Citrus Sinensis ID: 042053

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
GSRKQLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGFSY
cccccccccccccccccccccccccccHHHHHHHHHHcccEEEcHHHHHHHHHHHccccccccccccHHHHHHccccccEEcccccHHHHHHHHHHHHHcccHHHcHHHHHHHHHHHHHHHHHHHccccccccccccccEEccccccccccccccccccccccccccHHHHHHHHHHHccc
ccccccccccccccEEccHHHcccccHHHHHHHHHHHccHHHHHHHHHHHHHHHHccHHHcccccHHHHHHHHcccccEEEccccHHHHHHHHHHHHHHHccccccccccccccEEEEEHHHHcccccccccHHHcccHHHccccccEccccEEEEEcccccccccccHHHHHEEEEEHcc
gsrkqlppgprpypVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILldhdssfcnrtvpramsshqhyefslawmpvsrpwkSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYEsildnahyftperllgsdidfkgknfelipfgagwqiypglpLAIKMLYLGFSY
gsrkqlppgprpYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGFSY
GSRKQLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGFSY
**************VIRNLLEL*******LAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGF**
***KQLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGFSY
********GPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGFSY
****QLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGFSY
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
GSRKQLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKLASMAKSILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKNFELIPFGAGWQIYPGLPLAIKMLYLGFSY
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q8VWZ7 493 Geraniol 8-hydroxylase OS N/A no 0.624 0.229 0.455 8e-25
O23976 490 7-ethoxycoumarin O-deethy N/A no 0.640 0.236 0.412 8e-20
O64899 487 (S)-N-methylcoclaurine 3' N/A no 0.563 0.209 0.410 1e-19
O64900 488 (S)-N-methylcoclaurine 3' N/A no 0.563 0.209 0.410 1e-19
O64636512 Cytochrome P450 76C1 OS=A yes no 0.364 0.128 0.532 4e-18
D1MI46 495 Geraniol 8-hydroxylase OS N/A no 0.558 0.204 0.405 9e-18
Q9FXW4 488 Probable (S)-N-methylcocl N/A no 0.618 0.229 0.385 1e-17
O64635511 Cytochrome P450 76C4 OS=A no no 0.364 0.129 0.506 9e-17
O64637512 Cytochrome P450 76C2 OS=A no no 0.364 0.128 0.493 3e-16
Q9SD85 513 Flavonoid 3'-monooxygenas no no 0.823 0.290 0.293 2e-15
>sp|Q8VWZ7|C76B6_CATRO Geraniol 8-hydroxylase OS=Catharanthus roseus GN=CYP76B6 PE=1 SV=1 Back     alignment and function desciption
 Score =  113 bits (282), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 56/123 (45%), Positives = 80/123 (65%), Gaps = 10/123 (8%)

Query: 4   KQLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKL----------ASMAKSIL 53
           K LPPGP P P I +L  LG++PHKSLA+L+K HGPIMSLKL          ++MAK +L
Sbjct: 28  KNLPPGPSPLPFIGSLHLLGDQPHKSLAKLSKKHGPIMSLKLGQITTIVISSSTMAKEVL 87

Query: 54  LDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKC 113
              D +F +R+VP A+ +H  ++FS+ W+PV+  W+SLRK+ N +IF+   +     L+ 
Sbjct: 88  QKQDLAFSSRSVPNALHAHNQFKFSVVWLPVASRWRSLRKVLNSNIFSGNRLDANQHLRT 147

