
KOG1576342 consensus Predicted oxidoreductase [Energy product 99.89
CHL00200263 trpA tryptophan synthase alpha subunit; Provisiona 86.18
>KOG1577 consensus Aldo/keto reductase family proteins [General function prediction only] Back     alignment and domain information 
Probab=100.00  E-value=1.4e-42  Score=274.94  Aligned_cols=165  Identities=36%  Similarity=0.476  Sum_probs=145.7

Q ss_pred             CCCCCCceecCCCCCcCCcccccccccCChhHHHHHHHHHHHhCCCeeecCCCCCChHHHHHHHHHHhhcC-Cch-----
Q 041959            1 MRTAIPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLA-SFN-----   74 (172)
Q Consensus         1 ~~~~m~~~~l~~tg~~~p~ig~Gt~~~~~~~~~~~~v~~a~~~G~~~~DtA~~Yg~E~~iG~~l~~~~~~~-~~~-----   74 (172)
                      |+... .++|++ |.+||.||||||+ .+.+++.+.|+.|++.||||||||..|+||+.+|++|++...++ +.|     
T Consensus         1 M~~~~-~~~Ln~-G~~mP~iGlGTw~-~~~~~~~~aV~~Al~~GYRHIDtA~~Y~NE~evG~aik~~i~~~~v~RediFi   77 (300)
T KOG1577|consen    1 MSSKT-TVKLNN-GFKMPIIGLGTWQ-SPPGQVAEAVKAAIKAGYRHIDTAHVYGNEKEVGEAIKELLAEGGVKREDIFI   77 (300)
T ss_pred             CCccc-eEeccC-CCccceeeeEecc-cChhhHHHHHHHHHHhCcceeechhhhCChHHHHHHHHHHhhhCCcchhhhee
Confidence            33333 688988 9999999999999 78899999999999999999999999999999999999875332 222     


Q ss_pred             ---------------HHHhhhhccCCC-CCCCe----------------------------------------------e
Q 041959           75 ---------------PATSFSSPQNSG-SPTPI----------------------------------------------A   92 (172)
Q Consensus        75 ---------------~~~~~~sL~~l~-d~~~~----------------------------------------------i   92 (172)
                                     .++++ ||++|+ ||+|+                                              |
T Consensus        78 TSKlw~~~~~~~~v~~al~~-sLk~L~ldYvDLyLiH~P~~~k~~~~~~~~~~~~~~~~~~~~tW~amE~~~~~Gl~rsI  156 (300)
T KOG1577|consen   78 TSKLWPTDHAPELVEKALEK-SLKKLQLDYVDLYLIHWPVAFKDSFPKDENGKVNYDDVDRIETWKAMEKLVDEGLVRSI  156 (300)
T ss_pred             eeccCccccChhhHHHHHHH-HHHHhChhhhheeeEecccccCCCCCcccccccccccchHHHHHHHHHHHHHcCCceEe
Confidence                           79999 999998 77653                                              9


Q ss_pred             EEcCCCHHHHhh---------------hCCccccHHHHHHHHHcCceEEEeccCCCCCCCCCCCCCCChHHHHHHHHHhC
Q 041959           93 AVSSRAYKKLSK---------------TNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANG  157 (172)
Q Consensus        93 GvSn~~~~~~~~---------------~~~~~~~~~l~~~~~~~gi~v~a~~pl~~~g~~~g~~~~~~~~~l~~ia~~~~  157 (172)
                      |||||+..++++               +||+++|+++++||+++||.|+||||||.++.  +. ..+.++.+.+||+||+
T Consensus       157 GVSNF~~~~le~ll~~~ki~P~vnQvE~HP~~~Q~~L~~fCk~~~I~v~AYSpLg~~~~--~~-~ll~~~~l~~iA~K~~  233 (300)
T KOG1577|consen  157 GVSNFNIKQLEELLNLAKIKPAVNQVECHPYLQQKKLVEFCKSKGIVVTAYSPLGSPGR--GS-DLLEDPVLKEIAKKYN  233 (300)
T ss_pred             eeecCCHHHHHHHHhcCCCCCccceeeccCCcChHHHHHHHhhCCcEEEEecCCCCCCC--cc-ccccCHHHHHHHHHhC
Confidence            999999999999               99999999999999999999999999998443  12 6789999999999999


Q ss_pred             CCHHHHHHHhcccCC
Q 041959          158 KTVAQLIHNSFFLST  172 (172)
Q Consensus       158 ~t~aqial~w~~~~~  172 (172)
                      +|||||+|||.++.+
T Consensus       234 kt~aQIlLrw~~q~g  248 (300)
T KOG1577|consen  234 KTPAQILLRWALQRG  248 (300)
T ss_pred             CCHHHHHHHHHHhCC
Confidence            999999999998753

