Citrus Sinensis ID: 041986


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-----
MGLKQSSQIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC
ccccccccccEEEEEEccEEEEEEccccccccccHHHHHHHHHHHHHHHcccccEEEEEEcccccccccHHHHHHHHHHHHccHHHHHHHHHHHHHHHHHHHHccccEEEEEccEEEEccccccccccEEEEccccccccccccccccccccccccccccccccccEEEcccccccHHHHHHHccccEEEccccc
ccccHccccEEEEEEcccEEEEEEccHHHHHHHcHHHHHHHHHHHHHHHcccccEEEEEEccccEEEEcccHHHHHHccccccHHHHHHHHHHHHHHHHHHHHccccEEEEEEcEEcccHHHHHHHccEEEEcccccccccEEEEEEccccccHHHHHHHHHHHHHHHHHccccccHHHHHHHccccccccHHcc
mglkqssqIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYEswennsgvdfvvikgngrsfcaggdVVGAYRMLKEGRVEECKELFRTLYSFVYLVAtyskphvaimdgitmgggaGIAVHASYRLATEKTVFAMPEvligfhpdvgssyylsrlpghlgeylgltgatlsgEEMLFCGLATHYSLSAVC
mglkqssqiHVLVeeransrtvilnrPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC
MGLKQSSQIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC
*********HVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSL****
***********LVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC
********IHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC
*****SSQIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSLS*VC
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGLKQSSQIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query195 2.2.26 [Sep-21-2011]
Q8RXN4 409 3-hydroxyisobutyryl-CoA h yes no 0.943 0.449 0.592 7e-61
Q6NMB0 378 Probable 3-hydroxyisobuty no no 0.943 0.486 0.516 7e-54
Q9LKJ1 378 3-hydroxyisobutyryl-CoA h no no 0.969 0.5 0.518 1e-53
Q5XF59 401 3-hydroxyisobutyryl-CoA h no no 0.923 0.448 0.577 9e-53
Q1PEY5 378 Probable 3-hydroxyisobuty no no 0.943 0.486 0.5 1e-49
O74802 429 3-hydroxyisobutyryl-CoA h yes no 0.943 0.428 0.445 4e-43
Q5ZJ60 385 3-hydroxyisobutyryl-CoA h yes no 0.938 0.475 0.448 7e-41
Q8QZS1 385 3-hydroxyisobutyryl-CoA h yes no 0.917 0.464 0.447 1e-40
Q5XIE6 385 3-hydroxyisobutyryl-CoA h no no 0.948 0.480 0.433 1e-40
Q58EB4 382 3-hydroxyisobutyryl-CoA h yes no 0.917 0.468 0.453 2e-40
>sp|Q8RXN4|HIBC5_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial OS=Arabidopsis thaliana GN=At4g31810 PE=2 SV=1 Back     alignment and function desciption
 Score =  233 bits (593), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 134/184 (72%)

Query: 10  HVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAG 69
            VLVE +A SR  ILN P  LNAL+  MV  L + YESWE N  + FV++KG+G++FC+G
Sbjct: 42  QVLVEGKAKSRAAILNNPSSLNALSAPMVGRLKRLYESWEENPAISFVLMKGSGKTFCSG 101

Query: 70  GDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASY 129
            DV+  Y  + EG  EE K  F  LY FVYL  TY KP++AIMDG+TMG G GI++   +
Sbjct: 102 ADVLSLYHSINEGNTEESKLFFENLYKFVYLQGTYLKPNIAIMDGVTMGCGGGISLPGMF 161

Query: 130 RLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHY 189
           R+AT+KTV A PEV IGFHPD G+SYYLSRLPG+LGEYL LTG  L+G EM+ CGLATHY
Sbjct: 162 RVATDKTVLAHPEVQIGFHPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHY 221

Query: 190 SLSA 193
            L+A
Sbjct: 222 CLNA 225





Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 2EC: .EC: -
>sp|Q6NMB0|HIBC3_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 3 OS=Arabidopsis thaliana GN=At2g30660 PE=2 SV=1 Back     alignment and function description
>sp|Q9LKJ1|HIBC1_ARATH 3-hydroxyisobutyryl-CoA hydrolase 1 OS=Arabidopsis thaliana GN=CHY1 PE=1 SV=1 Back     alignment and function description
>sp|Q5XF59|HIBC4_ARATH 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial OS=Arabidopsis thaliana GN=At3g60510 PE=2 SV=1 Back     alignment and function description
>sp|Q1PEY5|HIBC2_ARATH Probable 3-hydroxyisobutyryl-CoA hydrolase 2 OS=Arabidopsis thaliana GN=At2g30650 PE=2 SV=1 Back     alignment and function description
>sp|O74802|HIBCH_SCHPO 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=ehd3 PE=3 SV=1 Back     alignment and function description
>sp|Q5ZJ60|HIBCH_CHICK 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Gallus gallus GN=HIBCH PE=2 SV=1 Back     alignment and function description
>sp|Q8QZS1|HIBCH_MOUSE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Mus musculus GN=Hibch PE=1 SV=1 Back     alignment and function description
>sp|Q5XIE6|HIBCH_RAT 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Rattus norvegicus GN=Hibch PE=1 SV=2 Back     alignment and function description
>sp|Q58EB4|HIBCH_DANRE 3-hydroxyisobutyryl-CoA hydrolase, mitochondrial OS=Danio rerio GN=hibch PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
224137860 363 predicted protein [Populus trichocarpa] 0.943 0.506 0.716 2e-73
255579623 403 catalytic, putative [Ricinus communis] g 0.938 0.454 0.699 9e-72
255541138 415 catalytic, putative [Ricinus communis] g 0.938 0.440 0.661 7e-70
357512815 401 3-hydroxyisobutyryl-CoA hydrolase-like p 0.953 0.463 0.634 7e-67
225430480 407 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.953 0.457 0.645 9e-67
225453474 405 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.943 0.454 0.641 5e-66
449531651264 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.943 0.696 0.630 6e-65
449455517 404 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.943 0.455 0.630 8e-65
297744387 438 unnamed protein product [Vitis vinifera] 0.948 0.422 0.637 3e-64
359495966 397 PREDICTED: 3-hydroxyisobutyryl-CoA hydro 0.938 0.460 0.644 5e-64
>gi|224137860|ref|XP_002326458.1| predicted protein [Populus trichocarpa] gi|222833780|gb|EEE72257.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  280 bits (717), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 134/187 (71%), Positives = 155/187 (82%), Gaps = 3/187 (1%)

Query: 10  HVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAG 69
            VLVE+  NSR +ILNRPHVLNAL T M   L K YESW N+  VDF+V+KGNGR+FCAG
Sbjct: 1   QVLVEKGTNSRVLILNRPHVLNALTTPMGHRLAKLYESWANDPVVDFIVLKGNGRAFCAG 60

Query: 70  GDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASY 129
           GDVV  YR++ EG++EECK+ FRT YSFV+L++TY KPHVAI+DGITMGGGAGI+VH S+
Sbjct: 61  GDVVRLYRLINEGKIEECKDCFRTFYSFVFLLSTYLKPHVAILDGITMGGGAGISVHGSF 120

Query: 130 RLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHL---GEYLGLTGATLSGEEMLFCGLA 186
           R+AT+KTVFA PEVLIG HPD G+SYYLSRLPG L   GEYLGLTG  LSGEEML CGLA
Sbjct: 121 RIATDKTVFATPEVLIGLHPDAGASYYLSRLPGCLGKDGEYLGLTGDMLSGEEMLACGLA 180

Query: 187 THYSLSA 193
           THYS +A
Sbjct: 181 THYSPNA 187




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255579623|ref|XP_002530652.1| catalytic, putative [Ricinus communis] gi|223529785|gb|EEF31721.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255541138|ref|XP_002511633.1| catalytic, putative [Ricinus communis] gi|223548813|gb|EEF50302.1| catalytic, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|357512815|ref|XP_003626696.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] gi|355520718|gb|AET01172.1| 3-hydroxyisobutyryl-CoA hydrolase-like protein [Medicago truncatula] Back     alignment and taxonomy information
>gi|225430480|ref|XP_002283319.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial [Vitis vinifera] gi|296082135|emb|CBI21140.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|225453474|ref|XP_002274299.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 1, mitochondrial [Vitis vinifera] gi|297734569|emb|CBI16620.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|449531651|ref|XP_004172799.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|449455517|ref|XP_004145499.1| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297744387|emb|CBI37361.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359495966|ref|XP_002266134.2| PREDICTED: 3-hydroxyisobutyryl-CoA hydrolase-like protein 2, mitochondrial [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query195
TAIR|locus:2116797 409 AT4G31810 [Arabidopsis thalian 0.938 0.447 0.595 1.6e-56
TAIR|locus:2152069 378 CHY1 "beta-hydroxyisobutyryl-C 0.969 0.5 0.518 1.5e-49
TAIR|locus:2054437 378 AT2G30660 [Arabidopsis thalian 0.943 0.486 0.516 6.7e-49
TAIR|locus:2054517 378 AT2G30650 [Arabidopsis thalian 0.943 0.486 0.5 7.9e-46
FB|FBgn0038326 386 CG5044 [Drosophila melanogaste 0.958 0.484 0.474 3.2e-42
WB|WBGene00017301 386 F09F7.4 [Caenorhabditis elegan 0.943 0.476 0.455 1.1e-41
ASPGD|ASPL0000005013 505 AN6844 [Emericella nidulans (t 0.938 0.362 0.473 1.6e-40
POMBASE|SPBC2D10.09 429 SPBC2D10.09 "3-hydroxyisobutyr 0.943 0.428 0.445 3.3e-40
RGD|1308392 385 Hibch "3-hydroxyisobutyryl-CoA 0.948 0.480 0.433 9.9e-39
UNIPROTKB|F1P188 385 HIBCH "3-hydroxyisobutyryl-CoA 0.933 0.472 0.451 1.3e-38
TAIR|locus:2116797 AT4G31810 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 582 (209.9 bits), Expect = 1.6e-56, P = 1.6e-56
 Identities = 109/183 (59%), Positives = 134/183 (73%)

Query:    11 VLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGG 70
             VLVE +A SR  ILN P  LNAL+  MV  L + YESWE N  + FV++KG+G++FC+G 
Sbjct:    43 VLVEGKAKSRAAILNNPSSLNALSAPMVGRLKRLYESWEENPAISFVLMKGSGKTFCSGA 102

Query:    71 DVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYR 130
             DV+  Y  + EG  EE K  F  LY FVYL  TY KP++AIMDG+TMG G GI++   +R
Sbjct:   103 DVLSLYHSINEGNTEESKLFFENLYKFVYLQGTYLKPNIAIMDGVTMGCGGGISLPGMFR 162

Query:   131 LATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLATHYS 190
             +AT+KTV A PEV IGFHPD G+SYYLSRLPG+LGEYL LTG  L+G EM+ CGLATHY 
Sbjct:   163 VATDKTVLAHPEVQIGFHPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLATHYC 222

Query:   191 LSA 193
             L+A
Sbjct:   223 LNA 225




GO:0003824 "catalytic activity" evidence=IEA
GO:0003860 "3-hydroxyisobutyryl-CoA hydrolase activity" evidence=ISS
GO:0006635 "fatty acid beta-oxidation" evidence=ISS
GO:0008152 "metabolic process" evidence=IEA
GO:0005739 "mitochondrion" evidence=IDA
GO:0009220 "pyrimidine ribonucleotide biosynthetic process" evidence=RCA
GO:0009640 "photomorphogenesis" evidence=RCA
GO:0009909 "regulation of flower development" evidence=RCA
GO:0010388 "cullin deneddylation" evidence=RCA
GO:0034968 "histone lysine methylation" evidence=RCA
TAIR|locus:2152069 CHY1 "beta-hydroxyisobutyryl-CoA hydrolase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054437 AT2G30660 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2054517 AT2G30650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
FB|FBgn0038326 CG5044 [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms
WB|WBGene00017301 F09F7.4 [Caenorhabditis elegans (taxid:6239)] Back     alignment and assigned GO terms
ASPGD|ASPL0000005013 AN6844 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
POMBASE|SPBC2D10.09 SPBC2D10.09 "3-hydroxyisobutyryl-CoA hydrolase (predicted)" [Schizosaccharomyces pombe (taxid:4896)] Back     alignment and assigned GO terms
RGD|1308392 Hibch "3-hydroxyisobutyryl-CoA hydrolase" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
UNIPROTKB|F1P188 HIBCH "3-hydroxyisobutyryl-CoA hydrolase, mitochondrial" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.2LOW CONFIDENCE prediction!
3rd Layer3.1.2.4LOW CONFIDENCE prediction!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
PLN02851 407 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrol 2e-93
PRK05617 342 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrol 2e-80
PLN02157 401 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrol 9e-76
PLN02874 379 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrol 2e-72
PLN02988 381 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrol 8e-70
cd06558195 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme 3e-52
COG1024257 COG1024, CaiD, Enoyl-CoA hydratase/carnithine race 7e-47
PRK06688259 PRK06688, PRK06688, enoyl-CoA hydratase; Provision 8e-28
pfam00378245 pfam00378, ECH, Enoyl-CoA hydratase/isomerase fami 7e-24
PRK07659260 PRK07659, PRK07659, enoyl-CoA hydratase; Provision 2e-22
PRK05809260 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydrata 2e-22
PRK05995262 PRK05995, PRK05995, enoyl-CoA hydratase; Provision 1e-21
PRK06072248 PRK06072, PRK06072, enoyl-CoA hydratase; Provision 5e-21
PRK05980260 PRK05980, PRK05980, enoyl-CoA hydratase; Provision 3e-20
PRK07260255 PRK07260, PRK07260, enoyl-CoA hydratase; Provision 1e-19
PRK09674255 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; 4e-18
PRK08138261 PRK08138, PRK08138, enoyl-CoA hydratase; Provision 5e-18
PRK06190258 PRK06190, PRK06190, enoyl-CoA hydratase; Provision 3e-17
PRK05862257 PRK05862, PRK05862, enoyl-CoA hydratase; Provision 9e-17
PRK07658257 PRK07658, PRK07658, enoyl-CoA hydratase; Provision 9e-17
TIGR02280256 TIGR02280, PaaB1, phenylacetate degradation probab 1e-16
PRK06142272 PRK06142, PRK06142, enoyl-CoA hydratase; Provision 4e-16
PRK07511260 PRK07511, PRK07511, enoyl-CoA hydratase; Provision 5e-16
PRK07657260 PRK07657, PRK07657, enoyl-CoA hydratase; Provision 1e-15
PRK05870249 PRK05870, PRK05870, enoyl-CoA hydratase; Provision 2e-15
PRK06494259 PRK06494, PRK06494, enoyl-CoA hydratase; Provision 2e-15
PRK08140262 PRK08140, PRK08140, enoyl-CoA hydratase; Provision 4e-15
PLN02664275 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-d 5e-15
PRK07509262 PRK07509, PRK07509, enoyl-CoA hydratase; Provision 3e-14
PRK06495257 PRK06495, PRK06495, enoyl-CoA hydratase; Provision 3e-14
PRK08258277 PRK08258, PRK08258, enoyl-CoA hydratase; Provision 4e-14
PLN02600251 PLN02600, PLN02600, enoyl-CoA hydratase 1e-13
PRK07468262 PRK07468, PRK07468, enoyl-CoA hydratase; Provision 1e-13
PRK06127269 PRK06127, PRK06127, enoyl-CoA hydratase; Provision 1e-13
PRK06144262 PRK06144, PRK06144, enoyl-CoA hydratase; Provision 2e-13
PRK07799263 PRK07799, PRK07799, enoyl-CoA hydratase; Provision 2e-13
PRK06210272 PRK06210, PRK06210, enoyl-CoA hydratase; Provision 5e-13
TIGR02441 737 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation c 7e-13
PLN02888265 PLN02888, PLN02888, enoyl-CoA hydratase 7e-13
PRK08260296 PRK08260, PRK08260, enoyl-CoA hydratase; Provision 7e-13
PRK07827260 PRK07827, PRK07827, enoyl-CoA hydratase; Provision 1e-12
PRK06023251 PRK06023, PRK06023, enoyl-CoA hydratase; Provision 2e-12
PRK08252254 PRK08252, PRK08252, enoyl-CoA hydratase; Provision 6e-12
PRK08150255 PRK08150, PRK08150, enoyl-CoA hydratase; Provision 2e-11
PRK08139266 PRK08139, PRK08139, enoyl-CoA hydratase; Validated 3e-11
PRK06143256 PRK06143, PRK06143, enoyl-CoA hydratase; Provision 5e-11
PRK07938249 PRK07938, PRK07938, enoyl-CoA hydratase; Provision 5e-11
PRK05674265 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydr 1e-10
PRK05981266 PRK05981, PRK05981, enoyl-CoA hydratase; Provision 1e-10
PRK07854243 PRK07854, PRK07854, enoyl-CoA hydratase; Provision 9e-10
PRK09120275 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydrata 2e-09
TIGR01929259 TIGR01929, menB, naphthoate synthase (dihydroxynap 3e-09
PRK03580261 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Pr 6e-09
TIGR02437 714 TIGR02437, FadB, fatty oxidation complex, alpha su 2e-08
PRK08272302 PRK08272, PRK08272, enoyl-CoA hydratase; Provision 3e-08
PRK12478298 PRK12478, PRK12478, enoyl-CoA hydratase; Provision 3e-08
PRK11154 708 PRK11154, fadJ, multifunctional fatty acid oxidati 6e-08
PRK09245266 PRK09245, PRK09245, enoyl-CoA hydratase; Provision 2e-07
COG0447282 COG0447, MenB, Dihydroxynaphthoic acid synthase [C 5e-07
PRK07327268 PRK07327, PRK07327, enoyl-CoA hydratase; Provision 6e-07
TIGR03200 360 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-car 8e-07
PRK05864276 PRK05864, PRK05864, enoyl-CoA hydratase; Provision 2e-06
PRK07112255 PRK07112, PRK07112, polyketide biosynthesis enoyl- 3e-06
TIGR03210256 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hyd 3e-06
TIGR02440 699 TIGR02440, FadJ, fatty oxidation complex, alpha su 5e-06
TIGR03189251 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecar 5e-06
PRK08259254 PRK08259, PRK08259, enoyl-CoA hydratase; Provision 6e-06
PRK05869222 PRK05869, PRK05869, enoyl-CoA hydratase; Validated 6e-06
PRK08290288 PRK08290, PRK08290, enoyl-CoA hydratase; Provision 1e-04
PRK06563255 PRK06563, PRK06563, enoyl-CoA hydratase; Provision 2e-04
PRK07110249 PRK07110, PRK07110, polyketide biosynthesis enoyl- 5e-04
PRK11730 715 PRK11730, fadB, multifunctional fatty acid oxidati 7e-04
PRK08321302 PRK08321, PRK08321, naphthoate synthase; Validated 8e-04
PLN02921327 PLN02921, PLN02921, naphthoate synthase 0.002
PRK07396273 PRK07396, PRK07396, dihydroxynaphthoic acid synthe 0.002
PRK09076258 PRK09076, PRK09076, enoyl-CoA hydratase; Provision 0.004
>gnl|CDD|178443 PLN02851, PLN02851, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
 Score =  277 bits (710), Expect = 2e-93
 Identities = 119/186 (63%), Positives = 140/186 (75%)