Query: 114 AKV 116
            KV
Sbjct: 148 RKV 150
Hydroxylase involved in the biosynthesis of hydroxygeraniol, a precursor of the terpenoid indole alkaloids such as vinblastine and vincristine. Also able to hydroxylate in vitro nerol and to catalyze 3'-hydroxylation of the flavanone naringenin to form eriodictyol. No activity with apigenin, kaempferol, p-coumaric acid and ferulic acid as substrates.
Catharanthus roseus (taxid: 4058)
EC: 1EC: .EC: 1EC: 4EC: .EC: 1EC: 3EC: .EC: 1EC: 5EC: 2
>sp|O23976|C76B1_HELTU 7-ethoxycoumarin O-deethylase OS=Helianthus tuberosus GN=CYP76B1 PE=1 SV=1 Back     alignment and function description
>sp|O64899|C80B1_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 1 (Fragment) OS=Eschscholzia californica GN=CYP80B1 PE=2 SV=1 Back     alignment and function description
>sp|O64900|C80B2_ESCCA (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Eschscholzia californica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|O64636|C76C1_ARATH Cytochrome P450 76C1 OS=Arabidopsis thaliana GN=CYP76C1 PE=2 SV=1 Back     alignment and function description
>sp|D1MI46|C76BA_SWEMU Geraniol 8-hydroxylase OS=Swertia mussotii GN=CYP76B10 PE=1 SV=1 Back     alignment and function description
>sp|Q9FXW4|C80B2_COPJA Probable (S)-N-methylcoclaurine 3'-hydroxylase isozyme 2 OS=Coptis japonica GN=CYP80B2 PE=2 SV=1 Back     alignment and function description
>sp|O64635|C76C4_ARATH Cytochrome P450 76C4 OS=Arabidopsis thaliana GN=CYP76C4 PE=3 SV=1 Back     alignment and function description
>sp|O64637|C76C2_ARATH Cytochrome P450 76C2 OS=Arabidopsis thaliana GN=CYP76C2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SD85|F3PH_ARATH Flavonoid 3'-monooxygenase OS=Arabidopsis thaliana GN=CYP75B1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
225427085 498 PREDICTED: cytochrome P450 76C4 [Vitis v 0.701 0.255 0.492 4e-31
297742026 594 unnamed protein product [Vitis vinifera] 0.701 0.213 0.492 4e-31
255537171 377 cytochrome P450, putative [Ricinus commu 0.635 0.305 0.512 1e-30
224058639 493 cytochrome P450 [Populus trichocarpa] gi 0.635 0.233 0.48 4e-28
359474275 499 PREDICTED: 7-ethoxycoumarin O-deethylase 0.618 0.224 0.524 8e-28
224071632 496 cytochrome P450 [Populus trichocarpa] gi 0.707 0.258 0.467 1e-27
356575857 501 PREDICTED: cytochrome P450 76C4-like [Gl 0.558 0.201 0.549 5e-27
359474277 499 PREDICTED: LOW QUALITY PROTEIN: 7-ethoxy 0.618 0.224 0.483 6e-27
356574422 522 PREDICTED: cytochrome P450 76C4-like [Gl 0.558 0.193 0.549 8e-27
356534205 309 PREDICTED: LOW QUALITY PROTEIN: 7-ethoxy 0.558 0.326 0.540 2e-26
>gi|225427085|ref|XP_002276561.1| PREDICTED: cytochrome P450 76C4 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  139 bits (351), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 69/140 (49%), Positives = 93/140 (66%), Gaps = 13/140 (9%)

Query: 5   QLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKL----------ASMAKSILL 54
           +LPPGP P+P+I NLL LG KPH+SLA LAKI+GP+MSLKL          A+MAK +L 
Sbjct: 32  KLPPGPVPFPIIGNLLNLGNKPHESLANLAKIYGPVMSLKLGCVTTVVITSATMAKEVLQ 91

Query: 55  DHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKCA 114
             D SFCNRT+P A+ +  H + S+ W+PVS  W++LRKICN HIFTN+++     L+  
Sbjct: 92  KKDQSFCNRTIPDALRALNHNQISMVWLPVSTKWRTLRKICNSHIFTNQKLDSSNYLRHQ 151

Query: 115 KV---LVNVWATVKYESILD 131
           KV   L NV  + +   ++D
Sbjct: 152 KVQDLLANVEQSCQAGDVVD 171

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|297742026|emb|CBI33813.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255537171|ref|XP_002509652.1| cytochrome P450, putative [Ricinus communis] gi|223549551|gb|EEF51039.1| cytochrome P450, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|224058639|ref|XP_002299579.1| cytochrome P450 [Populus trichocarpa] gi|222846837|gb|EEE84384.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|359474275|ref|XP_003631427.1| PREDICTED: 7-ethoxycoumarin O-deethylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224071632|ref|XP_002303546.1| cytochrome P450 [Populus trichocarpa] gi|222840978|gb|EEE78525.1| cytochrome P450 [Populus trichocarpa] Back     alignment and taxonomy information
>gi|356575857|ref|XP_003556053.1| PREDICTED: cytochrome P450 76C4-like [Glycine max] Back     alignment and taxonomy information
>gi|359474277|ref|XP_003631428.1| PREDICTED: LOW QUALITY PROTEIN: 7-ethoxycoumarin O-deethylase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|356574422|ref|XP_003555347.1| PREDICTED: cytochrome P450 76C4-like [Glycine max] Back     alignment and taxonomy information
>gi|356534205|ref|XP_003535648.1| PREDICTED: LOW QUALITY PROTEIN: 7-ethoxycoumarin O-deethylase-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
UNIPROTKB|Q8VWZ7 493 CYP76B6 "Geraniol 8-hydroxylas 0.624 0.229 0.455 2.3e-41
UNIPROTKB|D1MI46 495 CYP76B10 "Geraniol 8-hydroxyla 0.624 0.228 0.430 5.4e-40
TAIR|locus:2043699512 CYP76C1 ""cytochrome P450, fam 0.425 0.150 0.532 6.5e-34
TAIR|locus:2100982 498 CYP76C7 ""cytochrome P450, fam 0.635 0.230 0.341 1.5e-31
TAIR|locus:2043605512 CYP76C2 ""cytochrome P450, fam 0.408 0.144 0.513 1.9e-31
TAIR|locus:2043614 515 CYP76C3 ""cytochrome P450, fam 0.613 0.215 0.347 3.9e-30
TAIR|locus:2142878 513 TT7 "TRANSPARENT TESTA 7" [Ara 0.569 0.200 0.347 3.4e-26
TAIR|locus:2179280 496 CYP71B12 ""cytochrome P450, fa 0.574 0.209 0.325 8.2e-26
TAIR|locus:2179290 496 CYP71B13 ""cytochrome P450, fa 0.574 0.209 0.333 1.3e-25
TAIR|locus:2093531 501 CYP71B23 ""cytochrome P450, fa 0.580 0.209 0.344 2.3e-25
UNIPROTKB|Q8VWZ7 CYP76B6 "Geraniol 8-hydroxylase" [Catharanthus roseus (taxid:4058)] Back     alignment and assigned GO terms
 Score = 274 (101.5 bits), Expect = 2.3e-41, Sum P(2) = 2.3e-41
 Identities = 56/123 (45%), Positives = 80/123 (65%)