>COG0656 ARA1 Aldo/keto reductases, related to diketogulonate reductase [General function prediction only] Back     alignment and domain information
>COG0667 Tas Predicted oxidoreductases (related to aryl-alcohol dehydrogenases) [Energy production and conversion] Back     alignment and domain information
>KOG1575 consensus Voltage-gated shaker-like K+ channel, subunit beta/KCNAB [Energy production and conversion] Back     alignment and domain information
>PRK11565 dkgA 2,5-diketo-D-gluconate reductase A; Provisional Back     alignment and domain information
>PRK09912 L-glyceraldehyde 3-phosphate reductase; Provisional Back     alignment and domain information
>PRK11172 dkgB 2,5-diketo-D-gluconate reductase B; Provisional Back     alignment and domain information
>TIGR01293 Kv_beta voltage-dependent potassium channel beta subunit, animal Back     alignment and domain information
>PLN02587 L-galactose dehydrogenase Back     alignment and domain information
>PRK10625 tas putative aldo-keto reductase; Provisional Back     alignment and domain information
>cd06660 Aldo_ket_red Aldo-keto reductases (AKRs) are a superfamily of soluble NAD(P)(H) oxidoreductases whose chief purpose is to reduce aldehydes and ketones to primary and secondary alcohols Back     alignment and domain information
>PRK10376 putative oxidoreductase; Provisional Back     alignment and domain information
>PRK14863 bifunctional regulator KidO; Provisional Back     alignment and domain information
>COG4989 Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>PF00248 Aldo_ket_red: Aldo/keto reductase family; InterPro: IPR023210 The aldo-keto reductase family includes a number of related monomeric NADPH-dependent oxidoreductases, such as aldehyde reductase, aldose reductase, prostaglandin F synthase, xylose reductase, rho crystallin, and many others [] Back     alignment and domain information
>COG1453 Predicted oxidoreductases of the aldo/keto reductase family [General function prediction only] Back     alignment and domain information
>KOG1576 consensus Predicted oxidoreductase [Energy production and conversion] Back     alignment and domain information
>CHL00200 trpA tryptophan synthase alpha subunit; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
3h7u_A335 Crystal Structure Of The Plant Stress-Response Enzy 2e-10
1zgd_A312 Chalcone Reductase Complexed With Nadp+ At 1.7 Angs 5e-10
3h7r_A331 Crystal Structure Of The Plant Stress-Response Enzy 7e-08
3f7j_A276 B.Subtilis Yvgn Length = 276 1e-05
3d3f_A275 Crystal Structure Of Yvgn And Cofactor Nadph From B 1e-05
1frb_A 315 Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 1e-04
1vp5_A 298 Crystal Structure Of 2,5-diketo-d-gluconic Acid Red 4e-04
1zua_X 317 Crystal Structure Of Akr1b10 Complexed With Nadp+ A 4e-04
3qkz_A 316 Crystal Structure Of Mutant His269arg Akr1b14 Lengt 6e-04
3o3r_A 316 Crystal Structure Of Akr1b14 In Complex With Nadp L 6e-04
3up8_A 298 Crystal Structure Of A Putative 2,5-Diketo-D-Glucon 7e-04
4fzi_A290 Crystal Structure Of Prostaglandin F Synthase From 7e-04
1vbj_A 281 The Crystal Structure Of Prostaglandin F Synthase F 8e-04
>pdb|3H7U|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c9 Length = 335 Back     alignment and structure 
Iteration: 1

 Score = 62.0 bits (149), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 28/60 (46%), Positives = 42/60 (70%)
Query: 104 KTNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQL 163
           + +P W+Q KL+E+ K KG+H SA SPLG+ GT W  + V++N +L  +AE  GK+ AQ+
Sbjct: 202 ECHPSWRQTKLQEFCKSKGVHLSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQV 261
>pdb|1ZGD|A Chain A, Chalcone Reductase Complexed With Nadp+ At 1.7 Angstrom Resolution Length = 312 Back     alignment and structure
>pdb|3H7R|A Chain A, Crystal Structure Of The Plant Stress-Response Enzyme Akr4c8 Length = 331 Back     alignment and structure
>pdb|3F7J|A Chain A, B.Subtilis Yvgn Length = 276 Back     alignment and structure
>pdb|3D3F|A Chain A, Crystal Structure Of Yvgn And Cofactor Nadph From Bacillus Subtilis Length = 275 Back     alignment and structure
>pdb|1FRB|A Chain A, Fr-1 ProteinNADPHZOPOLRESTAT COMPLEX Length = 315 Back     alignment and structure
>pdb|1VP5|A Chain A, Crystal Structure Of 2,5-diketo-d-gluconic Acid Reductase (tm1009) From Thermotoga Maritima At 2.40 A Resolution Length = 298 Back     alignment and structure
>pdb|1ZUA|X Chain X, Crystal Structure Of Akr1b10 Complexed With Nadp+ And Tolrestat Length = 317 Back     alignment and structure
>pdb|3QKZ|A Chain A, Crystal Structure Of Mutant His269arg Akr1b14 Length = 316 Back     alignment and structure
>pdb|3O3R|A Chain A, Crystal Structure Of Akr1b14 In Complex With Nadp Length = 316 Back     alignment and structure
>pdb|3UP8|A Chain A, Crystal Structure Of A Putative 2,5-Diketo-D-Gluconic Acid Reductase B Length = 298 Back     alignment and structure
>pdb|4FZI|A Chain A, Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Cruzi Length = 290 Back     alignment and structure
>pdb|1VBJ|A Chain A, The Crystal Structure Of Prostaglandin F Synthase From Trypanosoma Brucei Length = 281 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query172
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 2e-21
3h7u_A 335 Aldo-keto reductase; stress response, NADP, drough 9e-19
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 3e-21
3h7r_A 331 Aldo-keto reductase; stress response, NADP, drough 7e-17
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 7e-20
1zgd_A 312 Chalcone reductase; polyketide, deoxychalcone, iso 5e-18
3ln3_A 324 Dihydrodiol dehydrogenase; putative reductase, str 4e-17
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 2e-07
2bgs_A 344 Aldose reductase; holoenzyme, aldo/keto reductase, 4e-17
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 5e-17
1s1p_A 331 Aldo-keto reductase family 1 member C3; TIM-barrel 8e-17
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 2e-16
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 4e-16
1afs_A 323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 4e-16
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 5e-16
3o3r_A 316 Aldo-keto reductase family 1, member B7; aldose re 5e-15
2ao0_A324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 7e-16
2ao0_A 324 Aldehyde dehydrogenase; TIM barrel, aldo-keto redu 6e-15
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 8e-16
1us0_A 316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 6e-15
3buv_A 326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 9e-16
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 1e-15
1mi3_A 322 Xylose reductase, XR; aldo-keto reductase, beta-al 3e-15
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 8e-15
3krb_A 334 Aldose reductase; ssgcid, SBRI, emerald biostructu 4e-15
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 1e-14
1qwk_A 317 Aldose reductase, aldo-keto reductase family 1 mem 5e-15
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 1e-13
4gie_A 290 Prostaglandin F synthase; structural genomics, nia 2e-14
4gie_A290 Prostaglandin F synthase; structural genomics, nia 2e-12
4f40_A 288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 2e-14
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 6e-13
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 3e-14
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 2e-12
3f7j_A 276 YVGN protein; aldo-keto reductase, oxidoreductase; 7e-14
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 1e-12
1vbj_A 281 Prostaglandin F synthase; TIM barrel, oxidoreducta 7e-14
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 1e-12
3b3e_A 310 YVGN protein; aldo-keto reductase, oxidoreductase; 1e-13
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 2e-12
2wzm_A 283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 1e-13
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 1e-12
3up8_A 298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-13
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 2e-12
1hw6_A 278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 2e-13
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 6e-13
1vp5_A 298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 2e-13
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 2e-13
1mzr_A 296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 3e-13
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 4e-13
1pyf_A 312 IOLS protein; beta-alpha barrel, aldo-keto reducta 5e-06
3v0s_A 337 Perakine reductase; AKR superfamily, oxidoreductas 8e-06
1ynp_A 317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 3e-05
1pz1_A 333 GSP69, general stress protein 69; beta-alpha barre 3e-05
3n2t_A 348 Putative oxidoreductase; aldo/keto reductase super 3e-04
3lut_A 367 Voltage-gated potassium channel subunit beta-2; vo 5e-04
3n6q_A 346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 7e-04
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
 Score = 88.0 bits (219), Expect = 2e-21
 Identities = 28/59 (47%), Positives = 41/59 (69%)