Query: 8   QIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFC 67
           Q  VLVE RA SR  ILNRP  LNAL   MVA L + YESWE N  + FV++KG+GR+FC
Sbjct: 41  QDQVLVEGRAKSRAAILNRPSSLNALTIPMVARLKRLYESWEENPDIGFVLMKGSGRAFC 100

Query: 68  AGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHA 127
           +G DVV  Y ++ EG VEECK  F  LY FVYL  TY KP+VAIMDGITMG GAGI++  
Sbjct: 101 SGADVVSLYHLINEGNVEECKLFFENLYKFVYLQGTYLKPNVAIMDGITMGCGAGISIPG 160

Query: 128 SYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCGLAT 187
            +R+ T+KTVFA PEV +GFHPD G+SYYLSRLPG+LGEYL LTG  L+G EM+ CGLAT
Sbjct: 161 MFRVVTDKTVFAHPEVQMGFHPDAGASYYLSRLPGYLGEYLALTGQKLNGVEMIACGLAT 220

Query: 188 HYSLSA 193
           HY L+A
Sbjct: 221 HYCLNA 226


Length = 407

>gnl|CDD|235533 PRK05617, PRK05617, 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>gnl|CDD|177817 PLN02157, PLN02157, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178462 PLN02874, PLN02874, 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>gnl|CDD|178568 PLN02988, PLN02988, 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|119339 cd06558, crotonase-like, Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>gnl|CDD|223955 COG1024, CaiD, Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|235852 PRK06688, PRK06688, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|201191 pfam00378, ECH, Enoyl-CoA hydratase/isomerase family Back     alignment and domain information
>gnl|CDD|236073 PRK07659, PRK07659, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180270 PRK05809, PRK05809, 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>gnl|CDD|235664 PRK05995, PRK05995, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168377 PRK06072, PRK06072, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180335 PRK05980, PRK05980, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180910 PRK07260, PRK07260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|182026 PRK09674, PRK09674, enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>gnl|CDD|236162 PRK08138, PRK08138, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235733 PRK06190, PRK06190, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180295 PRK05862, PRK05862, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181070 PRK07658, PRK07658, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131333 TIGR02280, PaaB1, phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>gnl|CDD|235714 PRK06142, PRK06142, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181009 PRK07511, PRK07511, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181069 PRK07657, PRK07657, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180298 PRK05870, PRK05870, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180591 PRK06494, PRK06494, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236163 PRK08140, PRK08140, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178269 PLN02664, PLN02664, enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>gnl|CDD|181008 PRK07509, PRK07509, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168580 PRK06495, PRK06495, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181329 PRK08258, PRK08258, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|178210 PLN02600, PLN02600, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|180987 PRK07468, PRK07468, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235705 PRK06127, PRK06127, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180424 PRK06144, PRK06144, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181122 PRK07799, PRK07799, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180472 PRK06210, PRK06210, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|131494 TIGR02441, fa_ox_alpha_mit, fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>gnl|CDD|215480 PLN02888, PLN02888, enoyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|236206 PRK08260, PRK08260, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236109 PRK07827, PRK07827, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168351 PRK06023, PRK06023, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181325 PRK08252, PRK08252, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181254 PRK08150, PRK08150, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181249 PRK08139, PRK08139, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|180423 PRK06143, PRK06143, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|181174 PRK07938, PRK07938, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|168168 PRK05674, PRK05674, gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|235661 PRK05981, PRK05981, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236115 PRK07854, PRK07854, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236383 PRK09120, PRK09120, p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
>gnl|CDD|200143 TIGR01929, menB, naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>gnl|CDD|179599 PRK03580, PRK03580, carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>gnl|CDD|131490 TIGR02437, FadB, fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>gnl|CDD|236213 PRK08272, PRK08272, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|183548 PRK12478, PRK12478, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|236864 PRK11154, fadJ, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|181723 PRK09245, PRK09245, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|223524 COG0447, MenB, Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|235991 PRK07327, PRK07327, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|132244 TIGR03200, dearomat_oah, 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|168278 PRK05864, PRK05864, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235938 PRK07112, PRK07112, polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|132254 TIGR03210, badI, 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>gnl|CDD|131493 TIGR02440, FadJ, fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>gnl|CDD|132233 TIGR03189, dienoyl_CoA_hyt, cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>gnl|CDD|236205 PRK08259, PRK08259, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235632 PRK05869, PRK05869, enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|236220 PRK08290, PRK08290, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|180625 PRK06563, PRK06563, enoyl-CoA hydratase; Provisional Back     alignment and domain information
>gnl|CDD|235936 PRK07110, PRK07110, polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>gnl|CDD|183293 PRK11730, fadB, multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>gnl|CDD|181386 PRK08321, PRK08321, naphthoate synthase; Validated Back     alignment and domain information
>gnl|CDD|178509 PLN02921, PLN02921, naphthoate synthase Back     alignment and domain information
>gnl|CDD|180958 PRK07396, PRK07396, dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>gnl|CDD|236373 PRK09076, PRK09076, enoyl-CoA hydratase; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 195
PRK09120275 p-hydroxycinnamoyl CoA hydratase/lyase; Validated 100.0
PRK05980260 enoyl-CoA hydratase; Provisional 100.0
PRK06142272 enoyl-CoA hydratase; Provisional 100.0
PRK07260255 enoyl-CoA hydratase; Provisional 100.0
PRK08140262 enoyl-CoA hydratase; Provisional 100.0
KOG1680290 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
PRK05862257 enoyl-CoA hydratase; Provisional 100.0
PRK07327268 enoyl-CoA hydratase; Provisional 100.0
PRK08150255 enoyl-CoA hydratase; Provisional 100.0
PRK07799263 enoyl-CoA hydratase; Provisional 100.0
PRK08258277 enoyl-CoA hydratase; Provisional 100.0
PRK09076258 enoyl-CoA hydratase; Provisional 100.0
PRK06190258 enoyl-CoA hydratase; Provisional 100.0
PRK06127269 enoyl-CoA hydratase; Provisional 100.0
PRK05995262 enoyl-CoA hydratase; Provisional 100.0
PRK09674255 enoyl-CoA hydratase-isomerase; Provisional 100.0
PRK05674265 gamma-carboxygeranoyl-CoA hydratase; Validated 100.0
TIGR03210256 badI 2-ketocyclohexanecarboxyl-CoA hydrolase. Memb 100.0
PRK05809260 3-hydroxybutyryl-CoA dehydratase; Validated 100.0
PRK06144262 enoyl-CoA hydratase; Provisional 100.0
PRK07658257 enoyl-CoA hydratase; Provisional 100.0
PRK08138261 enoyl-CoA hydratase; Provisional 100.0
PRK07511260 enoyl-CoA hydratase; Provisional 100.0
PRK06143256 enoyl-CoA hydratase; Provisional 100.0
PRK08139266 enoyl-CoA hydratase; Validated 100.0
PRK09245266 enoyl-CoA hydratase; Provisional 100.0
PRK06563255 enoyl-CoA hydratase; Provisional 100.0
PRK05864276 enoyl-CoA hydratase; Provisional 100.0
PRK06023251 enoyl-CoA hydratase; Provisional 100.0
TIGR01929259 menB naphthoate synthase (dihydroxynaphthoic acid 100.0
PRK08260296 enoyl-CoA hydratase; Provisional 100.0
TIGR02280256 PaaB1 phenylacetate degradation probable enoyl-CoA 100.0
PRK05981266 enoyl-CoA hydratase; Provisional 100.0
PLN02664275 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA 100.0
PRK07657260 enoyl-CoA hydratase; Provisional 100.0
PRK06688259 enoyl-CoA hydratase; Provisional 100.0
COG1024257 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipi 100.0
PRK06210272 enoyl-CoA hydratase; Provisional 100.0
PRK05869222 enoyl-CoA hydratase; Validated 100.0
PRK07468262 enoyl-CoA hydratase; Provisional 100.0
PRK05870249 enoyl-CoA hydratase; Provisional 100.0
PRK06494259 enoyl-CoA hydratase; Provisional 100.0
PF00378245 ECH: Enoyl-CoA hydratase/isomerase family; InterPr 100.0
PLN02157 401 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK08252254 enoyl-CoA hydratase; Provisional 100.0
PRK07396273 dihydroxynaphthoic acid synthetase; Validated 100.0
PLN02888265 enoyl-CoA hydratase 100.0
PRK11423261 methylmalonyl-CoA decarboxylase; Provisional 100.0
PRK07659260 enoyl-CoA hydratase; Provisional 100.0
PLN02600251 enoyl-CoA hydratase 100.0
PRK07509262 enoyl-CoA hydratase; Provisional 100.0
PRK07110249 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PRK08259254 enoyl-CoA hydratase; Provisional 100.0
PLN02988 381 3-hydroxyisobutyryl-CoA hydrolase 100.0
PRK05617 342 3-hydroxyisobutyryl-CoA hydrolase; Provisional 100.0
PRK03580261 carnitinyl-CoA dehydratase; Provisional 100.0
PRK07827260 enoyl-CoA hydratase; Provisional 100.0
PRK06495257 enoyl-CoA hydratase; Provisional 100.0
TIGR03189251 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hy 100.0
PRK08788287 enoyl-CoA hydratase; Validated 100.0
PRK07854243 enoyl-CoA hydratase; Provisional 100.0
PLN02874 379 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK08290288 enoyl-CoA hydratase; Provisional 100.0
PLN02921327 naphthoate synthase 100.0
PRK08272302 enoyl-CoA hydratase; Provisional 100.0
PLN03214278 probable enoyl-CoA hydratase/isomerase; Provisiona 100.0
PRK07112255 polyketide biosynthesis enoyl-CoA hydratase; Valid 100.0
PRK06072248 enoyl-CoA hydratase; Provisional 100.0
PLN02851 407 3-hydroxyisobutyryl-CoA hydrolase-like protein 100.0
PRK08321302 naphthoate synthase; Validated 100.0
TIGR03200 360 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hy 100.0
PRK07938249 enoyl-CoA hydratase; Provisional 100.0
PRK06213229 enoyl-CoA hydratase; Provisional 100.0
PRK12478298 enoyl-CoA hydratase; Provisional 100.0
PLN02267239 enoyl-CoA hydratase/isomerase family protein 100.0
PRK11730 715 fadB multifunctional fatty acid oxidation complex 100.0
cd06558195 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hy 100.0
TIGR02437 714 FadB fatty oxidation complex, alpha subunit FadB. 100.0
TIGR02441 737 fa_ox_alpha_mit fatty acid oxidation complex, alph 100.0
TIGR03222 546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK11154 708 fadJ multifunctional fatty acid oxidation complex 100.0
TIGR02440 699 FadJ fatty oxidation complex, alpha subunit FadJ. 100.0
TIGR03222546 benzo_boxC benzoyl-CoA-dihydrodiol lyase. In the p 100.0
PRK08184 550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
KOG0016266 consensus Enoyl-CoA hydratase/isomerase [Lipid tra 100.0
PRK08184550 benzoyl-CoA-dihydrodiol lyase; Provisional 100.0
KOG1679291 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
KOG1681292 consensus Enoyl-CoA isomerase [Lipid transport and 100.0
COG0447282 MenB Dihydroxynaphthoic acid synthase [Coenzyme me 100.0
KOG1684 401 consensus Enoyl-CoA hydratase [Lipid transport and 100.0
KOG1682287 consensus Enoyl-CoA isomerase [Lipid transport and 100.0
cd07020187 Clp_protease_NfeD_1 Nodulation formation efficienc 99.87
cd07014177 S49_SppA Signal peptide peptidase A. Signal peptid 99.86
cd07019211 S49_SppA_1 Signal peptide peptidase A (SppA), a se 99.73
cd00394161 Clp_protease_like Caseinolytic protease (ClpP) is 99.69
cd07022214 S49_Sppa_36K_type Signal peptide peptidase A (SppA 99.64
TIGR00705584 SppA_67K signal peptide peptidase SppA, 67K type. 99.61
cd07023208 S49_Sppa_N_C Signal peptide peptidase A (SppA), a 99.61
cd07016160 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP- 99.59
TIGR00706207 SppA_dom signal peptide peptidase SppA, 36K type. 99.53
cd07021178 Clp_protease_NfeD_like Nodulation formation effici 99.51
cd07018222 S49_SppA_67K_type Signal peptide peptidase A (SppA 99.41
cd07015172 Clp_protease_NfeD Nodulation formation efficiency 99.16
cd07013162 S14_ClpP Caseinolytic protease (ClpP) is an ATP-de 99.0
PRK00277200 clpP ATP-dependent Clp protease proteolytic subuni 98.94
PRK12319256 acetyl-CoA carboxylase subunit alpha; Provisional 98.88
PRK10949 618 protease 4; Provisional 98.87
PRK12553207 ATP-dependent Clp protease proteolytic subunit; Re 98.87
CHL00198322 accA acetyl-CoA carboxylase carboxyltransferase al 98.84
KOG1683 380 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA 98.81
cd07017171 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP- 98.79
PF00574182 CLP_protease: Clp protease; InterPro: IPR001907 In 98.74
TIGR00513316 accA acetyl-CoA carboxylase, carboxyl transferase, 98.72
PRK14512197 ATP-dependent Clp protease proteolytic subunit; Pr 98.71
PRK05724319 acetyl-CoA carboxylase carboxyltransferase subunit 98.71
PLN03230431 acetyl-coenzyme A carboxylase carboxyl transferase 98.71
PLN03229 762 acetyl-coenzyme A carboxylase carboxyl transferase 98.65
CHL00028200 clpP ATP-dependent Clp protease proteolytic subuni 98.61
PRK11778330 putative inner membrane peptidase; Provisional 98.59
TIGR00493191 clpP ATP-dependent Clp protease, proteolytic subun 98.58
PF01972285 SDH_sah: Serine dehydrogenase proteinase; InterPro 98.53
COG0616317 SppA Periplasmic serine proteases (ClpP class) [Po 98.5
TIGR03133274 malonate_beta malonate decarboxylase, beta subunit 98.44
PRK14514221 ATP-dependent Clp protease proteolytic subunit; Pr 98.4
PRK14513201 ATP-dependent Clp protease proteolytic subunit; Pr 98.39
PRK12551196 ATP-dependent Clp protease proteolytic subunit; Re 98.38
PRK07189301 malonate decarboxylase subunit beta; Reviewed 98.3
TIGR03134238 malonate_gamma malonate decarboxylase, gamma subun 98.25
CHL00174296 accD acetyl-CoA carboxylase beta subunit; Reviewed 98.15
PRK05654292 acetyl-CoA carboxylase subunit beta; Validated 98.07
TIGR00515285 accD acetyl-CoA carboxylase, carboxyl transferase, 98.04
PF01039 493 Carboxyl_trans: Carboxyl transferase domain; Inter 97.98
COG0740200 ClpP Protease subunit of ATP-dependent Clp proteas 97.98
COG1030 436 NfeD Membrane-bound serine protease (ClpP class) [ 97.93
TIGR00705 584 SppA_67K signal peptide peptidase SppA, 67K type. 97.9
PF01343154 Peptidase_S49: Peptidase family S49 peptidase clas 97.83
TIGR01117512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.74
COG0825317 AccA Acetyl-CoA carboxylase alpha subunit [Lipid m 97.63
PRK12552222 ATP-dependent Clp protease-like protein; Reviewed 97.62
COG0777294 AccD Acetyl-CoA carboxylase beta subunit [Lipid me 97.57
TIGR01117 512 mmdA methylmalonyl-CoA decarboxylase alpha subunit 97.42
PLN02820 569 3-methylcrotonyl-CoA carboxylase, beta chain 97.4
PRK10949 618 protease 4; Provisional 96.86
COG4799 526 Acetyl-CoA carboxylase, carboxyltransferase compon 95.9
PLN02820569 3-methylcrotonyl-CoA carboxylase, beta chain 95.86
KOG0840275 consensus ATP-dependent Clp protease, proteolytic 95.23
PF01039493 Carboxyl_trans: Carboxyl transferase domain; Inter 95.0
KOG0540536 consensus 3-Methylcrotonyl-CoA carboxylase, non-bi 84.76
COG0074293 SucD Succinyl-CoA synthetase, alpha subunit [Energ 82.63
smart0025038 PLEC Plectin repeat. 81.42
>PRK09120 p-hydroxycinnamoyl CoA hydratase/lyase; Validated Back     alignment and domain information
Probab=100.00  E-value=7.4e-50  Score=322.39  Aligned_cols=194  Identities=24%  Similarity=0.326  Sum_probs=172.3