Query:     4 KQLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKL----------ASMAKSIL 53
             K LPPGP P P I +L  LG++PHKSLA+L+K HGPIMSLKL          ++MAK +L
Sbjct:    28 KNLPPGPSPLPFIGSLHLLGDQPHKSLAKLSKKHGPIMSLKLGQITTIVISSSTMAKEVL 87

Query:    54 LDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFIVLKC 113
                D +F +R+VP A+ +H  ++FS+ W+PV+  W+SLRK+ N +IF+   +     L+ 
Sbjct:    88 QKQDLAFSSRSVPNALHAHNQFKFSVVWLPVASRWRSLRKVLNSNIFSGNRLDANQHLRT 147

Query:   114 AKV 116
              KV
Sbjct:   148 RKV 150
GO:0016099 "monoterpenoid biosynthetic process" evidence=IDA
GO:0016709 "oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen" evidence=IDA
UNIPROTKB|D1MI46 CYP76B10 "Geraniol 8-hydroxylase" [Swertia mussotii (taxid:137888)] Back     alignment and assigned GO terms
TAIR|locus:2043699 CYP76C1 ""cytochrome P450, family 76, subfamily C, polypeptide 1"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2100982 CYP76C7 ""cytochrome P450, family 76, subfamily C, polypeptide 7"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043605 CYP76C2 ""cytochrome P450, family 76, subfamily C, polypeptide 2"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2043614 CYP76C3 ""cytochrome P450, family 76, subfamily C, polypeptide 3"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2142878 TT7 "TRANSPARENT TESTA 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179280 CYP71B12 ""cytochrome P450, family 71, subfamily B, polypeptide 12"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2179290 CYP71B13 ""cytochrome P450, family 71, subfamily B, polypeptide 13"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2093531 CYP71B23 ""cytochrome P450, family 71, subfamily B, polypeptide 23"" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
PLN02687 517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 2e-23
PLN03112 514 PLN03112, PLN03112, cytochrome P450 family protein 4e-16
PLN00110 504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-15
PLN02687517 PLN02687, PLN02687, flavonoid 3'-monooxygenase 1e-13
PLN02183 516 PLN02183, PLN02183, ferulate 5-hydroxylase 2e-11
PLN02183516 PLN02183, PLN02183, ferulate 5-hydroxylase 8e-11
pfam00067 461 pfam00067, p450, Cytochrome P450 2e-10
PLN00110504 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F 3e-10
PLN02966502 PLN02966, PLN02966, cytochrome P450 83A1 3e-10
PLN03234 499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-10
PLN02966 502 PLN02966, PLN02966, cytochrome P450 83A1 3e-09
PLN03234499 PLN03234, PLN03234, cytochrome P450 83B1; Provisio 4e-09
PLN02655 466 PLN02655, PLN02655, ent-kaurene oxidase 2e-07
PLN02394503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 3e-07
PLN02394 503 PLN02394, PLN02394, trans-cinnamate 4-monooxygenas 5e-07
pfam00067461 pfam00067, p450, Cytochrome P450 6e-06
PTZ00404 482 PTZ00404, PTZ00404, cytochrome P450; Provisional 7e-05
PLN00168519 PLN00168, PLN00168, Cytochrome P450; Provisional 2e-04
PLN03112514 PLN03112, PLN03112, cytochrome P450 family protein 0.002
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information 
 Score = 95.6 bits (238), Expect = 2e-23
 Identities = 45/117 (38%), Positives = 69/117 (58%), Gaps = 12/117 (10%)