Query: 106 NPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLI 164
           +P W+Q KL+E+ K KG+H SA SPLG+ GT W  + V++N +L  +AE  GK+ AQ+ 
Sbjct: 204 HPSWRQTKLQEFCKSKGVHLSAYSPLGSPGTTWLKSDVLKNPILNMVAEKLGKSPAQVA 262
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Length = 335 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Length = 331 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Length = 312 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} Length = 324 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Length = 344 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Length = 331 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Length = 323 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} PDB: 3qkz_A* Length = 316 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Length = 316 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Length = 326 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Length = 322 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Length = 334 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Length = 317 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Length = 290 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} Length = 288 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Length = 283 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Length = 276 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Length = 281 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Length = 283 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Length = 298 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Length = 278 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Length = 298 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Length = 296 Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Length = 312 Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Length = 337 Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Length = 317 Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Length = 333 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} Length = 348 Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Length = 367 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} Length = 346 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
4gie_A290 Prostaglandin F synthase; structural genomics, nia 100.0
3f7j_A276 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3o0k_A283 Aldo/keto reductase; ssgcid, ALS collaborative cry 100.0
3b3d_A314 YTBE protein, putative morphine dehydrogenase; ald 100.0
3b3e_A310 YVGN protein; aldo-keto reductase, oxidoreductase; 100.0
3h7u_A335 Aldo-keto reductase; stress response, NADP, drough 100.0
3ln3_A324 Dihydrodiol dehydrogenase; putative reductase, str 100.0
1vbj_A281 Prostaglandin F synthase; TIM barrel, oxidoreducta 100.0
4gac_A324 Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldhe 100.0
3up8_A298 Putative 2,5-diketo-D-gluconic acid reductase B; n 100.0
1hw6_A278 2,5-diketo-D-gluconic acid reductase; aldo-keto re 100.0
2wzm_A283 Aldo-keto reductase; oxidoreductase; HET: NA7; 1.6 100.0
4f40_A288 Prostaglandin F2-alpha synthase/D-arabinose dehyd; 100.0
1qwk_A317 Aldose reductase, aldo-keto reductase family 1 mem 100.0
1zgd_A312 Chalcone reductase; polyketide, deoxychalcone, iso 100.0
1pyf_A312 IOLS protein; beta-alpha barrel, aldo-keto reducta 100.0
3o3r_A316 Aldo-keto reductase family 1, member B7; aldose re 100.0
3h7r_A331 Aldo-keto reductase; stress response, NADP, drough 100.0
1pz1_A333 GSP69, general stress protein 69; beta-alpha barre 100.0
1mzr_A296 2,5-diketo-D-gluconate reductase A; alpha/beta-bar 100.0
3n2t_A348 Putative oxidoreductase; aldo/keto reductase super 100.0
1mi3_A322 Xylose reductase, XR; aldo-keto reductase, beta-al 100.0
3v0s_A337 Perakine reductase; AKR superfamily, oxidoreductas 100.0
1afs_A323 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; 100.0
1vp5_A298 2,5-diketo-D-gluconic acid reductase; TM1009, stru 100.0
3n6q_A346 YGHZ aldo-keto reductase; TIM barrel, oxidoreducta 100.0
3erp_A353 Putative oxidoreductase; funded by the national in 100.0
3eau_A327 Voltage-gated potassium channel subunit beta-2; kv 100.0
3lut_A367 Voltage-gated potassium channel subunit beta-2; vo 100.0
3buv_A326 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reduc 100.0
1us0_A316 Aldose reductase; oxidoreductase, NADP, IDD594; HE 100.0
4exb_A292 Putative uncharacterized protein; aldo-keto reduct 100.0
1s1p_A331 Aldo-keto reductase family 1 member C3; TIM-barrel 100.0
1ur3_M319 Hypothetical oxidoreductase YDHF; NADP binding, al 100.0
1ynp_A317 Oxidoreductase, AKR11C1; aldo-keto reductase, NADP 100.0
3krb_A334 Aldose reductase; ssgcid, SBRI, emerald biostructu 100.0
2bgs_A344 Aldose reductase; holoenzyme, aldo/keto reductase, 100.0
1lqa_A346 TAS protein; TIM barrel, structure 2 function proj 100.0
1gve_A327 Aflatoxin B1 aldehyde reductase member 3; oxidored 100.0
2bp1_A360 Aflatoxin B1 aldehyde reductase member 2; oxidored 100.0
>4gie_A Prostaglandin F synthase; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: NAP; 1.25A {Trypanosoma cruzi} PDB: 4fzi_A* Back     alignment and structure
Probab=100.00  E-value=1.2e-42  Score=278.16  Aligned_cols=166  Identities=30%  Similarity=0.411  Sum_probs=147.0