Q ss_pred             CCCCCCCcceEEEEEeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEEeCCCceeccccchhHHHhhh
Q 041986            1 MGLKQSSQIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLK   80 (195)
Q Consensus         1 m~~~~~~~~~v~~~~~~~v~~i~l~~p~~~N~~~~~~~~~l~~~l~~~~~~~~~~~vvl~~~g~~F~~G~dl~~~~~~~~   80 (195)
                      |+|... |+++.++++++|++|+||||++.|++|.+++.+|.++++.++.|+++++|||||.|+.||+|.|++++.....
T Consensus         1 ~~~~~~-~~~i~~~~~~~va~itlnrp~~~Nal~~~m~~el~~al~~~~~d~~vr~vVl~g~g~~F~aG~Dl~~~~~~~~   79 (275)
T PRK09120          1 MSYENR-WDTVKVEVEDGIAWVTLNRPEKRNAMSPTLNREMIDVLDALEFDDDAGVLVLTGAGDAWSAGMDLKEYFRETD   79 (275)
T ss_pred             CCcccc-cccEEEEEECCEEEEEecCcccccCCCHHHHHHHHHHHHHHHhCCCceEEEEEcCCCceecCcCHHHHhhccc
Confidence            566555 8889999999999999999999999999999999999999999999999999999999999999998753221


Q ss_pred             cccHHHHHHHHHHHHHHHHHHhhCCCcEEEEEcchhcchhhHHhhhcCEEEEeCCeEEecCcccccccCCCchhhHhhhc
Q 041986           81 EGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRL  160 (195)
Q Consensus        81 ~~~~~~~~~~~~~~~~l~~~l~~~~~p~Iaav~G~~~g~G~~l~l~~D~~ia~~~a~~~~pe~~~G~~p~~g~~~~l~r~  160 (195)
                      ...........+....++.++..+||||||+|||+|+|+|++|+++||+||++++++|++||+++|++|++|++++++|+
T Consensus        80 ~~~~~~~~~~~~~~~~~~~~l~~~~kPvIAav~G~a~GgG~~lal~cD~~ia~~~a~f~~pe~~~Gl~p~~g~~~~l~~~  159 (275)
T PRK09120         80 AQPEILQERIRREAYGWWRRLRWYQKPTIAMVNGWCFGGGFSPLVACDLAIAADEAQFGLSEINWGIPPGGGVSKAMADT  159 (275)
T ss_pred             cchhHHHHHHHHHHHHHHHHHHhCCCCEEEEEcCEEechhHHHHHhCCEEEEeCCcEecCCccccCCCCCcchHHHHHHH
Confidence            11111112233345567888999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ch-HHHHHHhhcCCCCCHHHHHhcCccccccCCCCC
Q 041986          161 PG-HLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC  195 (195)
Q Consensus       161 ~g-~~a~~l~l~g~~~~a~ea~~~Glv~~vv~~~~l  195 (195)
                      +| ..+++++++|++++|+||+++|||++|||++++
T Consensus       160 iG~~~a~~llltg~~~~A~eA~~~Glv~~vv~~~~l  195 (275)
T PRK09120        160 VGHRDALYYIMTGETFTGRKAAEMGLVNESVPLAQL  195 (275)
T ss_pred             cCHHHHHHHHhcCCccCHHHHHHcCCcceecCHHHH
Confidence            99 899999999999999999999999999998764