Query: 3   RKQLPPGPRPYPVIRNLLELGEKPHKSLAELAKIHGPIMSLKL----------ASMAKSI 52
           ++ LPPGPR +PV+ NL +LG KPH ++A LAK +GP+  L+           AS+A   
Sbjct: 32  KRPLPPGPRGWPVLGNLPQLGPKPHHTMAALAKTYGPLFRLRFGFVDVVVAASASVAAQF 91

Query: 53  LLDHDSSFCNRTVPRAMSSHQHYEFS-LAWMPVSRPWKSLRKICNMHIFTNREIAGF 108
           L  HD++F NR  P + + H  Y +  L + P    W++LRKIC +H+F+ + +  F
Sbjct: 92  LRTHDANFSNRP-PNSGAEHMAYNYQDLVFAPYGPRWRALRKICAVHLFSAKALDDF 147

Length = 517
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|215371 PLN02687, PLN02687, flavonoid 3'-monooxygenase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|165828 PLN02183, PLN02183, ferulate 5-hydroxylase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|177725 PLN00110, PLN00110, flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|178550 PLN02966, PLN02966, cytochrome P450 83A1 Back     alignment and domain information
>gnl|CDD|178773 PLN03234, PLN03234, cytochrome P450 83B1; Provisional Back     alignment and domain information
>gnl|CDD|215354 PLN02655, PLN02655, ent-kaurene oxidase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215221 PLN02394, PLN02394, trans-cinnamate 4-monooxygenase Back     alignment and domain information
>gnl|CDD|215689 pfam00067, p450, Cytochrome P450 Back     alignment and domain information
>gnl|CDD|173595 PTZ00404, PTZ00404, cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215086 PLN00168, PLN00168, Cytochrome P450; Provisional Back     alignment and domain information
>gnl|CDD|215583 PLN03112, PLN03112, cytochrome P450 family protein; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
KOG0156489 consensus Cytochrome P450 CYP2 subfamily [Secondar 100.0
PLN00110 504 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional 100.0
PLN02971543 tryptophan N-hydroxylase 100.0
PLN02183516 ferulate 5-hydroxylase 100.0
PLN02655466 ent-kaurene oxidase 100.0
PLN02687 517 flavonoid 3'-monooxygenase 100.0
PLN02394503 trans-cinnamate 4-monooxygenase 100.0
PLN03234499 cytochrome P450 83B1; Provisional 100.0
PTZ00404482 cytochrome P450; Provisional 100.0
KOG0158499 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subf 100.0
PLN02500490 cytochrome P450 90B1 100.0
PLN03141452 3-epi-6-deoxocathasterone 23-monooxygenase; Provis 100.0
PLN03112514 cytochrome P450 family protein; Provisional 100.0
PLN02966502 cytochrome P450 83A1 100.0
PLN00168519 Cytochrome P450; Provisional 100.0
PF00067463 p450: Cytochrome P450 p450 superfamily signature b 100.0
PLN02774463 brassinosteroid-6-oxidase 100.0
PLN02290516 cytokinin trans-hydroxylase 100.0
PLN03018534 homomethionine N-hydroxylase 100.0
PLN02196463 abscisic acid 8'-hydroxylase 100.0
PLN02987472 Cytochrome P450, family 90, subfamily A 100.0
KOG0157497 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfami 100.0
PLN02302490 ent-kaurenoic acid oxidase 100.0
PLN02169500 fatty acid (omega-1)-hydroxylase/midchain alkane h 99.97
KOG0159519 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 99.97
PLN02738633 carotene beta-ring hydroxylase 99.97
PLN02936489 epsilon-ring hydroxylase 99.97
PLN03195516 fatty acid omega-hydroxylase; Provisional 99.96
KOG0684486 consensus Cytochrome P450 [Secondary metabolites b 99.95
PLN02648480 allene oxide synthase 99.94
PLN02426502 cytochrome P450, family 94, subfamily C protein 99.93
COG2124411 CypX Cytochrome P450 [Secondary metabolites biosyn 99.84
>KOG0156 consensus Cytochrome P450 CYP2 subfamily [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information 
Probab=100.00  E-value=2.4e-46  Score=293.89  Aligned_cols=178  Identities=36%  Similarity=0.666  Sum_probs=162.0

