Citrus Sinensis ID: 041967

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------
MKSNLSTEDDDDIVESDIELDNTDVMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRIQEHRRKYERLRKERELKNFERERQRKQAGADREALSGLRDGMASDFFSLCFCNIVGANR
ccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHccccHHHHHHHHHHHHHcccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHcccHHHHHHHHHHHHcccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHccccccHHHHHHHHccccccccc
**********************************************MRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARR******************************************MASDFFSLCFCNIVG***
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MKSNLSTEDDDDIVESDIELDNTDVMEPDNDPSQKMGDPSVEVTEEMRDAANMTKLKAVDLISEGKLEDAIGQLTEAIMLNPTSAILYAARAGVYVKLNKPNAAIRDAYVALETNPDSAKGYKIRGMARARLGQWEEAANDLHVASKLDYDEEIGMALKKVEPNARRxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxADREALSGLRDGMASDFFSLCFCNIVGANR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
TPR repeat-containing thioredoxin TDX Probable thiol-disulfide oxidoreductase that may participate in various redox reactions and act as chaperone under heat shock. May interact with HSP70 proteins through the TPR repeats.probableQ6ES52
Putative protein FAM10A4 probableQ8IZP2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1W3B, chain A
Confidence level:very confident
Coverage over the Query: 50-183
View the alignment between query and template
View the model in PyMOL
Template: 2LLW, chain A
Confidence level:probable
Coverage over the Query: 190-221
View the alignment between query and template
View the model in PyMOL