>PRK05980 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06142 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08140 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>KOG1680 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>PRK05862 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07327 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08150 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07799 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08258 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09076 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06190 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06127 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05995 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK09674 enoyl-CoA hydratase-isomerase; Provisional Back     alignment and domain information
>PRK05674 gamma-carboxygeranoyl-CoA hydratase; Validated Back     alignment and domain information
>TIGR03210 badI 2-ketocyclohexanecarboxyl-CoA hydrolase Back     alignment and domain information
>PRK05809 3-hydroxybutyryl-CoA dehydratase; Validated Back     alignment and domain information
>PRK06144 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07658 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08138 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07511 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06143 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK08139 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK09245 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06563 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05864 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06023 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR01929 menB naphthoate synthase (dihydroxynaphthoic acid synthetase) Back     alignment and domain information
>PRK08260 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR02280 PaaB1 phenylacetate degradation probable enoyl-CoA hydratase paaB Back     alignment and domain information
>PRK05981 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02664 enoyl-CoA hydratase/delta3,5-delta2,4-dienoyl-CoA isomerase Back     alignment and domain information
>PRK07657 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06688 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>COG1024 CaiD Enoyl-CoA hydratase/carnithine racemase [Lipid metabolism] Back     alignment and domain information
>PRK06210 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05869 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07468 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK05870 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06494 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PF00378 ECH: Enoyl-CoA hydratase/isomerase family; InterPro: IPR001753 The crotonase superfamily is comprised of mechanistically diverse proteins that share a conserved trimeric quaternary structure (sometimes a hexamer consisting of a dimer of trimers), the core of which consists of 4 turns of a (beta/beta/alpha)n superhelix Back     alignment and domain information
>PLN02157 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08252 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07396 dihydroxynaphthoic acid synthetase; Validated Back     alignment and domain information
>PLN02888 enoyl-CoA hydratase Back     alignment and domain information
>PRK11423 methylmalonyl-CoA decarboxylase; Provisional Back     alignment and domain information
>PRK07659 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02600 enoyl-CoA hydratase Back     alignment and domain information
>PRK07509 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK07110 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK08259 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02988 3-hydroxyisobutyryl-CoA hydrolase Back     alignment and domain information
>PRK05617 3-hydroxyisobutyryl-CoA hydrolase; Provisional Back     alignment and domain information
>PRK03580 carnitinyl-CoA dehydratase; Provisional Back     alignment and domain information
>PRK07827 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06495 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>TIGR03189 dienoyl_CoA_hyt cyclohexa-1,5-dienecarbonyl-CoA hydratase Back     alignment and domain information
>PRK08788 enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK07854 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02874 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08290 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02921 naphthoate synthase Back     alignment and domain information
>PRK08272 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN03214 probable enoyl-CoA hydratase/isomerase; Provisional Back     alignment and domain information
>PRK07112 polyketide biosynthesis enoyl-CoA hydratase; Validated Back     alignment and domain information
>PRK06072 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02851 3-hydroxyisobutyryl-CoA hydrolase-like protein Back     alignment and domain information
>PRK08321 naphthoate synthase; Validated Back     alignment and domain information
>TIGR03200 dearomat_oah 6-oxocyclohex-1-ene-1-carbonyl-CoA hydrolase Back     alignment and domain information
>PRK07938 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK06213 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PRK12478 enoyl-CoA hydratase; Provisional Back     alignment and domain information
>PLN02267 enoyl-CoA hydratase/isomerase family protein Back     alignment and domain information
>PRK11730 fadB multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>cd06558 crotonase-like Crotonase/Enoyl-Coenzyme A (CoA) hydratase superfamily Back     alignment and domain information
>TIGR02437 FadB fatty oxidation complex, alpha subunit FadB Back     alignment and domain information
>TIGR02441 fa_ox_alpha_mit fatty acid oxidation complex, alpha subunit, mitochondrial Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK11154 fadJ multifunctional fatty acid oxidation complex subunit alpha; Reviewed Back     alignment and domain information
>TIGR02440 FadJ fatty oxidation complex, alpha subunit FadJ Back     alignment and domain information
>TIGR03222 benzo_boxC benzoyl-CoA-dihydrodiol lyase Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>KOG0016 consensus Enoyl-CoA hydratase/isomerase [Lipid transport and metabolism] Back     alignment and domain information
>PRK08184 benzoyl-CoA-dihydrodiol lyase; Provisional Back     alignment and domain information
>KOG1679 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1681 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>COG0447 MenB Dihydroxynaphthoic acid synthase [Coenzyme metabolism] Back     alignment and domain information
>KOG1684 consensus Enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>KOG1682 consensus Enoyl-CoA isomerase [Lipid transport and metabolism] Back     alignment and domain information
>cd07020 Clp_protease_NfeD_1 Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07014 S49_SppA Signal peptide peptidase A Back     alignment and domain information
>cd07019 S49_SppA_1 Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd00394 Clp_protease_like Caseinolytic protease (ClpP) is an ATP-dependent protease Back     alignment and domain information
>cd07022 S49_Sppa_36K_type Signal peptide peptidase A (SppA) 36K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>cd07023 S49_Sppa_N_C Signal peptide peptidase A (SppA), a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07016 S14_ClpP_1 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>TIGR00706 SppA_dom signal peptide peptidase SppA, 36K type Back     alignment and domain information
>cd07021 Clp_protease_NfeD_like Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07018 S49_SppA_67K_type Signal peptide peptidase A (SppA) 67K type, a serine protease, has catalytic Ser-Lys dyad Back     alignment and domain information
>cd07015 Clp_protease_NfeD Nodulation formation efficiency D (NfeD) is a membrane-bound ClpP-class protease Back     alignment and domain information
>cd07013 S14_ClpP Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PRK00277 clpP ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK12319 acetyl-CoA carboxylase subunit alpha; Provisional Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>PRK12553 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>CHL00198 accA acetyl-CoA carboxylase carboxyltransferase alpha subunit; Provisional Back     alignment and domain information
>KOG1683 consensus Hydroxyacyl-CoA dehydrogenase/enoyl-CoA hydratase [Lipid transport and metabolism] Back     alignment and domain information
>cd07017 S14_ClpP_2 Caseinolytic protease (ClpP) is an ATP-dependent, highly conserved serine protease Back     alignment and domain information
>PF00574 CLP_protease: Clp protease; InterPro: IPR001907 In the MEROPS database peptidases and peptidase homologues are grouped into clans and families Back     alignment and domain information
>TIGR00513 accA acetyl-CoA carboxylase, carboxyl transferase, alpha subunit Back     alignment and domain information
>PRK14512 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK05724 acetyl-CoA carboxylase carboxyltransferase subunit alpha; Validated Back     alignment and domain information
>PLN03230 acetyl-coenzyme A carboxylase carboxyl transferase; Provisional Back     alignment and domain information
>PLN03229 acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; Provisional Back     alignment and domain information
>CHL00028 clpP ATP-dependent Clp protease proteolytic subunit Back     alignment and domain information
>PRK11778 putative inner membrane peptidase; Provisional Back     alignment and domain information
>TIGR00493 clpP ATP-dependent Clp protease, proteolytic subunit ClpP Back     alignment and domain information
>PF01972 SDH_sah: Serine dehydrogenase proteinase; InterPro: IPR002825 This family of archaebacterial proteins, formerly known as DUF114, has been found to be a serine dehydrogenase proteinase distantly related to ClpP proteinases that belong to the serine proteinase superfamily Back     alignment and domain information
>COG0616 SppA Periplasmic serine proteases (ClpP class) [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>TIGR03133 malonate_beta malonate decarboxylase, beta subunit Back     alignment and domain information
>PRK14514 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK14513 ATP-dependent Clp protease proteolytic subunit; Provisional Back     alignment and domain information
>PRK12551 ATP-dependent Clp protease proteolytic subunit; Reviewed Back     alignment and domain information
>PRK07189 malonate decarboxylase subunit beta; Reviewed Back     alignment and domain information
>TIGR03134 malonate_gamma malonate decarboxylase, gamma subunit Back     alignment and domain information
>CHL00174 accD acetyl-CoA carboxylase beta subunit; Reviewed Back     alignment and domain information
>PRK05654 acetyl-CoA carboxylase subunit beta; Validated Back     alignment and domain information
>TIGR00515 accD acetyl-CoA carboxylase, carboxyl transferase, beta subunit Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>COG0740 ClpP Protease subunit of ATP-dependent Clp proteases [Posttranslational modification, protein turnover, chaperones / Intracellular trafficking and secretion] Back     alignment and domain information
>COG1030 NfeD Membrane-bound serine protease (ClpP class) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00705 SppA_67K signal peptide peptidase SppA, 67K type Back     alignment and domain information
>PF01343 Peptidase_S49: Peptidase family S49 peptidase classification Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>COG0825 AccA Acetyl-CoA carboxylase alpha subunit [Lipid metabolism] Back     alignment and domain information
>PRK12552 ATP-dependent Clp protease-like protein; Reviewed Back     alignment and domain information
>COG0777 AccD Acetyl-CoA carboxylase beta subunit [Lipid metabolism] Back     alignment and domain information
>TIGR01117 mmdA methylmalonyl-CoA decarboxylase alpha subunit Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>PRK10949 protease 4; Provisional Back     alignment and domain information
>COG4799 Acetyl-CoA carboxylase, carboxyltransferase component (subunits alpha and beta) [Lipid metabolism] Back     alignment and domain information
>PLN02820 3-methylcrotonyl-CoA carboxylase, beta chain Back     alignment and domain information
>KOG0840 consensus ATP-dependent Clp protease, proteolytic subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01039 Carboxyl_trans: Carboxyl transferase domain; InterPro: IPR000022 Members in this domain include biotin dependent carboxylases [, ] Back     alignment and domain information
>KOG0540 consensus 3-Methylcrotonyl-CoA carboxylase, non-biotin containing subunit/Acetyl-CoA carboxylase carboxyl transferase, subunit beta [Amino acid transport and metabolism; Lipid transport and metabolism] Back     alignment and domain information
>COG0074 SucD Succinyl-CoA synthetase, alpha subunit [Energy production and conversion] Back     alignment and domain information
>smart00250 PLEC Plectin repeat Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
3bpt_A 363 Crystal Structure Of Human Beta-Hydroxyisobutyryl-C 2e-35
4hdt_A 353 Crystal Structure Of A Carnitinyl-Coa Dehydratase F 5e-29
4j2u_A 365 Crystal Structure Of An Enoyl-coa Hydratase From Rh 5e-27
3ju1_A 407 Crystal Structure Of Enoyl-Coa HydrataseISOMERASE F 4e-26
3rsi_A265 The Structure Of A Putative Enoyl-Coa HydrataseISOM 2e-17
2hw5_A286 The Crystal Structure Of Human Enoyl-Coenzyme A (Co 4e-16
2pbp_A258 Crystal Structure Of Enoyl-Coa Hydrates Subunit I ( 2e-15
1dub_A261 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 2e-15
1ey3_A258 Structure Of Enoyl-Coa Hydratase Complexed With The 2e-15
1mj3_A260 Crystal Structure Analysis Of Rat Enoyl-Coa Hydrata 2e-15
3h81_A278 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 1e-13
3q0j_A258 Crystal Structure Of The Mycobacterium Tuberculosis 1e-13
3pzk_A257 Crystal Structure Of The Mycobacterium Tuberculosis 2e-13
4fzw_A258 Crystal Structure Of The Paaf-paag Hydratase-isomer 2e-13
3qmj_A256 Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 Fr 3e-13
2ej5_A257 Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydr 5e-13
3moy_A263 Crystal Structure Of Probable Enoyl-Coa Hydratase F 9e-13
3r9t_A267 Structure Of Echa1_1 From Mycobacterium Paratubercu 2e-12
3r9s_A267 Structure Of A Carnitinyl-Coa Dehydratase From Myco 2e-12
3r0o_A273 Crystal Structure Of Carnitinyl-Coa Hydratase From 2e-12
3hrx_A254 Crystal Structure Of Phenylacetic Acid Degradation 5e-12
3tlf_A274 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 1e-11
1uiy_A253 Crystal Structure Of Enoyl-Coa Hydratase From Therm 2e-11
4f47_A278 The Structure Of Enoyl-Coa Hydratase Echa19 From My 2e-11
3qka_A261 Crystal Structure Of Enoyl-Coa Hydratase Echa5 From 3e-11
3qyr_A253 Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 M 2e-10
3p85_A270 Crystal Structure Enoyl-Coa Hydratase From Mycobact 2e-10
3qxz_A265 Crystal Structure Of A Probable Enoyl-Coa Hydratase 2e-10
3pea_A261 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 3e-10
3myb_A286 Crystal Structure Of Enoyl-Coa Hydratase Mycobacter 3e-10
2vsu_A276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 3e-10
2vsu_C275 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 3e-10
3qxi_A265 Crystal Structure Of Enoyl-Coa Hydratase Echa1 From 3e-10
2j5i_I276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 4e-10
2vsu_F276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 4e-10
2j5i_B276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 4e-10
2vsu_E276 A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase 4e-10
2vss_F276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 4e-10
2vss_E276 Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In C 4e-10
1dci_A275 Dienoyl-Coa Isomerase Length = 275 5e-10
3fdu_A266 Crystal Structure Of A Putative Enoyl-Coa Hydratase 1e-09
2j5i_A276 Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase 1e-09
3oc7_A267 Crystal Structure Of An Enoyl-Coa Hydratase From My 2e-09
2vre_A296 Crystal Structure Of Human Peroxisomal Delta3,5, De 2e-09
3trr_A256 Crystal Structure Of A Probable Enoyl-Coa Hydratase 3e-09
3p5m_A255 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 3e-09
3pe8_A256 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 8e-09
3rrv_A276 Crystal Structure Of An Enoyl-Coa HydrataseISOMERAS 1e-08
2fw2_A260 Catalytic Domain Of Cdy Length = 260 1e-08
2fbm_A291 Acetyltransferase Domain Of Cdy1 Length = 291 2e-08
3sll_A290 Crystal Structure Of A Probable Enoyl-Coa Hydratase 4e-08
2uzf_A273 Crystal Structure Of Staphylococcus Aureus 1,4-Dihy 5e-08
4fzw_C274 Crystal Structure Of The Paaf-paag Hydratase-isomer 1e-07
3he2_A264 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 1e-07
2gtr_A261 Human Chromodomain Y-Like Protein Length = 261 1e-07
3t3w_A279 Crystal Structure Of Probable Enoyl-Coa Hydratase F 2e-07
3ome_A282 Crystal Structure Of A Probable Enoyl-Coa Hydratase 2e-07
3lke_A263 Crystal Structure Of Enoyl-Coa Hydratase From Bacil 2e-07
3r9q_A262 Structure Of A Probable Enoyl-Coa HydrataseISOMERAS 3e-07
3m6m_A305 Crystal Structure Of Rpff Complexed With Rec Domain 6e-07
2iex_A272 Crystal Structure Of Dihydroxynapthoic Acid Synthet 7e-07
1nzy_A269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 8e-07
1nzy_B269 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudo 8e-07
2a7k_A250 Carboxymethylproline Synthase (carb) From Pectobact 9e-07
3kqf_A265 1.8 Angstrom Resolution Crystal Structure Of Enoyl- 9e-07
3hp0_A267 Crystal Structure Of A Putative Polyketide Biosynth 1e-06
3hin_A275 Crystal Structure Of Putative Enoyl-Coa Hydratase F 1e-06
2f6q_A280 The Crystal Structure Of Human Peroxisomal Delta3, 1e-06
4di1_A277 Crystal Structure Of Enoyl-Coa Hydratase Echa17 Fro 1e-06
1jxz_A269 Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coe 2e-06
3l3s_A263 Crystal Structure Of An Enoyl-Coa HydrotaseISOMERAS 7e-06
3i47_A268 Crystal Structure Of Putative Enoyl Coa HydrataseIS 9e-06
3t88_A289 Crystal Structure Of Escherichia Coli Menb In Compl 1e-05
3zw8_A 742 Crystal Structure Of Rat Peroxisomal Multifunctiona 1e-05
2wtb_A 725 Arabidopsis Thaliana Multifuctional Protein, Mfp2 L 1e-05
2x58_A 727 The Crystal Structure Of Mfe1 Liganded With Coa Len 1e-05
4els_A285 Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Co 1e-05
1hzd_A272 Crystal Structure Of Human Auh Protein, An Rna-Bind 2e-05
1wdk_A 715 Fatty Acid Beta-Oxidation Multienzyme Complex From 2e-05
3h02_A288 2.15 Angstrom Resolution Crystal Structure Of Napht 2e-05
3g64_A279 Crystal Structure Of Putative Enoyl-Coa Hydratase F 2e-05
3isa_A254 Crystal Structure Of Putative Enoyl-Coa HydrataseIS 3e-05
3zwb_A 742 Crystal Structure Of Rat Peroxisomal Multifunctiona 7e-05
3swx_A265 Crystal Structure Of A Probable Enoyl-Coa Hydratase 1e-04
3qre_A298 Crystal Structure Of An Enoyl-Coa Hydratase Echa12_ 3e-04
3njb_A333 Crystal Structure Of Enoyl-Coa Hydratase From Mycob 3e-04
4eml_A275 Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoy 8e-04
>pdb|3BPT|A Chain A, Crystal Structure Of Human Beta-Hydroxyisobutyryl-Coa Hydrolase In Complex With Quercetin Length = 363 Back     alignment and structure