Q ss_pred             CCCCCCceecCCCCCcCCcccccccccCChhHHHHHHHHHHHhCCCeeecCCCCCChHHHHHHHHHH--hhcCCch----
Q 041959            1 MRTAIPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEA--LRLASFN----   74 (172)
Q Consensus         1 ~~~~m~~~~l~~tg~~~p~ig~Gt~~~~~~~~~~~~v~~a~~~G~~~~DtA~~Yg~E~~iG~~l~~~--~~~~~~~----   74 (172)
                      |...|++++|++ |++||.||||||++.+.+++.++|++|+++||||||||+.||||+.+|++++..  +|+.++.    
T Consensus         9 m~~~~~~v~Ln~-G~~ip~lGlGtw~~~d~~e~~~~v~~Al~~Gin~~DTA~~YgsE~~vG~~l~~~~~~r~~~~i~tk~   87 (290)
T 4gie_A            9 MNCNYNCVTLHN-SVRMPQLGLGVWRAQDGAETANAVRWAIEAGYRHIDTAYIYSNERGVGQGIRESGVPREEVWVTTKV   87 (290)
T ss_dssp             CSSSSCEEECTT-SCEEESBCEECTTCCTTHHHHHHHHHHHHHTCCEEECCGGGTCHHHHHHHHHHHCCCGGGSEEEEEE
T ss_pred             cCCCCCEEEcCC-CCCccceeEECCCCCCHHHHHHHHHHHHHcCCCEEecccccCCHHHHHHHHHhcCCcchhccccccc
Confidence            777899999977 999999999999988888999999999999999999999999999999999987  2333321    


Q ss_pred             -----------HHHhhhhccCCC-CCCCe-----------------------------eEEcCCCHHHHhh---------
Q 041959           75 -----------PATSFSSPQNSG-SPTPI-----------------------------AAVSSRAYKKLSK---------  104 (172)
Q Consensus        75 -----------~~~~~~sL~~l~-d~~~~-----------------------------iGvSn~~~~~~~~---------  104 (172)
                                 +++++ ||+||+ ||+|+                             ||||||+.+++.+         
T Consensus        88 ~~~~~~~~~~~~~~e~-SL~rL~~dyiDly~lH~p~~~~~~e~~~al~~l~~~Gkir~iGvSn~~~~~l~~~~~~~~~~~  166 (290)
T 4gie_A           88 WNSDQGYEKTLAAFER-SRELLGLEYIDLYLIHWPGKKKFVDTWKALEKLYEEKKVRAIGVSNFEPHHLTELFKSCKIRP  166 (290)
T ss_dssp             CGGGCSHHHHHHHHHH-HHHHHTCSCEEEEEECCCCSSSHHHHHHHHHHHHHTTSEEEEEEESCCHHHHHHHHTTCSSCC
T ss_pred             cccCCChHHHHHHHHH-HHHHhCCCceeeEEecCCCCCcchHHHHHHHHHHHCCCcceeeecCCCHHHHHHHHHhccCCC
Confidence                       89999 999999 88775                             9999999999987         