Q ss_pred             CCCCCCCCCCCccccccCCCCCC-cHHHHHHHHHHhCCcEEEechHH----------HHHHHhhCCcCcCCCCc-hhhcc
Q 042053            3 RKQLPPGPRPYPVIRNLLELGEK-PHKSLAELAKIHGPIMSLKLASM----------AKSILLDHDSSFCNRTV-PRAMS   70 (181)
Q Consensus         3 ~~~~ppgp~~~p~~G~~~~~~~~-~~~~~~~~~~~yG~v~~~~~~~~----------~~~~~~~~~~~~~~r~~-~~~~~   70 (181)
                      ++++||||.++|+|||++++... +|..+++++++||+|+.+|+|..          ++|++.+++..|++|+. .....
T Consensus        24 ~~~lPPGP~~lPiIGnl~~l~~~~~h~~~~~ls~~yGpi~tl~lG~~~~Vviss~~~akE~l~~~d~~fa~Rp~~~~~~~  103 (489)
T KOG0156|consen   24 RRNLPPGPPPLPIIGNLHQLGSLPPHRSFRKLSKKYGPVFTLRLGSVPVVVISSYEAAKEVLVKQDLEFADRPDPTATLK  103 (489)
T ss_pred             CCCCCcCCCCCCccccHHHcCCCchhHHHHHHHHHhCCeEEEEecCceEEEECCHHHHHHHHHhCCccccCCCCchhhHH
Confidence            47899999999999999999876 99999999999999999999997          89999999999999997 23445


Q ss_pred             ccccCCcceeeecCCCchHHHHHhhhhccccc------------------------------------------------
Q 042053           71 SHQHYEFSLAWMPVSRPWKSLRKICNMHIFTN------------------------------------------------  102 (181)
Q Consensus        71 ~~~~~~~~~~~~~~g~~w~~~r~~~~~~l~~~------------------------------------------------  102 (181)
                      .+..++.+++++++|+.||.+||++...+++.                                                
T Consensus       104 ~~~~~~~~i~~a~yG~~Wr~~Rr~~~~~L~~~~~~~~~~~~R~~E~~~l~~~l~~~~~~~~vdl~~~l~~~~~nvI~~~~  183 (489)
T KOG0156|consen  104 YLSYGGKGIVFAPYGDYWREMRRFALTELRSFGRGKSFMEIREEEVDELVKKLSKSKKGEPVDLSELLDLLVGNVICRML  183 (489)
T ss_pred             HhcCCCCceEeCCCcHHHHHHHHHHHHHhcChhhhhhhHHHHHHHHHHHHHHHHhcCCCceeeHHHHHHHHHHHHHHHHH
Confidence            56656889999989999999999999888766                                                


Q ss_pred             --------------------------------------------------------------------------------
Q 042053          103 --------------------------------------------------------------------------------  102 (181)
Q Consensus       103 --------------------------------------------------------------------------------  102 (181)
                                                                                                      
T Consensus       184 fG~rf~~~~~~~~~~~~~l~~~~~~~~~~~~~~d~~p~~l~~~~~~~g~~~~~~~~~~~~~~~~~~~i~eh~~~~~~~~~  263 (489)
T KOG0156|consen  184 FGRRFEEEDEEEFLELKELVEESLELLGSFNLSDYFPFLLRWLDGISGLEKRLKKVSKRLDEFLERIIDEHREKIGDEEG  263 (489)
T ss_pred             hCCccccCCchHHHHHHHHHHHHHHHhCCccHHHHhhHHHHhcccccHHHHHHHHHHHHHHHHHHHHHHHHHhhhccCCC
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 042053          103 --------------------------------------------------------------------------------  102 (181)
Q Consensus       103 --------------------------------------------------------------------------------  102 (181)
                                                                                                      
T Consensus       264 ~D~vD~lL~~~~~~~~~~~t~~~i~~~~~dl~~AGtdTta~Tl~Wa~a~Ll~~Pev~~K~qeEId~vvG~~r~v~e~D~~  343 (489)
T KOG0156|consen  264 RDFVDALLKLMKEEKAEGLTDDHLKALILDLFLAGTDTTATTLEWAMAELLNNPEVQKKLQEEIDEVVGKGRLVSESDLP  343 (489)
T ss_pred             CcHHHHHHHhhcccccCCCCHHHHHHHHHHHHhcccchHHHHHHHHHHHHHhCHHHHHHHHHHHHHHhCCCCCCChhhhc
Confidence                                                                                            


Q ss_pred             ------------------------------eeEccEEEecCcEEhhhHHhhhcCCCcCCCCCccCCccccCCCccccCCc
Q 042053          103 ------------------------------REIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKN  152 (181)
Q Consensus       103 ------------------------------~~~~g~~ip~g~~v~~~~~~~~~dp~~~~~p~~F~PeRfl~~~~~~~~~~  152 (181)
                                                    ++++||.|||||.|+++.|++|+||++|+||++|+||||++++ +.++..
T Consensus       344 ~lpYL~Avi~E~~Rl~p~~Pl~~ph~~~~d~~i~Gy~IPkgT~v~vn~~ai~rDp~vw~dP~eF~PERFl~~~-d~~~~~  422 (489)
T KOG0156|consen  344 KLPYLKAVIKETLRLHPPLPLLLPRETTEDTKIGGYDIPKGTTVLVNLWAIHRDPKVWEDPEEFKPERFLDSN-DGKGLD  422 (489)
T ss_pred             cCHHHHHHHHHHHhcCCCccccccccccCCeeEcCEEcCCCCEEEEeehhhhcCCccCCCccccChhhhcCCc-cccCCc
Confidence                                          8999999999999999999999999999999999999999986 333356