Iteration: 1

Score = 145 bits (365), Expect = 2e-35, Method: Compositional matrix adjust. Identities = 76/186 (40%), Positives = 110/186 (59%), Gaps = 12/186 (6%) Query: 10 HVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKG-NGRSFCA 68 VL+ ++ + + LNRP LNAL + + + Q + WE + ++IKG G++FCA Sbjct: 7 EVLLGKKGCTGVITLNRPKFLNALTLNXIRQIYPQLKKWEQDPETFLIIIKGAGGKAFCA 66 Query: 69 GGDVVGAYRMLKEGRVEECKE-----LFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGI 123 GGD+ R++ E E+ K+ FR Y V + KP+VA++ GIT GGG G+ Sbjct: 67 GGDI----RVISEA--EKAKQKIAPVFFREEYXLNNAVGSCQKPYVALIHGITXGGGVGL 120 Query: 124 AVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFC 183 +VH +R+ATEK +FA PE IG PDVG Y+L RL G LG +L LTG L G ++ Sbjct: 121 SVHGQFRVATEKCLFAXPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRA 180 Query: 184 GLATHY 189 G+ATH+ Sbjct: 181 GIATHF 186
>pdb|4HDT|A Chain A, Crystal Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Thermoresistibile Length = 353 Back     alignment and structure
>pdb|4J2U|A Chain A, Crystal Structure Of An Enoyl-coa Hydratase From Rhodobacter Sphaeroides 2.4.1 Length = 365 Back     alignment and structure
>pdb|3JU1|A Chain A, Crystal Structure Of Enoyl-Coa HydrataseISOMERASE FAMILY PROTEIN Length = 407 Back     alignment and structure
>pdb|3RSI|A Chain A, The Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 265 Back     alignment and structure
>pdb|2HW5|A Chain A, The Crystal Structure Of Human Enoyl-Coenzyme A (Coa) Hydratase Short Chain 1, Echs1 Length = 286 Back     alignment and structure
>pdb|2PBP|A Chain A, Crystal Structure Of Enoyl-Coa Hydrates Subunit I (Gk_2039) From Geobacillus Kaustophilus Hta426 Length = 258 Back     alignment and structure
>pdb|1DUB|A Chain A, 2-Enoyl-Coa Hydratase, Data Collected At 100 K, Ph 6.5 Length = 261 Back     alignment and structure
>pdb|1EY3|A Chain A, Structure Of Enoyl-Coa Hydratase Complexed With The Substrate Dac-Coa Length = 258 Back     alignment and structure
>pdb|1MJ3|A Chain A, Crystal Structure Analysis Of Rat Enoyl-Coa Hydratase In Complex With Hexadienoyl-Coa Length = 260 Back     alignment and structure
>pdb|3H81|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 278 Back     alignment and structure
>pdb|3Q0J|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Complex With The Inhibitor Acetoacetylcoa Length = 258 Back     alignment and structure
>pdb|3PZK|A Chain A, Crystal Structure Of The Mycobacterium Tuberculosis Crotonase In Apo Form Length = 257 Back     alignment and structure
>pdb|4FZW|A Chain A, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 258 Back     alignment and structure
>pdb|3QMJ|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa8_6 From Mycobacterium Marinum Length = 256 Back     alignment and structure
>pdb|2EJ5|A Chain A, Crystal Structure Of Gk2038 Protein (Enoyl-Coa Hydratase Subunit Ii) From Geobacillus Kaustophilus Length = 257 Back     alignment and structure
>pdb|3MOY|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycob Smegmatis Length = 263 Back     alignment and structure
>pdb|3R9T|A Chain A, Structure Of Echa1_1 From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 267 Back     alignment and structure
>pdb|3R9S|A Chain A, Structure Of A Carnitinyl-Coa Dehydratase From Mycobacterium Avium 104 Length = 267 Back     alignment and structure
>pdb|3R0O|A Chain A, Crystal Structure Of Carnitinyl-Coa Hydratase From Mycobacterium Avium Length = 273 Back     alignment and structure
>pdb|3HRX|A Chain A, Crystal Structure Of Phenylacetic Acid Degradation Protein Paag Length = 254 Back     alignment and structure
>pdb|3TLF|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 274 Back     alignment and structure
>pdb|1UIY|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Thermus Thermophilus Hb8 Length = 253 Back     alignment and structure
>pdb|4F47|A Chain A, The Structure Of Enoyl-Coa Hydratase Echa19 From Mycobacterium Marinum Length = 278 Back     alignment and structure
>pdb|3QKA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa5 From Mycobacterium Marinum Length = 261 Back     alignment and structure
>pdb|3QYR|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa16_2 Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|3P85|A Chain A, Crystal Structure Enoyl-Coa Hydratase From Mycobacterium Avium Length = 270 Back     alignment and structure
>pdb|3QXZ|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 Back     alignment and structure
>pdb|3PEA|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis Str. 'ames Ancestor' Length = 261 Back     alignment and structure
>pdb|3MYB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Mycobacterium Smegm Length = 286 Back     alignment and structure
>pdb|2VSU|A Chain A, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism. Length = 276 Back     alignment and structure
>pdb|2VSU|C Chain C, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 275 Back     alignment and structure
>pdb|3QXI|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa1 From Mycobacterium Marinum Length = 265 Back     alignment and structure
>pdb|2J5I|I Chain I, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2VSU|F Chain F, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|2J5I|B Chain B, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|2VSU|E Chain E, A Ternary Complex Of Hydroxycinnamoyl-Coa Hydratase-Lyase ( Hchl) With Acetyl-Coenzyme A And Vanillin Gives Insights Into Substrate Specificity And Mechanism Length = 276 Back     alignment and structure
>pdb|2VSS|F Chain F, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|2VSS|E Chain E, Wild-Type Hydroxycinnamoyl-Coa Hydratase Lyase In Complex With Acetyl-Coa And Vanillin Length = 276 Back     alignment and structure
>pdb|1DCI|A Chain A, Dienoyl-Coa Isomerase Length = 275 Back     alignment and structure
>pdb|3FDU|A Chain A, Crystal Structure Of A Putative Enoyl-Coa HydrataseISOMERASE FROM Acinetobacter Baumannii Length = 266 Back     alignment and structure
>pdb|2J5I|A Chain A, Crystal Structure Of Hydroxycinnamoyl-Coa Hydratase-Lyase Length = 276 Back     alignment and structure
>pdb|3OC7|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase From Mycobacterium Avium Length = 267 Back     alignment and structure
>pdb|2VRE|A Chain A, Crystal Structure Of Human Peroxisomal Delta3,5, Delta2,4-Dienoyl Coa Isomerase Length = 296 Back     alignment and structure
>pdb|3TRR|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 256 Back     alignment and structure
>pdb|3P5M|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Avium Length = 255 Back     alignment and structure
>pdb|3PE8|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 256 Back     alignment and structure
>pdb|3RRV|A Chain A, Crystal Structure Of An Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Paratuberculosis Length = 276 Back     alignment and structure
>pdb|2FW2|A Chain A, Catalytic Domain Of Cdy Length = 260 Back     alignment and structure
>pdb|2FBM|A Chain A, Acetyltransferase Domain Of Cdy1 Length = 291 Back     alignment and structure
>pdb|3SLL|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 290 Back     alignment and structure
>pdb|2UZF|A Chain A, Crystal Structure Of Staphylococcus Aureus 1,4-Dihydroxy-2- Naphthoyl Coa Synthase (Menb) In Complex With Acetoacetyl Coa Length = 273 Back     alignment and structure
>pdb|4FZW|C Chain C, Crystal Structure Of The Paaf-paag Hydratase-isomerase Complex From E.coli Length = 274 Back     alignment and structure
>pdb|3HE2|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Tuberculosis Length = 264 Back     alignment and structure
>pdb|2GTR|A Chain A, Human Chromodomain Y-Like Protein Length = 261 Back     alignment and structure
>pdb|3T3W|A Chain A, Crystal Structure Of Probable Enoyl-Coa Hydratase From Mycobacterium Thermoresistibile Length = 279 Back     alignment and structure
>pdb|3OME|A Chain A, Crystal Structure Of A Probable Enoyl-Coa Hydratase From Mycobacterium Smegmatis Length = 282 Back     alignment and structure
>pdb|3LKE|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Halodurans Length = 263 Back     alignment and structure
>pdb|3R9Q|A Chain A, Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Atcc 19977 DSM 44196 Length = 262 Back     alignment and structure
>pdb|3M6M|A Chain A, Crystal Structure Of Rpff Complexed With Rec Domain Of Rpfc Length = 305 Back     alignment and structure
>pdb|2IEX|A Chain A, Crystal Structure Of Dihydroxynapthoic Acid Synthetase (Gk2873) From Geobacillus Kaustophilus Hta426 Length = 272 Back     alignment and structure
>pdb|1NZY|A Chain A, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|1NZY|B Chain B, 4-Chlorobenzoyl Coenzyme A Dehalogenase From Pseudomonas Sp. Strain Cbs-3 Length = 269 Back     alignment and structure
>pdb|2A7K|A Chain A, Carboxymethylproline Synthase (carb) From Pectobacterium Carotovora, Apo Enzyme Length = 250 Back     alignment and structure
>pdb|3KQF|A Chain A, 1.8 Angstrom Resolution Crystal Structure Of Enoyl-Coa Hydratase From Bacillus Anthracis. Length = 265 Back     alignment and structure
>pdb|3HP0|A Chain A, Crystal Structure Of A Putative Polyketide Biosynthesis Enoyl-Coa Hydratase (Pksh) From Bacillus Subtilis Length = 267 Back     alignment and structure
>pdb|3HIN|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Rhodopseudomonas Palustris Cga009 Length = 275 Back     alignment and structure
>pdb|2F6Q|A Chain A, The Crystal Structure Of Human Peroxisomal Delta3, Delta2 Enoyl Coa Isomerase (Peci) Length = 280 Back     alignment and structure
>pdb|4DI1|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase Echa17 From Mycobacterium Marinum Length = 277 Back     alignment and structure
>pdb|1JXZ|A Chain A, Structure Of The H90q Mutant Of 4-Chlorobenzoyl-Coenzyme A Dehalogenase Complexed With 4-Hydroxybenzoyl-Coenzyme A (Product) Length = 269 Back     alignment and structure
>pdb|3L3S|A Chain A, Crystal Structure Of An Enoyl-Coa HydrotaseISOMERASE FAMILY Protein From Silicibacter Pomeroyi Length = 263 Back     alignment and structure
>pdb|3I47|A Chain A, Crystal Structure Of Putative Enoyl Coa HydrataseISOMERASE (Crotonase) From Legionella Pneumophila Subsp. Pneumophila Str. Philadelphia 1 Length = 268 Back     alignment and structure
>pdb|3T88|A Chain A, Crystal Structure Of Escherichia Coli Menb In Complex With Substrate Analogue, Osb-Ncoa Length = 289 Back     alignment and structure
>pdb|3ZW8|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) In Apo Form Length = 742 Back     alignment and structure
>pdb|2WTB|A Chain A, Arabidopsis Thaliana Multifuctional Protein, Mfp2 Length = 725 Back     alignment and structure
>pdb|2X58|A Chain A, The Crystal Structure Of Mfe1 Liganded With Coa Length = 727 Back     alignment and structure
>pdb|4ELS|A Chain A, Structure Of E. Coli. 1,4-Dihydroxy-2- Naphthoyl Coenzyme A Synthases (Menb) In Complex With Bicarbonate Length = 285 Back     alignment and structure
>pdb|1HZD|A Chain A, Crystal Structure Of Human Auh Protein, An Rna-Binding Homologue Of Enoyl-Coa Hydratase Length = 272 Back     alignment and structure
>pdb|1WDK|A Chain A, Fatty Acid Beta-Oxidation Multienzyme Complex From Pseudomonas Fragi, Form I (Native2) Length = 715 Back     alignment and structure
>pdb|3H02|A Chain A, 2.15 Angstrom Resolution Crystal Structure Of Naphthoate Synthase From Salmonella Typhimurium. Length = 288 Back     alignment and structure
>pdb|3G64|A Chain A, Crystal Structure Of Putative Enoyl-Coa Hydratase From Streptomyces Coelicolor A3(2) Length = 279 Back     alignment and structure
>pdb|3ISA|A Chain A, Crystal Structure Of Putative Enoyl-Coa HydrataseISOMERASE FROM Bordetella Parapertussis Length = 254 Back     alignment and structure
>pdb|3ZWB|A Chain A, Crystal Structure Of Rat Peroxisomal Multifunctional Enzyme Type 1 (rpmfe1) Complexed With 2trans-hexenoyl-coa Length = 742 Back     alignment and structure
>pdb|3SWX|A Chain A, Crystal Structure Of A Probable Enoyl-Coa HydrataseISOMERASE FROM Mycobacterium Abscessus Length = 265 Back     alignment and structure
>pdb|3QRE|A Chain A, Crystal Structure Of An Enoyl-Coa Hydratase Echa12_1 From Mycobacterium Marinum Length = 298 Back     alignment and structure
>pdb|3NJB|A Chain A, Crystal Structure Of Enoyl-Coa Hydratase From Mycobacterium Smegmatis, Iodide Soak Length = 333 Back     alignment and structure
>pdb|4EML|A Chain A, Synechocystis Sp. Pcc 6803 1,4-Dihydroxy-2-Naphthoyl-Coenzyme A Synthase (Menb) In Complex With Bicarbonate Length = 275 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query195
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 1e-95
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 5e-93
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 4e-37
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 3e-36
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 8e-36
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 1e-35
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 1e-35
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 1e-35
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 3e-35
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 7e-35
3lke_A263 Enoyl-COA hydratase; nysgrc, target 11251J, struct 9e-35
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 1e-34
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 1e-34
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 1e-34
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 2e-34
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 1e-33
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 2e-33
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 5e-33
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 8e-33
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 1e-32
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 1e-32
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 2e-31
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 4e-31
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 1e-30
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 3e-30
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 3e-30
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 3e-30
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 4e-30
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 6e-30
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 2e-29
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 2e-29
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 2e-29
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 6e-29
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 2e-28
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 4e-28
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 4e-28
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 8e-28
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 1e-27
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 3e-27
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 3e-27
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 4e-27
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 6e-27
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 6e-27
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 2e-26
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 2e-26
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 2e-26
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 2e-26
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 2e-26
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 5e-26
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 2e-25
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 3e-25
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 4e-25
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 6e-25
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 6e-25
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 7e-25
3t3w_A279 Probable enoyl-COA hydratase; ssgcid, structural g 2e-24
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 2e-24
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 1e-23
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 2e-23
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 2e-23
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 2e-23
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 3e-23
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 5e-23
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 5e-22
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 1e-21
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 2e-21
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 6e-21
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 6e-21
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 2e-20
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 2e-20
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 4e-20
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 1e-18
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 1e-17
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Length = 363 Back     alignment and structure
 Score =  281 bits (721), Expect = 1e-95
 Identities = 77/189 (40%), Positives = 110/189 (58%), Gaps = 2/189 (1%)

Query: 6   SSQIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNG-R 64
            +   VL+ ++  +  + LNRP  LNAL  +M+  +  Q + WE +     ++IKG G +
Sbjct: 3   DAAEEVLLGKKGCTGVITLNRPKFLNALTLNMIRQIYPQLKKWEQDPETFLIIIKGAGGK 62

Query: 65  SFCAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIA 124
           +FCAGGD+       K  + +     FR  Y     V +  KP+VA++ GITMGGG G++
Sbjct: 63  AFCAGGDIRVISEAEKAKQ-KIAPVFFREEYMLNNAVGSCQKPYVALIHGITMGGGVGLS 121

Query: 125 VHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGHLGEYLGLTGATLSGEEMLFCG 184
           VH  +R+ATEK +FAMPE  IG  PDVG  Y+L RL G LG +L LTG  L G ++   G
Sbjct: 122 VHGQFRVATEKCLFAMPETAIGLFPDVGGGYFLPRLQGKLGYFLALTGFRLKGRDVYRAG 181