Q ss_pred             ------hCCccccHHHHHHHHHcCceEEEeccCCCCCCCCCCCCCCChHHHHHHHHHhCCCHHHHHHHhcccCC
Q 041959          105 ------TNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGHNRVMENEVLKQIAEANGKTVAQLIHNSFFLST  172 (172)
Q Consensus       105 ------~~~~~~~~~l~~~~~~~gi~v~a~~pl~~~g~~~g~~~~~~~~~l~~ia~~~~~t~aqial~w~~~~~  172 (172)
                            +++..++.+++++|+++||++++|+|+++ |.+.+   ....+.+.++|++||+|++|+||||+++.+
T Consensus       167 ~~~q~~~~~~~~~~~l~~~~~~~gi~~~a~spl~~-G~l~~---~~~~~~l~~iA~~~g~t~aqvaL~w~l~~~  236 (290)
T 4gie_A          167 MVNQVELHPLFQQRTLREFCKQHNIAITAWSPLGS-GEEAG---ILKNHVLGEIAKKHNKSPAQVVIRWDIQHG  236 (290)
T ss_dssp             SEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCS-SGGGC---GGGCHHHHHHHHHHTCCHHHHHHHHHHHTT
T ss_pred             ceeeEeccccchhHHHHHHHHHcCceEeeeccccc-ccccc---cchhHHHHHHHHHhCCCHHHHHHHHHHhCC
Confidence                  55666678999999999999999999998 77643   345689999999999999999999998753
>3f7j_A YVGN protein; aldo-keto reductase, oxidoreductase; 1.70A {Bacillus subtilis} PDB: 3d3f_A* Back     alignment and structure
>3o0k_A Aldo/keto reductase; ssgcid, ALS collaborative crystallography; 1.80A {Brucella melitensis biovar} Back     alignment and structure
>3b3d_A YTBE protein, putative morphine dehydrogenase; aldo-keto reductase, oxidoreductase; 2.30A {Bacillus subtilis} Back     alignment and structure
>3h7u_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.25A {Arabidopsis thaliana} Back     alignment and structure
>3ln3_A Dihydrodiol dehydrogenase; putative reductase, structural genomics, joint center for structural genomics, JCSG, protein structure initiative, PSI-2; HET: MLY MSE NAD; 1.18A {Mus musculus} SCOP: c.1.7.1 Back     alignment and structure
>1vbj_A Prostaglandin F synthase; TIM barrel, oxidoreductase; HET: NAP CIT; 2.10A {Trypanosoma brucei} Back     alignment and structure
>4gac_A Alcohol dehydrogenase [NADP(+)]; TIM barrel, aldheyde reductase AKR1A4, SMAR1, oxidoreductase; HET: FLC; 1.64A {Mus musculus} PDB: 2alr_A 3h4g_A* 3cv7_A* 3fx4_A* 1ae4_A* 1cwn_A* 1hqt_A* Back     alignment and structure
>3up8_A Putative 2,5-diketo-D-gluconic acid reductase B; nysgrc, PSI-biology, structural genomics; 1.96A {Sinorhizobium meliloti} Back     alignment and structure
>1hw6_A 2,5-diketo-D-gluconic acid reductase; aldo-keto reductase, TIM barrel, oxidoreductase; 1.90A {Corynebacterium SP} SCOP: c.1.7.1 PDB: 1a80_A* 1m9h_A* Back     alignment and structure
>2wzm_A Aldo-keto reductase; oxidoreductase; HET: NA7; 1.64A {Mycobacterium smegmatis} PDB: 2wzt_A Back     alignment and structure
>4f40_A Prostaglandin F2-alpha synthase/D-arabinose dehyd; structural genomics, niaid, national institute of allergy AN infectious diseases; HET: CIT; 1.60A {Leishmania major} PDB: 4g5d_A* Back     alignment and structure
>1qwk_A Aldose reductase, aldo-keto reductase family 1 member C1, XH961; structural genomics, PSI, protein structure initiative; 1.60A {Caenorhabditis elegans} SCOP: c.1.7.1 Back     alignment and structure
>1zgd_A Chalcone reductase; polyketide, deoxychalcone, isoflavonoid, biosynthesis, plant protein; HET: NAP; 1.70A {Medicago sativa} Back     alignment and structure
>1pyf_A IOLS protein; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; 1.80A {Bacillus subtilis} SCOP: c.1.7.1 PDB: 1pz0_A* Back     alignment and structure
>3o3r_A Aldo-keto reductase family 1, member B7; aldose reductase like protein, AKR1B14, oxidoreductase; HET: NAP; 1.86A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 3qkz_A* Back     alignment and structure
>3h7r_A Aldo-keto reductase; stress response, NADP, drought tolerance, oxidoreductase; HET: NAP; 1.40A {Arabidopsis thaliana} Back     alignment and structure
>1pz1_A GSP69, general stress protein 69; beta-alpha barrel, aldo-keto reductase, TIM barrel, oxidoreductase; HET: NAP; 2.20A {Bacillus subtilis} SCOP: c.1.7.1 Back     alignment and structure
>1mzr_A 2,5-diketo-D-gluconate reductase A; alpha/beta-barrel, aldo-ketoreductase, NADPH dependant, BACT targets at IGS-CNRS, france, BIGS; 2.13A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>3n2t_A Putative oxidoreductase; aldo/keto reductase superfamily, AKR, AKR11B4, TIM barrel; 2.00A {Gluconobacter oxydans} SCOP: c.1.7.0 Back     alignment and structure
>1mi3_A Xylose reductase, XR; aldo-keto reductase, beta-alpha barrel, dimer, oxidoreductase; HET: NAD; 1.80A {Candida tenuis} SCOP: c.1.7.1 PDB: 1jez_A* 1k8c_A* 1ye6_A* 1ye4_A* 1sm9_A* 1r38_A* 1z9a_A* Back     alignment and structure
>3v0s_A Perakine reductase; AKR superfamily, oxidoreductase; HET: MLZ M3L MLY ATR; 1.77A {Rauvolfia serpentina} PDB: 3v0u_A 3v0t_A* 3uyi_A* Back     alignment and structure
>1afs_A 3-alpha-HSD, 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, NAD; HET: NAP TES; 2.50A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 1lwi_A* Back     alignment and structure