Q ss_pred             cceecccCCCccCCChHHHHHHHHhhhcC
Q 042053          153 FELIPFGAGWQIYPGLPLAIKMLYLGFSY  181 (181)
Q Consensus       153 ~~~~pFg~G~r~C~G~~~A~~~~~~~l~~  181 (181)
                      ..++|||.|+|.|||..+|++|+.+++|+
T Consensus       423 ~~~iPFG~GRR~CpG~~La~~~l~l~la~  451 (489)
T KOG0156|consen  423 FKLIPFGSGRRICPGEGLARAELFLFLAN  451 (489)
T ss_pred             eEecCCCCCcCCCCcHHHHHHHHHHHHHH
Confidence            88999999999999999999999999873

>PLN00110 flavonoid 3',5'-hydroxylase (F3'5'H); Provisional Back     alignment and domain information
>PLN02971 tryptophan N-hydroxylase Back     alignment and domain information
>PLN02183 ferulate 5-hydroxylase Back     alignment and domain information
>PLN02655 ent-kaurene oxidase Back     alignment and domain information
>PLN02687 flavonoid 3'-monooxygenase Back     alignment and domain information
>PLN02394 trans-cinnamate 4-monooxygenase Back     alignment and domain information
>PLN03234 cytochrome P450 83B1; Provisional Back     alignment and domain information
>PTZ00404 cytochrome P450; Provisional Back     alignment and domain information
>KOG0158 consensus Cytochrome P450 CYP3/CYP5/CYP6/CYP9 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02500 cytochrome P450 90B1 Back     alignment and domain information
>PLN03141 3-epi-6-deoxocathasterone 23-monooxygenase; Provisional Back     alignment and domain information
>PLN03112 cytochrome P450 family protein; Provisional Back     alignment and domain information
>PLN02966 cytochrome P450 83A1 Back     alignment and domain information
>PLN00168 Cytochrome P450; Provisional Back     alignment and domain information
>PF00067 p450: Cytochrome P450 p450 superfamily signature b-class p450 signature mitochondrial p450 signature E-class p450 group I signature E-class p450 group II signature E-class p450 group IV signature; InterPro: IPR001128 Cytochrome P450 enzymes are a superfamily of haem-containing mono-oxygenases that are found in all kingdoms of life, and which show extraordinary diversity in their reaction chemistry Back     alignment and domain information
>PLN02774 brassinosteroid-6-oxidase Back     alignment and domain information
>PLN02290 cytokinin trans-hydroxylase Back     alignment and domain information
>PLN03018 homomethionine N-hydroxylase Back     alignment and domain information
>PLN02196 abscisic acid 8'-hydroxylase Back     alignment and domain information
>PLN02987 Cytochrome P450, family 90, subfamily A Back     alignment and domain information
>KOG0157 consensus Cytochrome P450 CYP4/CYP19/CYP26 subfamilies [Secondary metabolites biosynthesis, transport and catabolism; Lipid transport and metabolism] Back     alignment and domain information
>PLN02302 ent-kaurenoic acid oxidase Back     alignment and domain information
>PLN02169 fatty acid (omega-1)-hydroxylase/midchain alkane hydroxylase Back     alignment and domain information
>KOG0159 consensus Cytochrome P450 CYP11/CYP12/CYP24/CYP27 subfamilies [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02738 carotene beta-ring hydroxylase Back     alignment and domain information
>PLN02936 epsilon-ring hydroxylase Back     alignment and domain information
>PLN03195 fatty acid omega-hydroxylase; Provisional Back     alignment and domain information
>KOG0684 consensus Cytochrome P450 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PLN02648 allene oxide synthase Back     alignment and domain information
>PLN02426 cytochrome P450, family 94, subfamily C protein Back     alignment and domain information
>COG2124 CypX Cytochrome P450 [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
1r9o_A 477 Crystal Structure Of P4502c9 With Flurbiprofen Boun 1e-06
1og2_A 475 Structure Of Human Cytochrome P450 Cyp2c9 Length = 5e-06
4gqs_A 477 Structure Of Human Microsomal Cytochrome P450 (cyp) 8e-06
3e4e_A 476 Human Cytochrome P450 2e1 In Complex With The Inhib 2e-05
1dt6_A 473 Structure Of Mammalian Cytochrome P450 2c5 Length = 3e-05
2pg6_A 476 Crystal Structure Of Human Microsomal P450 2a6 L240 7e-05
3ebs_A 476 Human Cytochrome P450 2a6 I208sI300FG301AS369G IN C 7e-05
1z10_A 476 Crystal Structure Of Human Microsomal P450 2a6 With 7e-05
2pg7_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 7e-05
2pg5_A 476 Crystal Structure Of Human Microsomal P450 2a6 N297 7e-05
2p85_A 476 Structure Of Human Lung Cytochrome P450 2a13 With I 7e-05
1pq2_A 476 Crystal Structure Of Human Drug Metabolizing Cytoch 2e-04
4i8v_A 491 Human Cytochrome P450 1a1 In Complex With Alpha-nap 6e-04
>pdb|1R9O|A Chain A, Crystal Structure Of P4502c9 With Flurbiprofen Bound Length = 477 Back     alignment and structure 
Iteration: 1