Query: 185 LATHYSLSA 193
           +ATH+  S 
Sbjct: 182 IATHFVDSE 190


>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Length = 407 Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Length = 280 Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Length = 256 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Length = 255 Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Length = 266 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Length = 267 Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Length = 279 Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Length = 291 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 11251J, structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Length = 263 Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Length = 257 Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Length = 280 Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} Length = 267 Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Length = 261 Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Length = 269 Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} Length = 268 Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Length = 264 Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Length = 276 Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Length = 243 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} PDB: 3q1t_A Length = 272 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Length = 254 Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Length = 257 Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Length = 263 Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Length = 253 Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Length = 276 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Length = 256 Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Length = 298 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Length = 263 Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Length = 286 Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Length = 290 Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Length = 264 Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Length = 250 Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} Length = 233 Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Length = 278 Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Length = 258 Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Length = 262 Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Length = 287 Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Length = 258 Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Length = 265 Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Length = 275 Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Length = 256 Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Length = 265 Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Length = 278 Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} Length = 274 Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Length = 333 Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Length = 334 Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Length = 275 Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Length = 272 Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Length = 265 Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Length = 260 Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} PDB: 3r9s_A 3r0o_A Length = 267 Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Length = 263 Back     alignment and structure
>3t3w_A Probable enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Length = 279 Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Length = 261 Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Length = 232 Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Length = 273 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Length = 275 Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Length = 277 Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 3h02_A 2iex_A Length = 289 Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Length = 440 Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Length = 261 Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Length = 725 Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Length = 305 Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Length = 260 Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Length = 287 Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Length = 742 Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Length = 265 Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Length = 289 Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Length = 715 Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Length = 556 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
4fzw_C274 1,2-epoxyphenylacetyl-COA isomerase; structural ge 100.0
3hrx_A254 Probable enoyl-COA hydratase; the spiral fold, the 100.0
4fzw_A258 2,3-dehydroadipyl-COA hydratase; structural genomi 100.0
3g64_A279 Putative enoyl-COA hydratase; alpha-beta structure 100.0
4hdt_A 353 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carniti 100.0
3kqf_A265 Enoyl-COA hydratase/isomerase family protein; IDP0 100.0
3i47_A268 Enoyl COA hydratase/isomerase (crotonase); structu 100.0
3lke_A263 Enoyl-COA hydratase; nysgrc, target 112 structural 100.0
3pea_A261 Enoyl-COA hydratase/isomerase family protein; stru 100.0
4di1_A277 Enoyl-COA hydratase ECHA17; structural genomics, s 100.0
3hin_A275 Putative 3-hydroxybutyryl-COA dehydratase; structu 100.0
3qmj_A256 Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, 100.0
3lao_A258 Enoyl-COA hydratase/isomerase; alpha-beta sandwich 100.0
2f6q_A280 Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxis 100.0
3p5m_A255 Enoyl-COA hydratase/isomerase; seattle structural 100.0
1pjh_A280 Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral 100.0
3gkb_A287 Putative enoyl-COA hydratase; structural genomics, 100.0
2j5i_A276 P-hydroxycinnamoyl COA hydratase/lyase; vanillin, 100.0
3sll_A290 Probable enoyl-COA hydratase/isomerase; structural 100.0
3rrv_A276 Enoyl-COA hydratase/isomerase; structural genomics 100.0
2fbm_A291 Y chromosome chromodomain protein 1, telomeric IS; 100.0
3qk8_A272 Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SB 100.0
3gow_A254 PAAG, probable enoyl-COA hydratase; the spiral fol 100.0
2gtr_A261 CDY-like, chromodomain Y-like protein; structural 100.0
3fdu_A266 Putative enoyl-COA hydratase/isomerase; structural 100.0
2ppy_A265 Enoyl-COA hydratase; beta-oxidation, fatty acid me 100.0
3moy_A263 Probable enoyl-COA hydratase; ssgcid, seattle stru 100.0
1nzy_A269 Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogen 100.0
2ej5_A257 Enoyl-COA hydratase subunit II; structural genomic 100.0
2pbp_A258 Enoyl-COA hydratase subunit I; B-oxidation, struct 100.0
3myb_A286 Enoyl-COA hydratase; ssgcid, struct genomics, seat 100.0
3h81_A278 Enoyl-COA hydratase ECHA8; niaid, decode, infectio 100.0
3swx_A265 Probable enoyl-COA hydratase/isomerase; structural 100.0
2vx2_A287 Enoyl-COA hydratase domain-containing protein 3; i 100.0
3l3s_A263 Enoyl-COA hydratase/isomerase family protein; crot 100.0
3qre_A298 Enoyl-COA hydratase, ECHA12_1; structural genomics 100.0
2a7k_A250 CARB; crotonase, antibiotic, beta-lactam, biosynth 100.0
1dci_A275 Dienoyl-COA isomerase; lyase; 1.50A {Rattus norveg 100.0
1wz8_A264 Enoyl-COA hydratase; lyase, crotonase, hexamer, st 100.0
3hp0_A267 Putative polyketide biosynthesis enoyl-COA hydrata 100.0
3r9q_A262 Enoyl-COA hydratase/isomerase; ssgcid, lyase,isome 100.0
3r6h_A233 Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium m 100.0
3pe8_A256 Enoyl-COA hydratase; emerald biostructures, struct 100.0
3rsi_A265 Putative enoyl-COA hydratase/isomerase; structural 100.0
1uiy_A253 Enoyl-COA hydratase; lyase, beta-oxidation, croton 100.0
4eml_A275 Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coe 100.0
2uzf_A273 Naphthoate synthase; lyase, menaquinone biosynthes 100.0
3t89_A289 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
3t8b_A334 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase 100.0
4f47_A278 Enoyl-COA hydratase ECHA19; ssgcid, seattle struct 100.0
3ju1_A 407 Enoyl-COA hydratase/isomerase family protein; alph 100.0
1hzd_A272 AUH, AU-binding protein/enoyl-COA hydratase; RNA-b 100.0
3ot6_A232 Enoyl-COA hydratase/isomerase family protein; stru 100.0
3oc7_A267 Enoyl-COA hydratase; seattle structural genomics c 100.0
3qxz_A265 Enoyl-COA hydratase/isomerase; structural genomics 100.0
2j5g_A263 ALR4455 protein; enzyme evolution, C-C bond hydrol 100.0
3t3w_A279 Enoyl-COA hydratase; ssgcid, structural genomics, 100.0
3bpt_A 363 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, bet 100.0
3tlf_A274 Enoyl-COA hydratase/isomerase; structural genomics 100.0
3isa_A254 Putative enoyl-COA hydratase/isomerase; structural 100.0
1ef8_A261 Methylmalonyl COA decarboxylase; lyase; 1.85A {Esc 100.0
3h0u_A289 Putative enoyl-COA hydratase; structural genomics, 100.0
1szo_A257 6-oxocamphor hydrolase; enzyme-product complex; HE 100.0
3njd_A333 Enoyl-COA hydratase; ssgcid, mycobacerium smegmati 100.0
2q35_A243 CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} 100.0
3he2_A264 Enoyl-COA hydratase ECHA6; fatty acid metabolism, 100.0
3m6n_A305 RPFF protein; enoyl-COA hydratase, lyase; 1.80A {X 100.0
3qxi_A265 Enoyl-COA hydratase ECHA1; structural genomics, se 100.0
3r9t_A267 ECHA1_1; ssgcid, seattle structural genomics cente 100.0
1mj3_A260 Enoyl-COA hydratase, mitochondrial; homohexamer, l 100.0
1sg4_A260 3,2-trans-enoyl-COA isomerase, mitochondrial; crot 100.0
3trr_A256 Probable enoyl-COA hydratase/isomerase; ssgcid, st 100.0
2np9_A440 DPGC; protein inhibitor complex, oxidoreductase; H 100.0
2w3p_A 556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 100.0
1wdk_A 715 Fatty oxidation complex alpha subunit; alpha2BETA2 100.0
3zwc_A 742 Peroxisomal bifunctional enzyme; beta oxidation pa 100.0
2wtb_A 725 MFP2, fatty acid multifunctional protein (ATMFP2); 100.0
3bf0_A593 Protease 4; bacterial, hydrolase, inner membrane, 99.9
3rst_A240 Signal peptide peptidase SPPA; alpha/beta protein 99.87
3viv_A230 441AA long hypothetical NFED protein; protein-pept 99.86
1y7o_A218 ATP-dependent CLP protease proteolytic subunit; hy 99.74
2f9y_B304 Acetyl-coenzyme A carboxylase carboxyl transferas 99.65
2f9i_A327 Acetyl-coenzyme A carboxylase carboxyl transferase 99.63
2f9y_A339 Acetyl-COA carboxylase, carboxyltransferase alpha; 99.61
2cby_A208 ATP-dependent CLP protease proteolytic subunit 1; 99.29
3qwd_A203 ATP-dependent CLP protease proteolytic subunit; ca 99.04
1yg6_A193 ATP-dependent CLP protease proteolytic subunit; en 99.04
2f6i_A215 ATP-dependent CLP protease, putative; structural g 99.03
1tg6_A277 Putative ATP-dependent CLP protease proteolytic S; 98.9
3p2l_A201 ATP-dependent CLP protease proteolytic subunit; st 98.9
4gm2_A205 ATP-dependent CLP protease proteolytic subunit; st 98.57
2w3p_A556 Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ri 98.55
1pix_A 587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 98.46
3bf0_A 593 Protease 4; bacterial, hydrolase, inner membrane, 98.43
2f9i_B285 Acetyl-coenzyme A carboxylase carboxyl transferase 98.21
3n6r_B 531 Propionyl-COA carboxylase, beta subunit; protein c 98.2
3iav_A 530 Propionyl-COA carboxylase complex B subunit; accas 98.13
1on3_A 523 Methylmalonyl-COA carboxyltransferase 12S subunit; 98.04
2bzr_A 548 Propionyl-COA carboxylase beta chain 5; fatty acid 97.96
1x0u_A 522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.95
3u9r_B 555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 97.88
1vrg_A 527 Propionyl-COA carboxylase, beta subunit; TM0716, s 97.78
1x0u_A522 Hypothetical methylmalonyl-COA decarboxylase ALPH; 97.68
3gf3_A 588 Glutaconyl-COA decarboxylase subunit A; sodium ION 97.26
3iav_A530 Propionyl-COA carboxylase complex B subunit; accas 97.19
1vrg_A527 Propionyl-COA carboxylase, beta subunit; TM0716, s 97.16
2bzr_A548 Propionyl-COA carboxylase beta chain 5; fatty acid 97.07
1pix_A587 Glutaconyl-COA decarboxylase A subunit; biotin-dep 96.9
1on3_A523 Methylmalonyl-COA carboxyltransferase 12S subunit; 96.79
3n6r_B531 Propionyl-COA carboxylase, beta subunit; protein c 96.75
3u9r_B555 MCC beta, methylcrotonyl-COA carboxylase, beta-sub 96.02
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 95.8
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 95.72
3gf3_A588 Glutaconyl-COA decarboxylase subunit A; sodium ION 94.84
3k8x_A 758 Acetyl-COA carboxylase; transferase, carboxyltrans 90.48
2x24_A 793 Acetyl-COA carboxylase; fatty acid biosynthesis, l 90.29
>4fzw_C 1,2-epoxyphenylacetyl-COA isomerase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
Probab=100.00  E-value=8.5e-53  Score=338.30  Aligned_cols=192  Identities=26%  Similarity=0.360  Sum_probs=167.1

Q ss_pred             CCCCcceEEEEEeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEEeCCCceeccccchhHHHhhhccc
Q 041986            4 KQSSQIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGR   83 (195)
Q Consensus         4 ~~~~~~~v~~~~~~~v~~i~l~~p~~~N~~~~~~~~~l~~~l~~~~~~~~~~~vvl~~~g~~F~~G~dl~~~~~~~~~~~   83 (195)
                      +.+.++.|.++.+++|++||||||++.|++|.+++.+|.+++++++.|+++++|||||.|+.||+|.|++++........
T Consensus        10 ~GsM~e~il~~~~~gVa~itlnRP~~~NAl~~~m~~~L~~al~~~~~d~~vr~vVltg~G~~FcaG~Dl~~~~~~~~~~~   89 (274)
T 4fzw_C           10 HGSMMEFILSHVEKGVMTLTLNRPERLNSFNDEMHAQLAECLKQVERDDTIRCLLLTGAGRGFCAGQDLNDRNVDPTGPA   89 (274)
T ss_dssp             ------CEEEEEETTEEEEEECCTTTTSCBCHHHHHHHHHHHHHHHHCTTCCEEEEEESSSCSBCCBCCC---------C
T ss_pred             cccccccEEEEEECCEEEEEEcCcCccCCCCHHHHHHHHHHHHHHHhCCCceEEEEECCCCceeCCcChHhhhccccccc
Confidence            44567789999999999999999999999999999999999999999999999999999999999999998764443333


Q ss_pred             HHHHHHHHHHHHHHHHHHhhCCCcEEEEEcchhcchhhHHhhhcCEEEEeCCeEEecCcccccccCCCchhhHhhhcch-
Q 041986           84 VEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPG-  162 (195)
Q Consensus        84 ~~~~~~~~~~~~~l~~~l~~~~~p~Iaav~G~~~g~G~~l~l~~D~~ia~~~a~~~~pe~~~G~~p~~g~~~~l~r~~g-  162 (195)
                      .+....+.+.++.++.++.++||||||+|||+|+|||++|+++||+||++++++|++||+++|++|++|++++|+|++| 
T Consensus        90 ~~~~~~~~~~~~~l~~~l~~~~kPvIAav~G~a~GgG~~lalacD~ria~~~a~f~~pe~~~Gl~p~~g~~~~L~r~vG~  169 (274)
T 4fzw_C           90 PDLGMSVERFYNPLVRRLAKLPKPVICAVNGVAAGAGATLALGGDIVIAARSAKFVMAFSKLGLIPDCGGTWLLPRVAGR  169 (274)
T ss_dssp             CCHHHHHHHTHHHHHHHHHHCSSCEEEEECSCEETHHHHHHHTSSEEEEETTCEEECCGGGTTCCCTTTHHHHHHHHTCH
T ss_pred             hHHHHHHHHHHHHHHHHHHHCCCCEEEEECCceeecCceeeeccceEEECCCCEEECcccCcccCCCccHHHHHHHHhhH
Confidence            3333455556778889999999999999999999999999999999999999999999999999999999999999999 


Q ss_pred             HHHHHHhhcCCCCCHHHHHhcCccccccCCCCC
Q 041986          163 HLGEYLGLTGATLSGEEMLFCGLATHYSLSAVC  195 (195)
Q Consensus       163 ~~a~~l~l~g~~~~a~ea~~~Glv~~vv~~~~l  195 (195)
                      .++.+++++|++++|+||+++||||+|||++++
T Consensus       170 ~~A~~llltg~~i~A~eA~~~GLv~~vv~~~~l  202 (274)
T 4fzw_C          170 ARAMGLALLGNQLSAEQAHEWGMIWQVVDDETL  202 (274)
T ss_dssp             HHHHHHHHHCCCEEHHHHHHTTSSSEEECGGGH
T ss_pred             HHHHHHHHhCCcCCHHHHHHCCCceEEeChHHH
Confidence            899999999999999999999999999998764