>1vp5_A 2,5-diketo-D-gluconic acid reductase; TM1009, structural genomics, joint center for structural genomics, PSI, protein structure initiative; HET: NAP; 2.40A {Thermotoga maritima} SCOP: c.1.7.1 Back     alignment and structure
>3n6q_A YGHZ aldo-keto reductase; TIM barrel, oxidoreductase; 1.80A {Escherichia coli} SCOP: c.1.7.0 PDB: 4ast_A 4aub_A* Back     alignment and structure
>3erp_A Putative oxidoreductase; funded by the national institute of allergy and infectious D of NIH contract number HHSN272200700058C; 1.55A {Salmonella enterica subsp} Back     alignment and structure
>3eau_A Voltage-gated potassium channel subunit beta-2; kvbeta, cortisone, NADPH, cytoplasm, ION transport, ionic channel, NADP, phosphoprotein; HET: NDP PDN; 1.82A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2r9r_A* 2a79_A* 3lnm_A* 1exb_A* 3eb4_A* 3eb3_A* 1qrq_A* 1zsx_A* Back     alignment and structure
>3lut_A Voltage-gated potassium channel subunit beta-2; voltage gating, potassium channel, KV1.2, gating charges, no analysis, ION transport; HET: NAP; 2.90A {Rattus norvegicus} Back     alignment and structure
>3buv_A 3-OXO-5-beta-steroid 4-dehydrogenase; 5-beta-reductase, catalytic tetrad, hepes, NADP, bIle catabolism, disease mutation, lipid metabolism; HET: NAP EPE; 1.35A {Homo sapiens} PDB: 3bur_A* 3bv7_A* 3caq_A* 3cas_A* 3cav_A* 3g1r_A* 3cot_A* 3dop_A* 3cmf_A* 3uzx_A* 3uzw_A* 3uzy_A* 3uzz_A* Back     alignment and structure
>1us0_A Aldose reductase; oxidoreductase, NADP, IDD594; HET: NDP LDT CIT; 0.66A {Homo sapiens} SCOP: c.1.7.1 PDB: 1pwl_A* 1t41_A* 1pwm_A* 1x96_A* 1x97_A* 1x98_A* 1z89_A* 1z8a_A* 2dux_A* 2duz_A* 2dv0_A* 2fz8_A* 2fz9_A* 2fzb_A* 2fzd_A* 2hv5_A* 2hvn_A* 2hvo_A* 2i16_A* 2i17_A* ... Back     alignment and structure
>4exb_A Putative uncharacterized protein; aldo-keto reductase, NADP+ binding, oxidoreducta; 2.75A {Pseudomonas aeruginosa} PDB: 4exa_A Back     alignment and structure
>1s1p_A Aldo-keto reductase family 1 member C3; TIM-barrel, oxidoreductase; HET: NAP; 1.20A {Homo sapiens} SCOP: c.1.7.1 PDB: 1s1r_A* 1s2a_A* 1s2c_A* 3uwe_A* 3r58_A* 3r43_A* 3r7m_A* 3r6i_A* 3r8h_A* 3r94_A* 3r8g_A* 1zq5_A* 1ry8_A* 1xf0_A* 1ry0_A* 2f38_A* 2fgb_A* 4dbs_A* 4dbu_A* 3gug_A* ... Back     alignment and structure
>1ur3_M Hypothetical oxidoreductase YDHF; NADP binding, aldo-keto reductase; 2.57A {Escherichia coli} SCOP: c.1.7.1 PDB: 1og6_A* Back     alignment and structure
>1ynp_A Oxidoreductase, AKR11C1; aldo-keto reductase, NADPH; HET: SUC; 1.25A {Bacillus halodurans} PDB: 1ynq_A* Back     alignment and structure
>3krb_A Aldose reductase; ssgcid, SBRI, emerald biostructures, university of washingto niaid, oxidoreductase, S genomics; HET: NAP; 1.75A {Giardia lamblia} Back     alignment and structure
>2bgs_A Aldose reductase; holoenzyme, aldo/keto reductase, oxidoreductase; HET: NDP; 1.64A {Hordeum vulgare} PDB: 2bgq_A* 2vdg_A* Back     alignment and structure
>1lqa_A TAS protein; TIM barrel, structure 2 function project, S2F, structural GE oxidoreductase; HET: NDP; 1.60A {Escherichia coli} SCOP: c.1.7.1 Back     alignment and structure
>1gve_A Aflatoxin B1 aldehyde reductase member 3; oxidoreductase, aldo-keto reductase, succinic semialdehyde oxidoreductase, AKR7 family; HET: NAP CIT; 1.38A {Rattus norvegicus} SCOP: c.1.7.1 PDB: 2clp_A* 2c91_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 172
d1mi3a_ 319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 1e-16
d1mi3a_319 c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenu 0.002
d1us0a_ 314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 2e-16
d1us0a_314 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 3e-07
d1frba_ 315 c.1.7.1 (A:) FR-1 (fibroblast growth factor-induce 2e-16
d1qwka_ 312 c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematod 7e-15
d1hqta_ 324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 9e-15
d1hqta_324 c.1.7.1 (A:) Aldose reductase (aldehyde reductase) 9e-05
d1afsa_ 319 c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase 2e-14
d1s1pa_ 315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 5e-14
d1s1pa_315 c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (ak 3e-05
d1vp5a_ 284 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 9e-14
d1mzra_ 274 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 2e-12
d1hw6a_262 c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase 4e-12
d3eaua1 326 c.1.7.1 (A:36-361) Voltage-dependent K+ channel be 4e-10
d1pz1a_ 333 c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillu 2e-09
d1lqaa_ 346 c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 2e-09
d1gvea_ 324 c.1.7.1 (A:) Aflatoxin aldehyde reductase (akr7a1) 6e-09
d1ur3m_ 298 c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Esc 6e-09
d1pyfa_ 311 c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillu 7e-09
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Xylose reductase
species: Fungi (Candida tenuis) [TaxId: 45596]

