Citrus Sinensis ID: 042009

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260--
FFKKQKQEKGIGFGRCYISGVAGSFYDRLFPDKSLHFVHSSSSLHWLSQVPPALESNATPAALNKGKIYISKSSPQCVLDAYSLQFQNNFLIFLKSRAAEMVAGGRMVLSLMGRRSIDPTTEESCYQWELLAQALMSLVTERLIEEEKLDSFNAPYYAPCPEELKMAIQKEGSFIIDRLGHFEIDWDGGVEELTNTTLLPLSRGQRVAKTVRAVVESMFELHFGKAMMDLLFARYAEMVDDYLSKNRAKYINLVISIIKKDN
cccHHHHHcccccccEEEEEccccccccccccccccEEEccccccccccccccccccccccccccccEEEcccccHHHHHHHHHHHHHHHHHHHHccccHHccccEEEEEEccccccccccccccHHHHHHHHHHHHHHHHccccHHHHHccccccccccHHHHHHHHHHcccEEEEEEEEEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccccEEEEEEEEEEccc
F********GIGFGRCYISGVAGSFYDRLFPDKSLHFVHSSSSLHWLSQVPPALESNATPAALNKGKIYISKSSPQCVLDAYSLQFQNNFLIFLKSRAAEMVAGGRMVLSLMGRRSIDPTTEESCYQWELLAQALMSLVTERLIEEEKLDSFNAPYYAPCPEELKMAIQKEGSFIIDRLGHFEIDWDGGVEELTNTTLLPLSRGQRVAKTVRAVVESMFELHFGKAMMDLLFARYAEMVDDYLSKNRAKYINLVISIIKK**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
FFKKQKQEKGIGFGRCYISGVAGSFYDRLFPDKSLHFVHSSSSLHWLSQVPPALESNATPAALNKGKIYISKSSPQCVLDAYSLQFQNNFLIFLKSRAAEMVAGGRMVLSLMGRRSIDPTTEESCYQWELLAQALMSLVTERLIEEEKLDSFNAPYYAPCPEELKMAIQKEGSFIIDRLGHFEIDWDGGVEELTNTTLLPLSRGQRVAKTVRAVVESMFELHFGKAMMDLLFARYAEMVDDYLSKNRAKYINLVISIIKKDN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Jasmonate O-methyltransferase Catalyzes the methylation of jasmonate into methyljasmonate, a plant volatile that acts as an important cellular regulator mediating diverse developmental processes and defense responses.probableQ9AR07

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1M6E, chain X
Confidence level:very confident
Coverage over the Query: 14-261
View the alignment between query and template
View the model in PyMOL
Template: 2EG5, chain A
Confidence level:confident
Coverage over the Query: 1-118,130-260
View the alignment between query and template
View the model in PyMOL