>3hrx_A Probable enoyl-COA hydratase; the spiral fold, the crotonase superfamily, lyase; 1.85A {Thermus thermophilus} Back     alignment and structure
>4fzw_A 2,3-dehydroadipyl-COA hydratase; structural genomics, montreal-kingston bacterial structural initiative, BSGI, crotonase fold; 2.55A {Escherichia coli} Back     alignment and structure
>3g64_A Putative enoyl-COA hydratase; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; 2.05A {Streptomyces coelicolor A3} Back     alignment and structure
>4hdt_A 3-hydroxyisobutyryl-COA hydrolase; ssgcid, carnitinyl-COA dehydratase, enoyl-COA hydratase/ISOM mycobacterium thermoresistibIle; 1.60A {Mycobacterium thermoresistibile} Back     alignment and structure
>3kqf_A Enoyl-COA hydratase/isomerase family protein; IDP02329, structural genomic for structural genomics of infectious diseases, csgid; HET: MSE; 1.80A {Bacillus anthracis} Back     alignment and structure
>3i47_A Enoyl COA hydratase/isomerase (crotonase); structural genomics; 1.58A {Legionella pneumophila subsp} SCOP: c.14.1.0 Back     alignment and structure
>3lke_A Enoyl-COA hydratase; nysgrc, target 112 structural genomics, PSI-2, protein structure initiative; 1.70A {Bacillus halodurans} Back     alignment and structure
>3pea_A Enoyl-COA hydratase/isomerase family protein; structural genomics, center for structural genomics of infec diseases, csgid; HET: FLC PG4; 1.82A {Bacillus anthracis} Back     alignment and structure
>4di1_A Enoyl-COA hydratase ECHA17; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis, ortholog; 2.25A {Mycobacterium marinum} Back     alignment and structure
>3hin_A Putative 3-hydroxybutyryl-COA dehydratase; structural genomics, protein structure INI NEW YORK structural genomix research consortium; 2.00A {Rhodopseudomonas palustris} Back     alignment and structure
>3qmj_A Enoyl-COA hydratase, ECHA8_6; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3lao_A Enoyl-COA hydratase/isomerase; alpha-beta sandwich, structural genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Pseudomonas aeruginosa} Back     alignment and structure
>2f6q_A Peroxisomal 3,2-trans-enoyl-COA isomerase; peroxisomes, fatty acid metabolism, STR genomics, structural genomics consortium, SGC; 1.95A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3p5m_A Enoyl-COA hydratase/isomerase; seattle structural genomics center for infectious disease, S coenzyme A, tuberculosis; 2.05A {Mycobacterium avium} Back     alignment and structure
>1pjh_A Enoyl-COA isomerase; ECI1P; beta-BETA-alpha spiral fold, inter-trimer contacts; 2.10A {Saccharomyces cerevisiae} SCOP: c.14.1.3 PDB: 1hno_A 1k39_A* 1hnu_A Back     alignment and structure
>3gkb_A Putative enoyl-COA hydratase; structural genomics, unknown function, PSI-2, protein struct initiative; 1.80A {Streptomyces avermitilis} Back     alignment and structure
>2j5i_A P-hydroxycinnamoyl COA hydratase/lyase; vanillin, aldolase, crotonase, coenzyme-A; 1.8A {Pseudomonas fluorescens} PDB: 2j5i_B 2vss_A* 2j5i_I 2vss_F* 2vsu_A* 2vss_E* 2vsu_F* 2vsu_E* 2vsu_C* Back     alignment and structure
>3sll_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.35A {Mycobacterium abscessus} Back     alignment and structure
>3rrv_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.45A {Mycobacterium avium subsp} Back     alignment and structure
>2fbm_A Y chromosome chromodomain protein 1, telomeric IS; acetyltransferase, structural genomics, structural genomics consortium, SGC, unknown function; 2.28A {Homo sapiens} SCOP: c.14.1.3 Back     alignment and structure
>3qk8_A Enoyl-COA hydratase ECHA15; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 1.60A {Mycobacterium marinum M} SCOP: c.14.1.0 PDB: 3q1t_A Back     alignment and structure
>2gtr_A CDY-like, chromodomain Y-like protein; structural genomics, structural genomics consortium, SGC, unknown function; 1.90A {Homo sapiens} PDB: 2fw2_A Back     alignment and structure
>3fdu_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2; 2.00A {Acinetobacter baumannii} Back     alignment and structure
>2ppy_A Enoyl-COA hydratase; beta-oxidation, fatty acid metabol lyase, structural genomics, NPPSFA; 2.16A {Geobacillus kaustophilus} Back     alignment and structure
>3moy_A Probable enoyl-COA hydratase; ssgcid, seattle structural genomics center for infectious DI enoyl COA, actinobacteria, lyase; 1.50A {Mycobacterium smegmatis} Back     alignment and structure
>1nzy_A Dehalogenase, 4-chlorobenzoyl coenzyme A dehalogenase; lyase; HET: BCA; 1.80A {Pseudomonas SP} SCOP: c.14.1.3 PDB: 1jxz_A* 1nzy_B* Back     alignment and structure
>2ej5_A Enoyl-COA hydratase subunit II; structural genomics, GK2038, NPPSFA, national project on prote structural and functional analyses; 2.00A {Geobacillus kaustophilus} Back     alignment and structure
>2pbp_A Enoyl-COA hydratase subunit I; B-oxidation, structural genomics, NPPSFA, nationa on protein structural and functional analyses; 1.80A {Geobacillus kaustophilus} PDB: 2qq3_A Back     alignment and structure
>3myb_A Enoyl-COA hydratase; ssgcid, struct genomics, seattle structural genomics center for infectious lyase; 1.55A {Mycobacterium smegmatis} Back     alignment and structure
>3h81_A Enoyl-COA hydratase ECHA8; niaid, decode, infectious disease, MPCS, fatty acid metaboli metabolism, lyase, structural genomics; 1.80A {Mycobacterium tuberculosis} PDB: 3q0j_A* 3pzk_A 3q0g_A* Back     alignment and structure
>3swx_A Probable enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>2vx2_A Enoyl-COA hydratase domain-containing protein 3; isomerase, fatty acid metabolism, transit peptide, lipid Met crontonase, mitochondrion, CAsp; 2.3A {Homo sapiens} Back     alignment and structure
>3l3s_A Enoyl-COA hydratase/isomerase family protein; crotonase superfamily, dimer of trimers, PSI-2, NYSGXRC, structural genomics; 2.32A {Ruegeria pomeroyi} Back     alignment and structure
>3qre_A Enoyl-COA hydratase, ECHA12_1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.40A {Mycobacterium marinum M} Back     alignment and structure
>2a7k_A CARB; crotonase, antibiotic, beta-lactam, biosynthetic protein; 2.24A {Pectobacterium carotovorum} SCOP: c.14.1.3 PDB: 2a81_A* Back     alignment and structure
>1dci_A Dienoyl-COA isomerase; lyase; 1.50A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2vre_A Back     alignment and structure
>1wz8_A Enoyl-COA hydratase; lyase, crotonase, hexamer, structural genomics, riken S genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>3hp0_A Putative polyketide biosynthesis enoyl-COA hydratase homolog PKSH; polyketide synthase, enoyl COA hydratase,isomerase; 2.32A {Bacillus subtilis} Back     alignment and structure
>3r9q_A Enoyl-COA hydratase/isomerase; ssgcid, lyase,isomerase; 2.10A {Mycobacterium abscessus} PDB: 3qka_A Back     alignment and structure
>3r6h_A Enoyl-COA hydratase, ECHA3; ssgcid, mycobacerium marinum, structura genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium marinum M} PDB: 4hc8_A* Back     alignment and structure
>3pe8_A Enoyl-COA hydratase; emerald biostructures, structural genomics, seattle structur genomics center for infectious disease, ssgcid, lyase; 1.60A {Mycobacterium smegmatis} PDB: 3p85_A* 3qyr_A Back     alignment and structure
>3rsi_A Putative enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 2.00A {Mycobacterium abscessus} Back     alignment and structure
>1uiy_A Enoyl-COA hydratase; lyase, beta-oxidation, crotonase, riken structural genomics/proteomics initiative, RSGI, structural genomics; 2.85A {Thermus thermophilus} SCOP: c.14.1.3 Back     alignment and structure
>4eml_A Naphthoate synthase; 1,4-dihydroxy-2-naphthoyl-coenzyme A, lyase; 2.04A {Synechocystis SP} Back     alignment and structure
>2uzf_A Naphthoate synthase; lyase, menaquinone biosynthesis; HET: CAA; 2.9A {Staphylococcus aureus} Back     alignment and structure
>3t89_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.95A {Escherichia coli} PDB: 3t88_A 4elx_A 4elw_A 4els_A 3h02_A 2iex_A Back     alignment and structure
>3t8b_A 1,4-dihydroxy-2-naphthoyl-COA synthase; crotonase superfamily, lyase; 1.65A {Mycobacterium tuberculosis} PDB: 3t8a_A 1rjm_A* 1rjn_A* 1q52_A 1q51_A Back     alignment and structure
>4f47_A Enoyl-COA hydratase ECHA19; ssgcid, seattle structural genomics center for infectious DI niaid; 1.75A {Mycobacterium marinum} Back     alignment and structure
>3ju1_A Enoyl-COA hydratase/isomerase family protein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative; HET: MSE; 2.30A {Shewanella oneidensis} Back     alignment and structure
>1hzd_A AUH, AU-binding protein/enoyl-COA hydratase; RNA-binding protein,enoyl-COA hydratase, riken structural genomics/proteomics initiative, RSGI; 2.20A {Homo sapiens} SCOP: c.14.1.3 PDB: 2zqq_A 2zqr_A Back     alignment and structure
>3ot6_A Enoyl-COA hydratase/isomerase family protein; structural genomics, PSI-2, protein structure initiative; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>3oc7_A Enoyl-COA hydratase; seattle structural genomics center for infectious disease, S non-pathogenic mycobacterium species, ortholog; 1.50A {Mycobacterium avium} SCOP: c.14.1.0 Back     alignment and structure
>3qxz_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.35A {Mycobacterium abscessus} SCOP: c.14.1.0 Back     alignment and structure
>2j5g_A ALR4455 protein; enzyme evolution, C-C bond hydrolase, hydrolase, lyase, crotonase, biocatalysis, beta-diketone; 1.46A {Anabaena SP} PDB: 2j5s_A* 2j5g_D Back     alignment and structure
>3t3w_A Enoyl-COA hydratase; ssgcid, structural genomics, seattle ST genomics center for infectious disease, lyase; 1.80A {Mycobacterium thermoresistibile} PDB: 3ome_A Back     alignment and structure
>3bpt_A 3-hydroxyisobutyryl-COA hydrolase; coenzyme A, beta-hydroxyisobutyryl acid, querceti structural genomics consortium, SGC; HET: QUE; 1.50A {Homo sapiens} Back     alignment and structure
>3tlf_A Enoyl-COA hydratase/isomerase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, otholog; 2.15A {Mycobacterium avium subsp} SCOP: c.14.1.0 Back     alignment and structure
>3isa_A Putative enoyl-COA hydratase/isomerase; structural genomics, PSI-2, protein structure initiative, EN hydratase; 1.76A {Bordetella parapertussis} Back     alignment and structure
>1ef8_A Methylmalonyl COA decarboxylase; lyase; 1.85A {Escherichia coli} SCOP: c.14.1.3 PDB: 1ef9_A* Back     alignment and structure
>3h0u_A Putative enoyl-COA hydratase; structural genomics, isomerase, PSI-2, protein structure initiative; 1.50A {Streptomyces avermitilis} Back     alignment and structure
>1szo_A 6-oxocamphor hydrolase; enzyme-product complex; HET: CAX; 1.90A {Rhodococcus SP} SCOP: c.14.1.3 PDB: 1o8u_A Back     alignment and structure
>3njd_A Enoyl-COA hydratase; ssgcid, mycobacerium smegmatis, structu genomics, seattle structural genomics center for infectious lyase; 1.75A {Mycobacterium smegmatis} PDB: 3njb_A Back     alignment and structure
>2q35_A CURF; crotonase, lyase; 1.65A {Lyngbya majuscula} PDB: 2q34_A 2q2x_A Back     alignment and structure
>3he2_A Enoyl-COA hydratase ECHA6; fatty acid metabolism, lipid metabolism, lyase, structural genomics; HET: PGE; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>3m6n_A RPFF protein; enoyl-COA hydratase, lyase; 1.80A {Xanthomonas campestris PV} PDB: 3m6m_A Back     alignment and structure
>3qxi_A Enoyl-COA hydratase ECHA1; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 2.20A {Mycobacterium marinum} Back     alignment and structure
>3r9t_A ECHA1_1; ssgcid, seattle structural genomics center for infectious DI enoyl-COA hydratase, lyase; 1.75A {Mycobacterium avium subsp} SCOP: c.14.1.0 PDB: 3r9s_A 3r0o_A Back     alignment and structure
>1mj3_A Enoyl-COA hydratase, mitochondrial; homohexamer, lyase; HET: HXC; 2.10A {Rattus norvegicus} SCOP: c.14.1.3 PDB: 2dub_A* 1dub_A* 1ey3_A* 2hw5_A* Back     alignment and structure
>1sg4_A 3,2-trans-enoyl-COA isomerase, mitochondrial; crotonase fold; HET: CO8; 1.30A {Homo sapiens} SCOP: c.14.1.3 PDB: 1xx4_A Back     alignment and structure
>3trr_A Probable enoyl-COA hydratase/isomerase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 2.09A {Mycobacterium abscessus} Back     alignment and structure
>2np9_A DPGC; protein inhibitor complex, oxidoreductase; HET: YE1; 2.45A {Streptomyces toyocaensis} PDB: 2pg8_A* Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>1wdk_A Fatty oxidation complex alpha subunit; alpha2BETA2 heterotetrameric complex, lyase, oxidoreductase/transferase complex, lyase; HET: ACO NAD N8E; 2.50A {Pseudomonas fragi} SCOP: a.100.1.3 a.100.1.3 c.2.1.6 c.14.1.3 PDB: 1wdl_A* 1wdm_A* 2d3t_A* Back     alignment and structure
>3zwc_A Peroxisomal bifunctional enzyme; beta oxidation pathway, oxidoreductase, lipid metabolism, LY isomerase, peroxisome, fatty acid metabolism; HET: NAD HSC; 2.30A {Rattus norvegicus} PDB: 3zw9_A* 3zw8_A* 3zwa_A* 3zwb_A* 2x58_A* Back     alignment and structure
>2wtb_A MFP2, fatty acid multifunctional protein (ATMFP2); oxidoreductase, peroxisomes, beta-oxidation, fatty acid oxidation; 2.50A {Arabidopsis thaliana} Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>3rst_A Signal peptide peptidase SPPA; alpha/beta protein fold, signal peptide digestion, bacterial membrane, hydrolase; 2.37A {Bacillus subtilis} Back     alignment and structure
>3viv_A 441AA long hypothetical NFED protein; protein-peptide complex, alpha / beta motif, protease, membr protein stomatin, hydrolase-protein binding complex; 2.25A {Pyrococcus horikoshii} PDB: 3bpp_A 2deo_A Back     alignment and structure
>1y7o_A ATP-dependent CLP protease proteolytic subunit; hydrolase; 2.51A {Streptococcus pneumoniae} SCOP: c.14.1.1 Back     alignment and structure
>2f9y_B Acetyl-coenzyme A carboxylase carboxyl transferas beta; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2f9i_A Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>2f9y_A Acetyl-COA carboxylase, carboxyltransferase alpha; zinc ribbon, crotonase superfamily, spiral domain, ligase; 3.20A {Escherichia coli} SCOP: c.14.1.4 Back     alignment and structure
>2cby_A ATP-dependent CLP protease proteolytic subunit 1; serine protease, endopept mycobacterium tuberculosis, ATP-dependent protease; 2.6A {Mycobacterium tuberculosis} SCOP: c.14.1.1 PDB: 2c8t_A 2ce3_A Back     alignment and structure
>3qwd_A ATP-dependent CLP protease proteolytic subunit; caseinolytic protease, serin-protease, hydrolase; 2.10A {Staphylococcus aureus subsp} SCOP: c.14.1.1 PDB: 3v5e_A 3v5i_A 3sta_V 3st9_A Back     alignment and structure
>1yg6_A ATP-dependent CLP protease proteolytic subunit; endopeptidase CLP, caseinolytic protease, protease TI, heat shock protein F21.5, hydrolase; 1.90A {Escherichia coli} SCOP: c.14.1.1 PDB: 1tyf_A 2fzs_A* 3mt6_R 1yg8_A 3hln_A 2zl2_A 2zl0_A 2zl4_A 2zl3_A 3tt7_A* 3tt6_A 3ktg_A 3kth_A 3kti_A* 3ktj_A* 3ktk_A* 3q7h_A Back     alignment and structure
>2f6i_A ATP-dependent CLP protease, putative; structural genomics, structural genomics conso SGC, hydrolase; 2.45A {Plasmodium falciparum} SCOP: c.14.1.1 Back     alignment and structure
>1tg6_A Putative ATP-dependent CLP protease proteolytic S; mitochondrial CLPP, CLP/HSP 100, ATP-dependent protease, HYD; HET: FME; 2.10A {Homo sapiens} SCOP: c.14.1.1 Back     alignment and structure
>3p2l_A ATP-dependent CLP protease proteolytic subunit; structural genomics, center for structural genomics of infec diseases, csgid; 2.29A {Francisella tularensis subsp} SCOP: c.14.1.1 Back     alignment and structure
>4gm2_A ATP-dependent CLP protease proteolytic subunit; structural genomics, structural genomics consortium, SGC, PR hydrolase; 2.80A {Plasmodium falciparum} PDB: 4hnk_A Back     alignment and structure
>2w3p_A Benzoyl-COA-dihydrodiol lyase; BOXC, crotonase, ring cleaving, burkholderia xenovorans LB400 crotonase; 1.50A {Burkholderia xenovorans} Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>3bf0_A Protease 4; bacterial, hydrolase, inner membrane, membrane, transmembrane; 2.55A {Escherichia coli} PDB: 3bez_A Back     alignment and structure
>2f9i_B Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta; zinc ribbon, crotonase superfamily, spiral domain; 1.98A {Staphylococcus aureus} Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1x0u_A Hypothetical methylmalonyl-COA decarboxylase ALPH; lyase; 2.20A {Sulfolobus tokodaii} Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3iav_A Propionyl-COA carboxylase complex B subunit; accase, pccase, ACC, PCC, CT, carboxyltransfe polyketide, fatty acid, PKS, FAS; 1.75A {Streptomyces coelicolor} PDB: 1xnw_A 3ib9_A* 3ibb_A 3mfm_C 1xny_A* 1xnv_A* 1xo6_A Back     alignment and structure
>1vrg_A Propionyl-COA carboxylase, beta subunit; TM0716, structural joint center for structural genomics, JCSG, protein structu initiative, PSI; HET: MSE; 2.30A {Thermotoga maritima} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>2bzr_A Propionyl-COA carboxylase beta chain 5; fatty acid biosynthesis, accase, ligase, transferase; 2.2A {Mycobacterium tuberculosis} PDB: 2a7s_A Back     alignment and structure
>1pix_A Glutaconyl-COA decarboxylase A subunit; biotin-dependent ION pump, carboxyltransferase, lyase; 2.20A {Acidaminococcus fermentans} SCOP: c.14.1.4 c.14.1.4 Back     alignment and structure
>1on3_A Methylmalonyl-COA carboxyltransferase 12S subunit; domain duplication, multienzyme complex, transcarboxylase; HET: MCA; 1.90A {Propionibacterium freudenreichii} SCOP: c.14.1.4 c.14.1.4 PDB: 1on9_A* Back     alignment and structure
>3n6r_B Propionyl-COA carboxylase, beta subunit; protein complex, biotin-dependent carboxylase, ligase; HET: BTI; 3.20A {Roseobacter denitrificans} Back     alignment and structure
>3u9r_B MCC beta, methylcrotonyl-COA carboxylase, beta-subunit; carboxyltransferase, beta-BETA-alpha superhelix, ligase; HET: 1PE; 1.50A {Pseudomonas aeruginosa} PDB: 3u9s_B* 3u9t_B Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>3gf3_A Glutaconyl-COA decarboxylase subunit A; sodium ION transport, biotin, glutamate fermentation, lyase; HET: COO; 1.75A {Clostridium symbiosum} PDB: 3gf7_A 3glm_A* 3gma_A* Back     alignment and structure
>3k8x_A Acetyl-COA carboxylase; transferase, carboxyltransferase, AC tepraloxydim, ATP-binding, biotin, fatty acid biosynthesis; HET: B89; 2.30A {Saccharomyces cerevisiae} PDB: 1w2x_A* 3h0s_A* 3h0j_A* 3h0q_A* 1od2_A* 1od4_A* 3pgq_A* 3tvu_A* 3tv5_A* 3tvw_A* 3tz3_A* 1uyr_A* 1uys_A* 1uyt_A 1uyv_A Back     alignment and structure
>2x24_A Acetyl-COA carboxylase; fatty acid biosynthesis, ligase, lipid synthesis; HET: X24; 2.40A {Bos taurus} PDB: 3ff6_A* 3tdc_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 195
d1mj3a_260 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat 9e-34
d1uiya_253 c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {The 3e-23
d1dcia_275 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 4e-18
d1hzda_266 c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [T 3e-16
d2f6qa1245 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-C 2e-15
d1q52a_297 c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacter 7e-15
d1pjha_266 c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2 6e-13
d1nzya_269 c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Ps 2e-11
d1wdka4 310 c.14.1.3 (A:1-310) Fatty oxidation complex alpha s 3e-11
d2fw2a1258 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Hum 2e-09
d1szoa_249 c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus 4e-07
d2a7ka1230 c.14.1.3 (A:1-230) Carbapenem biosynthes protein C 7e-07
d1ef8a_261 c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Esc 1e-06
d1wz8a1263 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TT 4e-06
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 260 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Enoyl-CoA hydratase (crotonase)
species: Rat (Rattus norvegicus) [TaxId: 10116]
 Score =  118 bits (297), Expect = 9e-34
 Identities = 47/179 (26%), Positives = 80/179 (44%), Gaps = 10/179 (5%)