 Score = 73.5 bits (179), Expect = 1e-16
 Identities = 35/152 (23%), Positives = 60/152 (39%), Gaps = 2/152 (1%)

Query: 4   AIPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEA 63
           +IP+  L S+G  +P +GFG  +     A  E+V  AIK GYR FD A  Y +E+ +G+ 
Sbjct: 1   SIPDIKL-SSGHLMPSIGFGCWKLANATAG-EQVYQAIKAGYRLFDGAEDYGNEKEVGDG 58

Query: 64  LAEALRLASFNPATSFSSPQNSGSPTPIAAVSSRAYKKLSKTNPIWQQKKLREYRKEKGI 123
           +  A+          F + +   +      V +   K L+     +    L  +      
Sbjct: 59  VKRAIDEGLVKREEIFLTSKLWNNYHDPKNVETALNKTLADLKVDYVDLFLIHFPIAFKF 118

Query: 124 HFSACSPLGAVGTNWGHNRVMENEVLKQIAEA 155
                          G+N V E+  + +  +A
Sbjct: 119 VPIEEKYPPGFYCGDGNNFVYEDVPILETWKA 150
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Length = 319 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Length = 314 Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 315 Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 312 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Length = 324 Back     information, alignment and structure
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 319 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Length = 315 Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Length = 284 Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Length = 274 Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Length = 262 Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 326 Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Length = 333 Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Length = 346 Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Length = 298 Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Length = 311 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query172
d1us0a_314 Aldose reductase (aldehyde reductase) {Human (Homo 100.0
d1afsa_319 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus 100.0
d1mzra_274 2,5-diketo-D-gluconic acid reductase A {Escherichi 100.0
d1qwka_312 Hypothetical protein C07D8.6 {Nematode (Caenorhabd 100.0
d1mi3a_319 Xylose reductase {Fungi (Candida tenuis) [TaxId: 4 100.0
d1s1pa_315 Prostaglandin d2 11-ketoreductase (akr1c3) {Human 100.0
d1hw6a_262 2,5-diketo-D-gluconic acid reductase A {Corynebact 100.0
d1frba_315 FR-1 (fibroblast growth factor-induced) protein {M 100.0
d1vp5a_284 2,5-diketo-D-gluconic acid reductase A {Thermotoga 100.0
d1hqta_324 Aldose reductase (aldehyde reductase) {Pig (Sus sc 100.0
d1pz1a_333 Putative oxidoreductase YhdN {Bacillus subtilis [T 100.0
d1lqaa_346 Tas protein {Escherichia coli [TaxId: 562]} 100.0
d1pyfa_311 Putative oxidoreductase IolS {Bacillus subtilis [T 100.0
d3eaua1326 Voltage-dependent K+ channel beta subunit {Rat (Ra 100.0
d1ur3m_298 Hypothetical oxidoreductase YdhF {Escherichia coli 99.97
d1gvea_324 Aflatoxin aldehyde reductase (akr7a1) {Rat (Rattus 99.97
d1qopa_267 Trp synthase alpha-subunit {Salmonella typhimurium 85.19
>d1us0a_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: NAD(P)-linked oxidoreductase
family: Aldo-keto reductases (NADP)
domain: Aldose reductase (aldehyde reductase)
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=1.4e-36  Score=242.71  Aligned_cols=165  Identities=28%  Similarity=0.371  Sum_probs=141.6

Q ss_pred             CCceecCCCCCcCCcccccccccCChhHHHHHHHHHHHhCCCeeecCCCCCChHHHHHHHHHHhhcCCch----------
Q 041959            5 IPEEPLGSTGKSIPLVGFGTVEYPLNEAFKERVLHAIKLGYRHFDTAAAYPSEQPLGEALAEALRLASFN----------   74 (172)
Q Consensus         5 m~~~~l~~tg~~~p~ig~Gt~~~~~~~~~~~~v~~a~~~G~~~~DtA~~Yg~E~~iG~~l~~~~~~~~~~----------   74 (172)
                      |+++.+.+||++||.||||||+ .+.+++.++|++|++.|||+||||+.||||+.+|++|++..++....          
T Consensus         1 ~~~r~~~~tG~~vs~iglGtw~-~~~~~~~~~i~~A~~~Gin~fDTA~~YgsE~~lG~~l~~~~~~~~~~~~~~~~~~~~   79 (314)
T d1us0a_           1 MASRILLNNGAKMPILGLGTWK-SPPGQVTEAVKVAIDVGYRHIDCAHVYQNENEVGVAIQEKLREQVVKREELFIVSKL   79 (314)
T ss_dssp             CCSEEECTTSCEEESBCEECTT-CCHHHHHHHHHHHHHHTCCEEECCGGGTCHHHHHHHHHHHHHTTSSCGGGCEEEEEE
T ss_pred             CCCceECCCcCEecceeeECCC-CCHHHHHHHHHHHHHcCCCEEECccccCChHHHHHHHHhhhhccccccccccccccc
Confidence            7889999999999999999999 57899999999999999999999999999999999999875554321          


