Citrus Sinensis ID: 042034

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------45
MVLVTAARDYINRMLQDISGMKVLILDSQTVSAVSVVYSQSELLQKEVFLVELVDSIYKSKESMSHLKAVYFLRPSSENIQHLRRQLANPRFGEYHLFFSNMLKDTQIHILADSDEQEVVQQVQEFYADFVAVEPYHFTLNIPSNHLYMLPAVVDPSSLQHFCDRVVDGIAAVFLALKRRPVIRYQRTSDIAKRIAQETTKLMYQQESGLFDFRRTEISPLLLILDRRDDPVTPLLNQWTYQAMVHELIGIQDNKVDLRSIGDFPKDQQEVVLSSEQDTFFKANMYENFGDIGMNIKRMVDEFQQVAKSNQSIQTIEDMARFVENYPEYKKMHGNVSKHVTLVTEMSKMVEERKLMLVSETEQELACNGGQGAAFEAVTNLLNNENVSDIDRLRLVMLYALRYEKDSPVQLMQLFNKLASRSAKYKPGLVQFLLKQAGVDKRTGDLYGN
ccHHHHHHHHHHHHHcccccEEEEEEcccccHHHHccccHHHHHHccccHHHHcccccccccccccccEEEEEcccHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHccccccccEEEEEcccEECcccccEEEccccccccccccccccccHHHHHHHHHHHHHHHHHHHccccEEEECcccHHHHHHHHHHHHHHHHHccccccccccccccEEEEEccccccccccHHHHHHHHHHHHHHcccccEEEECccccccccccEEEccccccHHHHHHccccHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHccccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccccHHHHHHHHHHccccccccccccc
MVLVTAARDYINRMLQDISGMKVLILDSQTVSAVSVVYSQSELLQKEVFLVELVDSIYKSKESMSHLKAVYFLRPSSENIQHLRRQLANPRFGEYHLFFSNMLKDTQIHILADSDEQEVVQQVQEFYADFVAVEPYHFTLNIPSNHLYMLPAVVDPSSLQHFCDRVVDGIAAVFLALKRRPVIRYQRTSDIAKRIAQETTKLMYQQESGLFDFRRTEISPLLLILDRRDDPVTPLLNQWTYQAMVHELIGIQDNKVDLRSIGDFPKDQQEVVLSSEQDTFFKANMYENFGDIGMNIKRMVDEFQQVAKSNQSIQTIEDMARFVENYPEYKKMHGNVSKHVTLVTEMSKMVEERKLMLVSETEQELACNGGQGAAFEAVTNLLNNENVSDIDRLRLVMLYALRYEKDSPVQLMQLFNKLASRSAKYKPGLVQFLLKQAGV**********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVLVTAARDYINRMLQDISGMKVLILDSQTVSAVSVVYSQSELLQKEVFLVELVDSIYKSKESMSHLKAVYFLRPSSENIQHLRRQLANPRFGEYHLFFSNMLKDTQIHILADSDEQEVVQQVQEFYADFVAVEPYHFTLNIPSNHLYMLPAVVDPSSLQHFCDRVVDGIAAVFLALKRRPVIRYQRTSDIAKRIAQETTKLMYQQESGLFDFRRTEISPLLLILDRRDDPVTPLLNQWTYQAMVHELIGIQDNKVDLRSIGDFPKDQQEVVLSSEQDTFFKANMYENFGDIGMNIKRMVDEFQQVAKSNQSIQTIEDMARFVENYPEYKKMHGNVSKHVTLVTEMSKMVEERKLMLVSETEQELACNGGQGAAFEAVTNLLNNENVSDIDRLRLVMLYALRYEKDSPVQLMQLFNKLASRSAKYKPGLVQFLLKQAGVDKRTGDLYGN

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Vacuolar protein sorting-associated protein 45 homolog Involved in the protein transport to the vacuole, probably at the level of vesicle fusion at the trans-Golgi network (TGN) and not in transport from the TGN to the prevacuolar compartment. Binds syntaxins.probableO49048

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1EPU, chain A
Confidence level:very confident
Coverage over the Query: 2-258,270-441
View the alignment between query and template
View the model in PyMOL