Query: 10  HVLVEERANS---RTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSF 66
           +++ E++  +     + LNRP  LNAL   ++  L +  E++E +  V  +V+ G  ++F
Sbjct: 5   YIITEKKGKNSSVGLIQLNRPKALNALCNGLIEELNQALETFEEDPAVGAIVLTGGEKAF 64

Query: 67  CAGGDVVGAYRMLKEGRVEECKELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVH 126
            AG D+                       S    +    KP +A ++G  +GGG  +A+ 
Sbjct: 65  AAGADIKEMQNR------TFQDCYSGKFLSHWDHITRIKKPVIAAVNGYALGGGCELAMM 118

Query: 127 ASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPGH-LGEYLGLTGATLSGEEMLFCG 184
                A EK  F  PE+L+G  P  G +  L+R  G  L   + LTG  +S ++    G
Sbjct: 119 CDIIYAGEKAQFGQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAG 177


>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Length = 253 Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 275 Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Length = 266 Back     information, alignment and structure
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Length = 297 Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 266 Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Length = 269 Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Length = 310 Back     information, alignment and structure
>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Length = 258 Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Length = 249 Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Length = 230 Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Length = 261 Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Length = 263 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query195
d2f6qa1245 Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human ( 100.0
d2fw2a1258 Chromodomain protein CDY2A {Human (Homo sapiens) [ 100.0
d1pjha_266 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1mj3a_260 Enoyl-CoA hydratase (crotonase) {Rat (Rattus norve 100.0
d1wdka4 310 Fatty oxidation complex alpha subunit, N-terminal 100.0
d1wz8a1263 Probable enoyl-CoA hydratase TTHA0218 {Thermus the 100.0
d1nzya_269 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., 100.0
d2a7ka1230 Carbapenem biosynthes protein CarB {Pectobacterium 100.0
d1ef8a_261 Methylmalonyl CoA decarboxylase {Escherichia coli 100.0
d1uiya_253 Enoyl-CoA hydratase (crotonase) {Thermus thermophi 100.0
d1szoa_249 6-oxo camphor hydrolase {Rhodococcus erythropolis 100.0
d1dcia_275 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1hzda_266 AUH protein {Human (Homo sapiens) [TaxId: 9606]} 100.0
d1sg4a1249 Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA iso 100.0
d1q52a_297 Naphthoate synthase MenB {Mycobacterium tuberculos 100.0
d2cbya1179 Clp protease, ClpP subunit {Mycobacterium tubercul 98.62
d1yg6a1183 Clp protease, ClpP subunit {Escherichia coli [TaxI 98.58
d1y7oa1192 Clp protease, ClpP subunit {Streptococcus pneumoni 98.48
d2f6ia1190 Clp protease, ClpP subunit {Plasmodium falciparum 98.41
d1tg6a1193 Clp protease, ClpP subunit {Human (Homo sapiens), 98.24
d1on3a1253 Methylmalonyl-CoA carboxyltransferase (transcarbox 98.23
d2f9ya1316 Acetyl-coenzyme A carboxylase carboxyl transferase 98.2
d1xnya1258 Propionyl-CoA carboxylase complex B subunit, PccB 98.12
d2a7sa1258 Propionyl-CoA carboxylase complex B subunit, PccB 98.02
d1vrga1251 Propionyl-CoA carboxylase complex B subunit, PccB 97.99
d1pixa2287 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 97.9
d2f9yb1263 Acetyl-coenzyme A carboxylase carboxyl transferase 97.89
d2a7sa2271 Propionyl-CoA carboxylase complex B subunit, PccB 97.2
d1on3a2264 Methylmalonyl-CoA carboxyltransferase (transcarbox 97.1
d1vrga2264 Propionyl-CoA carboxylase complex B subunit, PccB 96.38
d1xnya2263 Propionyl-CoA carboxylase complex B subunit, PccB 96.11
d1uyra1333 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 95.84
d1pixa3299 Glutaconyl-CoA decarboxylase A subunit {Acidaminoc 95.53
d1uyra2 404 Acetyl-coenzyme A carboxylase {Baker's yeast (Sacc 91.52
>d2f6qa1 c.14.1.3 (A:108-352) Peroxisomal 3,2-trans-enoyl-CoA isomerase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: ClpP/crotonase
superfamily: ClpP/crotonase
family: Crotonase-like
domain: Peroxisomal 3,2-trans-enoyl-CoA isomerase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=100.00  E-value=2.8e-49  Score=311.51  Aligned_cols=187  Identities=21%  Similarity=0.308  Sum_probs=169.8

Q ss_pred             cceEEEEEeCCEEEEEEcCCCCCCCCCHHHHHHHHHHHHHHhcCCCceEEEEEeCCCceeccccchhHHHhhhcccHHHH
Q 041986            8 QIHVLVEERANSRTVILNRPHVLNALNTSMVALLTKQYESWENNSGVDFVVIKGNGRSFCAGGDVVGAYRMLKEGRVEEC   87 (195)
Q Consensus         8 ~~~v~~~~~~~v~~i~l~~p~~~N~~~~~~~~~l~~~l~~~~~~~~~~~vvl~~~g~~F~~G~dl~~~~~~~~~~~~~~~   87 (195)
                      |++|.++++++|++||||||++.|++|.+++.+|.+++++++.|+.+ +||++|.|+.||+|.|++++............
T Consensus         2 ~~~i~~~~~~gi~~Itlnrp~~~Nals~~~~~~l~~~l~~~~~d~~v-~vvl~g~g~~F~aG~Dl~~~~~~~~~~~~~~~   80 (245)
T d2f6qa1           2 FETLVVTSEDGITKIMFNRPKKKNAINTEMYHEIMRALKAASKDDSI-ITVLTGNGDYYSSGNDLTNFTDIPPGGVEEKA   80 (245)
T ss_dssp             CSSEEEEEETTEEEEEECCGGGTTCBCHHHHHHHHHHHHHHHHSSCS-EEEEEESTTCSBCCBCC----CCCTTHHHHHH
T ss_pred             cceEEEEEECCEEEEEEcCCCcCCCCCHHHHHHHHHHHHHHhcCCce-EEeecCCCccccCCccchhhhccccccccccc
Confidence            67899999999999999999999999999999999999999998776 89999999999999999998765544444455


Q ss_pred             HHHHHHHHHHHHHHhhCCCcEEEEEcchhcchhhHHhhhcCEEEEeCCeEEecCcccccccCCCchhhHhhhcch-HHHH
Q 041986           88 KELFRTLYSFVYLVATYSKPHVAIMDGITMGGGAGIAVHASYRLATEKTVFAMPEVLIGFHPDVGSSYYLSRLPG-HLGE  166 (195)
Q Consensus        88 ~~~~~~~~~l~~~l~~~~~p~Iaav~G~~~g~G~~l~l~~D~~ia~~~a~~~~pe~~~G~~p~~g~~~~l~r~~g-~~a~  166 (195)
                      ......+.++++++.++|||+||+|||+|+|||++++++||+||++++++|++||+++|++|++|+++++++++| .+++
T Consensus        81 ~~~~~~~~~~~~~i~~~~kpvIa~v~G~a~GgG~~la~~~D~~ia~~~a~f~~pe~~~G~~p~~g~~~~l~~~~g~~~a~  160 (245)
T d2f6qa1          81 KNNAVLLREFVGCFIDFPKPLIAVVNGPAVGISVTLLGLFDAVYASDRATFHTPFSHLGQSPEGCSSYTFPKIMSPAKAT  160 (245)
T ss_dssp             HHHHHHHHHHHHHHHSCCSCEEEEECSCEETHHHHGGGGCSEEEEETTCEEECCTGGGTCCCCTTHHHHHHHHHCHHHHH
T ss_pred             chhhhHHHHHHhhhhhcCCceEEEECCccccccccchhhhhhhhhhccCeEecccccCCCCccccchhhcccccccchhh
Confidence            566667788999999999999999999999999999999999999999999999999999999999999999999 9999


Q ss_pred             HHhhcCCCCCHHHHHhcCccccccCCCCC
Q 041986          167 YLGLTGATLSGEEMLFCGLATHYSLSAVC  195 (195)
Q Consensus       167 ~l~l~g~~~~a~ea~~~Glv~~vv~~~~l  195 (195)
                      +++++|++++|+||+++||||+|+|++++
T Consensus       161 ~l~l~g~~~~a~eA~~~Glv~~vv~~~~l  189 (245)
T d2f6qa1         161 EMLIFGKKLTAGEACAQGLVTEVFPDSTF  189 (245)
T ss_dssp             HHHTTCCCEEHHHHHHTTSCSEEECTTTH
T ss_pred             hhcccccccccccccccccccccCCcchH
Confidence            99999999999999999999999999864



>d2fw2a1 c.14.1.3 (A:3-260) Chromodomain protein CDY2A {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pjha_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1mj3a_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wdka4 c.14.1.3 (A:1-310) Fatty oxidation complex alpha subunit, N-terminal domain {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d1wz8a1 c.14.1.3 (A:2-264) Probable enoyl-CoA hydratase TTHA0218 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1nzya_ c.14.1.3 (A:) 4-Chlorobenzoyl-CoA dehalogenase {Pseudomonas sp., strain CBS-3 [TaxId: 306]} Back     information, alignment and structure
>d2a7ka1 c.14.1.3 (A:1-230) Carbapenem biosynthes protein CarB {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1ef8a_ c.14.1.3 (A:) Methylmalonyl CoA decarboxylase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1uiya_ c.14.1.3 (A:) Enoyl-CoA hydratase (crotonase) {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1szoa_ c.14.1.3 (A:) 6-oxo camphor hydrolase {Rhodococcus erythropolis [TaxId: 1833]} Back     information, alignment and structure
>d1dcia_ c.14.1.3 (A:) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1hzda_ c.14.1.3 (A:) AUH protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sg4a1 c.14.1.3 (A:2-250) Dienoyl-CoA isomerase (delta3-delta2-enoyl-CoA isomerase) {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1q52a_ c.14.1.3 (A:) Naphthoate synthase MenB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2cbya1 c.14.1.1 (A:15-193) Clp protease, ClpP subunit {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1yg6a1 c.14.1.1 (A:11-193) Clp protease, ClpP subunit {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1y7oa1 c.14.1.1 (A:2-193) Clp protease, ClpP subunit {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2f6ia1 c.14.1.1 (A:177-366) Clp protease, ClpP subunit {Plasmodium falciparum [TaxId: 5833]} Back     information, alignment and structure
>d1tg6a1 c.14.1.1 (A:1-193) Clp protease, ClpP subunit {Human (Homo sapiens), mitochondrial [TaxId: 9606]} Back     information, alignment and structure
>d1on3a1 c.14.1.4 (A:8-260) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d2f9ya1 c.14.1.4 (A:4-319) Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha, AccA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xnya1 c.14.1.4 (A:10-267) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d2a7sa1 c.14.1.4 (A:20-277) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1vrga1 c.14.1.4 (A:1-251) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pixa2 c.14.1.4 (A:1-287) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d2f9yb1 c.14.1.4 (B:23-285) Acetyl-coenzyme A carboxylase carboxyl transferase subunit beta, AccD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2a7sa2 c.14.1.4 (A:278-548) Propionyl-CoA carboxylase complex B subunit, PccB {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1on3a2 c.14.1.4 (A:261-524) Methylmalonyl-CoA carboxyltransferase (transcarboxylase 12S) {Propionibacterium freudenreichii [TaxId: 1744]} Back     information, alignment and structure
>d1vrga2 c.14.1.4 (A:252-515) Propionyl-CoA carboxylase complex B subunit, PccB {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1xnya2 c.14.1.4 (A:268-530) Propionyl-CoA carboxylase complex B subunit, PccB {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1uyra1 c.14.1.4 (A:1482-1814) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1pixa3 c.14.1.4 (A:288-586) Glutaconyl-CoA decarboxylase A subunit {Acidaminococcus fermentans [TaxId: 905]} Back     information, alignment and structure
>d1uyra2 c.14.1.4 (A:1815-2218) Acetyl-coenzyme A carboxylase {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure