Citrus Sinensis ID: 042044


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------22
MGRGKIEIKRIENLSNRQVTYSKRRNGLIKKAKEIAVLCDAKVSLIIFATSGKMHDYSSAPMFEILEAYHKQSGKKLWDAKHENLYNEIDRIKKENDSMQIKLRHLKGEDVTSLNHKELMALEDALENGLTGIRDKQSEMMERMRKNGKMLEEEHNYLKYVLRQQEIAKQQQQQMALENNVREIDPNGYHQRENDGYSSHMPLAFRVQPIQPNLQERI
ccccccccEEcccccccccccccccccHHHHHHHHHHcccccccEEEEEccccccccccccHHHHHHHHHHccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccc
MGRGKIEIKRIENLSNRQVTYSKRRNGLIKKAKEIAVLCDAKVSLIIFATSGKMHDYSSAPMFEILEAYHKQSGKKLWDAKHENLYNEIDRIKKENDSMQIKLRHLKGEDVTSLNHKELMALEDALENGLTGIRDKQSEMMERMRKNGKMLEEEHNYLKYVLRQQE************************************LAFRVQPIQP******
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGRGKIEIKRIENLSNRQVTYSKRRNGLIKKAKEIAVLCDAKVSLIIFATSGKMHDYSSAPMFEILEAYHKQSGxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxDVTSLNHKELMALEDALENGLTGIxxxxxxxxxxxxxxxxxxxxxHNYLKYVLRQQEIAKQQQQQMALENNVREIDPNGYHQRENDGYSSHMPLAFRVQPIQPNLQERI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Floral homeotic protein PISTILLATA Probable transcription factor involved in the genetic control of flower development. Is required for normal development of petals and stamens in the wild-type flower. Forms an heterodimer with APETALA3 that is required for autoregulation of both AP3 and PI genes. AP3/PI heterodimer interacts with APETALA1 or SEPALLATA3 to form a ternary complex that could be responsible for the regulation of the genes involved in the flower development. AP3/PI heterodimer activates the expression of NAP.probableP48007
MADS-box transcription factor 2 Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules (whorl 2).probableQ40702
Floral homeotic protein PMADS 2 Transcription factor involved in the genetic control of flower development.probableQ07474

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1MNM, chain A
Confidence level:very confident
Coverage over the Query: 1-81
View the alignment between query and template
View the model in PyMOL
Template: 1J1D, chain C
Confidence level:probable
Coverage over the Query: 109-153
View the alignment between query and template
View the model in PyMOL