 Score = 49.3 bits (116), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 52/107 (48%), Gaps = 15/107 (14%)
Query: 3   RKQLPPGPRPYPVIRNLLELGEKP-HKSLAELAKIHGPIMSLKLA----------SMAKS 51
           R +LPPGP P PVI N+L++G K   KSL  L+K++GP+ +L                K 
Sbjct: 9   RGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKE 68
Query: 52  ILLDHDSSFCNRTV-PRAMSSHQHYEFSLAWMPVSRPWKSLRKICNM 97
            L+D    F  R + P A  +++ +    +     + WK +R+   M
Sbjct: 69  ALIDLGEEFSGRGIFPLAERANRGFGIVFSN---GKKWKEIRRFSLM 112
>pdb|1OG2|A Chain A, Structure Of Human Cytochrome P450 Cyp2c9 Length = 475 Back     alignment and structure
>pdb|4GQS|A Chain A, Structure Of Human Microsomal Cytochrome P450 (cyp) 2c19 Length = 477 Back     alignment and structure
>pdb|3E4E|A Chain A, Human Cytochrome P450 2e1 In Complex With The Inhibitor 4- Methylpyrazole Length = 476 Back     alignment and structure
>pdb|1DT6|A Chain A, Structure Of Mammalian Cytochrome P450 2c5 Length = 473 Back     alignment and structure
>pdb|2PG6|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 L240cN297Q Length = 476 Back     alignment and structure
>pdb|3EBS|A Chain A, Human Cytochrome P450 2a6 I208sI300FG301AS369G IN COMPLEX With Phenacetin Length = 476 Back     alignment and structure
>pdb|1Z10|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 With Coumarin Bound Length = 476 Back     alignment and structure
>pdb|2PG7|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297qI300V Length = 476 Back     alignment and structure
>pdb|2PG5|A Chain A, Crystal Structure Of Human Microsomal P450 2a6 N297q Length = 476 Back     alignment and structure
>pdb|2P85|A Chain A, Structure Of Human Lung Cytochrome P450 2a13 With Indole Bound In Two Alternate Conformations Length = 476 Back     alignment and structure
>pdb|1PQ2|A Chain A, Crystal Structure Of Human Drug Metabolizing Cytochrome P450 2c8 Length = 476 Back     alignment and structure
>pdb|4I8V|A Chain A, Human Cytochrome P450 1a1 In Complex With Alpha-naphthoflavone Length = 491 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
3n9y_A 487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 3e-21
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 2e-09
3b98_A 475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-18
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 2e-08
3k9v_A 482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 2e-17
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 3e-08
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 1e-16
3dax_A 491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-15
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 2e-08
3swz_A 494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 2e-14
2hi4_A 495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 5e-14
3czh_A 481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 2e-13
3e6i_A 476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 5e-13
3tbg_A 479 Cytochrome P450 2D6; monooxygenase, thioridazine, 5e-13
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 3e-04
3qz1_A 496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 2e-11
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 6e-04
1r9o_A 477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 2e-11
1po5_A 476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-11
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 3e-04
2fdv_A 476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 6e-11
3b6h_A 498 Prostacyclin synthase; enzyme-inhibitor complex, C 4e-09
2cib_A 455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-08
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 1e-04
3s79_A 503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 7e-07
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 2e-06
2ij2_A 470 Cytochrome P450 BM3; monoxygenase, heme binding pr 6e-06
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 2e-05
3dbg_A 467 Putative cytochrome P450; cytochrome P450 oxidored 9e-05
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 1e-04
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 1e-04
3i3k_A 461 Lanosterol 14-alpha demethylase; cytochrome P450, 4e-04
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
 Score = 88.9 bits (221), Expect = 3e-21
 Identities = 19/120 (15%), Positives = 34/120 (28%), Gaps = 15/120 (12%)