Q ss_pred             -----------HHHhhhhccCCC-CCCCe-------------------------------------------------eE
Q 041959           75 -----------PATSFSSPQNSG-SPTPI-------------------------------------------------AA   93 (172)
Q Consensus        75 -----------~~~~~~sL~~l~-d~~~~-------------------------------------------------iG   93 (172)
                                 +++++ ||++|+ |++|+                                                 ||
T Consensus        80 ~~~~~~~~~~~~~~~~-SL~rl~~d~idl~~lH~~~~~~~~~~~~~~~~~~~~~~~~~~~~e~~~~L~~lk~~G~Ir~iG  158 (314)
T d1us0a_          80 WCTYHEKGLVKGACQK-TLSDLKLDYLDLYLIHWPTGFKPGKEFFPLDESGNVVPSDTNILDTWAAMEELVDEGLVKAIG  158 (314)
T ss_dssp             CGGGCSHHHHHHHHHH-HHHHHTCSCBSEEEESSSCCBCCSSCSSCBCTTSCBCBCSCCHHHHHHHHHHHHHTTSBSCEE
T ss_pred             ccccccchhhHHHHHH-HhhhcCCCceeeeeeccCCCCCcccccCCcccccccCCCCCCHHHHHHHHHHHHHcCCeeEee
Confidence                       78999 999988 65432                                                 99


Q ss_pred             EcCCCHHHHhh-----------------hCCccccHHHHHHHHHcCceEEEeccCCCCCCCCCC----CCCCChHHHHHH
Q 041959           94 VSSRAYKKLSK-----------------TNPIWQQKKLREYRKEKGIHFSACSPLGAVGTNWGH----NRVMENEVLKQI  152 (172)
Q Consensus        94 vSn~~~~~~~~-----------------~~~~~~~~~l~~~~~~~gi~v~a~~pl~~~g~~~g~----~~~~~~~~l~~i  152 (172)
                      +|||+..++++                 +++...+.+++++|+++||.+++|+|++. |.+.+.    ......+.+.++
T Consensus       159 vS~~~~~~l~~~~~~~~~~~~~~~~q~~~~~~~~~~~l~~~~~~~~i~~~~~~pl~~-g~~~~~~~~~~~~~~~~~l~~i  237 (314)
T d1us0a_         159 ISNFNHLQVEMILNKPGLKYKPAVNQIECHPYLTQEKLIQYCQSKGIVVTAYSPLGS-PDRPWAKPEDPSLLEDPRIKAI  237 (314)
T ss_dssp             EESCCHHHHHHHHTCTTCCSCCSEEEEECBTTBCCHHHHHHHHHTTCEEEEESTTCC-TTCTTCCTTSCCTTTCHHHHHH
T ss_pred             ccCCCHHHHHHHHHhccCCcCchhhhhhcchhhhHHHHHHHHHHcCCeeeccCcccc-ccccccCcccchhhhhhHHHHH
Confidence            99999999987                 44555567899999999999999999998 665432    233456899999


Q ss_pred             HHHhCCCHHHHHHHhcccCC
Q 041959          153 AEANGKTVAQLIHNSFFLST  172 (172)
Q Consensus       153 a~~~~~t~aqial~w~~~~~  172 (172)
                      |+++|+|++|+||+|+++.+
T Consensus       238 a~~~g~s~aq~al~~~l~~~  257 (314)
T d1us0a_         238 AAKHNKTTAQVLIRFPMQRN  257 (314)
T ss_dssp             HHHHTCCHHHHHHHHHHHTT
T ss_pred             HHHhCCCHHHHHHHHHHhCC
Confidence            99999999999999998753
>d1afsa_ c.1.7.1 (A:) 3-alpha-hydroxysteroid dehydrogenase {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1mzra_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qwka_ c.1.7.1 (A:) Hypothetical protein C07D8.6 {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1mi3a_ c.1.7.1 (A:) Xylose reductase {Fungi (Candida tenuis) [TaxId: 45596]} Back     information, alignment and structure
>d1s1pa_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1hw6a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Corynebacterium sp. [TaxId: 1720]} Back     information, alignment and structure
>d1frba_ c.1.7.1 (A:) FR-1 (fibroblast growth factor-induced) protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1vp5a_ c.1.7.1 (A:) 2,5-diketo-D-gluconic acid reductase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1hqta_ c.1.7.1 (A:) Aldose reductase (aldehyde reductase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1pz1a_ c.1.7.1 (A:) Putative oxidoreductase YhdN {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1lqaa_ c.1.7.1 (A:) Tas protein {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1pyfa_ c.1.7.1 (A:) Putative oxidoreductase IolS {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d3eaua1 c.1.7.1 (A:36-361) Voltage-dependent K+ channel beta subunit {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ur3m_ c.1.7.1 (M:) Hypothetical oxidoreductase YdhF {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qopa_ c.1.2.4 (A:) Trp synthase alpha-subunit {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure