Citrus Sinensis ID: 042048


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280------
MAEIATGMKTLMDFPHLGGGLIVSLEVGDWDGHQKRSLLIDHGLFEVIMLPFDRHLSPQNVRKVVSEADGYQPHLIAPEQGYRRLIDSALNYFRGPAEASVDAVHFVLKELVRRSIGETQELKRFPTLQSEIAAAANEALERFRDDSKKTTMRLVEMESSYLTVDFFRKLPQDIERVGNPTAPSAADRYTEGHFRRIGSNVSSYVGMVSETLKNTIPKAVVHCQVKEAKRSLLDHFYAQLGKKEGKQLAQLLDEDPMLMERRQQCAKRLELYKSARDEIDSVSWTR
cccHHHHHHHHHHHHHHHccccccccccccccHHHHHHHHHcccHHHccccccccccHHHHHHHHHHcccccccccccHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccccccccccccHHHHHHHcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccc
******GMKTLMDFPHLGGGLIVSLEVGDWDGHQKRSLLIDHGLFEVIMLPFDRHLSPQNVRKVVSEADGYQPHLIAPEQGYRRLIDSALNYFRGPAEASVDAVHFVLKELVRRSIGETQELKRFPTLQSEIAAAANEA***********TMRLVEMESSYLTVDFFRKLPQDIER************YTEGHFRRIGSNVSSYVGMVSETLKNTIPKAVVHCQVKEAKRSLLDHFYAQLGK*********LDEDPMLMERRQQCAKRLELYKSARDEIDSVSWT*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAEIATGMKTLMDFPHLGGGLIVSLEVGDWDGHQKRSLLIDHGLFEVIMLPFDRHLSPQNVRKVVSEADGYQPHLIAPEQGYRRLIDSALNYFRGPAEASVDAVHFVLKELVRRSIGETQELKRFPTLQSEIAAAANEALERFRDDSKKTTMRLVEMESSYLTVDFFRKLPQDIERVGNPTAPSAADRYTEGHFRRIGSNVSSYVGMVSETLKNTIPKAVVHCQVKEAKRSLLDHFYAQLGKKEGKQLAQLLDEDPMLMERRQQCAKRLELYKSARDEIDSVSWTR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Dynamin-related protein 1E Microtubule-associated force-producing protein that is targeted to the tubulo-vesicular network of the forming cell plate during cytokinesis. Plays also a major role in plasma membrane maintenance and cell wall integrity with an implication in vesicular trafficking, polar cell expansion, and other aspects of plant growth and development.probableQ9FNX5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3ZVR, chain A
Confidence level:very confident
Coverage over the Query: 9-280
View the alignment between query and template
View the model in PyMOL