Query: 5   QLPPGPRPYPVIRNLLELGE----KPHKSLAELAKIHGPIMSLKL----------ASMAK 50
              P P     +       E    K H    +  + +GPI   KL               
Sbjct: 9   NEIPSPGDNGWLNLYHFWRETGTHKVHLHHVQNFQKYGPIYREKLGNVESVYVIDPEDVA 68

Query: 51  SILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRP-WKSLRKICNMHIFTNREIAGFI 109
            +      +     +P  ++ HQ+Y+  +  +      WK  R   N  +        F+
Sbjct: 69  LLFKSEGPNPERFLIPPWVAYHQYYQRPIGVLLKKSAAWKKDRVALNQEVMAPEATKNFL 128
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Length = 487 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Length = 475 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Length = 482 Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Length = 507 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Length = 491 Back     alignment and structure
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Length = 494 Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Length = 495 Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Length = 481 Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Length = 476 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Length = 479 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Length = 496 Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Length = 477 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Length = 476 Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Length = 476 Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Length = 498 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Length = 455 Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* Length = 503 Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Length = 415 Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Length = 470 Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Length = 417 Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Length = 467 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Length = 444 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
3tbg_A479 Cytochrome P450 2D6; monooxygenase, thioridazine, 100.0
3swz_A494 Steroid 17-alpha-hydroxylase/17,20 lyase; cytochro 100.0
3ld6_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3e6i_A476 CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, mono 100.0
3pm0_A 507 Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase 100.0
3nxu_A485 Cytochrome P450 3A4; alpha beta protein, cytochrom 100.0
3i3k_A461 Lanosterol 14-alpha demethylase; cytochrome P450, 100.0
3k9v_A482 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitocho 100.0
1po5_A476 Cytochrome P450 2B4; oxidoreductase, membrane prot 100.0
3czh_A481 Cytochrome P450 2R1; vitamin D, vitamin S 25-hydro 100.0
2fdv_A476 Cytochrome P450 2A6; CYP2A6, monooxygenase, drug m 100.0
1r9o_A477 Cytochrome P450 2C9; monooxygenase, drug metaboliz 100.0
2hi4_A495 Cytochrome P450 1A2; CYP1A2, monooxygenase, drug m 100.0
3s79_A503 Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD 100.0
3dbg_A467 Putative cytochrome P450; cytochrome P450 oxidored 100.0
2ve3_A444 Putative cytochrome P450 120; oxidoreductase, mono 100.0
2cib_A455 Cytochrome P450 51; heme, heme lipid synthesis, me 100.0
3qz1_A496 Steroid 21-hydroxylase; P450 monooxygenase, oxidor 100.0
3n9y_A487 Cholesterol SIDE-chain cleavage enzyme; cytochrome 100.0
3gw9_A 450 Sterol 14alpha-demethylase; CYP51, cytochrome P450 100.0
3v8d_A491 Cholesterol 7-alpha-monooxygenase; cytochrome, oxi 100.0
1jfb_A404 Nitric-oxide reductase cytochrome P450 55A1; cytoc 100.0
3dax_A491 Cytochrome P450 7A1; cholesterol, cholesterol 7-al 99.98
2cd8_A436 Cytochrome P450 monooxygenase; oxidoreductase, PIK 99.98
2ij2_A470 Cytochrome P450 BM3; monoxygenase, heme binding pr 99.98
3b98_A475 Prostaglandin I2 synthase; prostacyclin synthase, 99.97
3mdm_A456 Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, th 99.97
3b6h_A498 Prostacyclin synthase; enzyme-inhibitor complex, C 99.97
1ued_A406 P450 OXYC, P450 monooxygenase; cytochrome P450 van 99.97
4fb2_A398 P450CIN; heme, monooxygenase, cindoxin, oxidoreduc 99.96
3dsk_A495 Cytochrome P450 74A, chloroplast; P450 fold, fatty 99.96
2zbx_A412 Cytochrome P450-SU1; beta prism, heme, iron, metal 99.96
1izo_A417 P450bsbeta, cytochrome P450 152A1; heme protein, p 99.96
3awm_A415 Fatty acid alpha-hydroxylase; cytochrome P450, per 99.96
1n97_A389 CYP175A1; electron transport; HET: SRT HEM; 1.80A 99.96
3ivy_A433 Cytochrome P450 CYP125; cholesterol, monooxygenase 99.96
3nc3_A441 Cytochrome P450 CYPX; cytochrome P450 oxidase, HAE 99.96
3oft_A396 Cytochrome P450, CYP101C1; oxidoreductase; HET: HE 99.96
1cpt_A428 Cytochrome P450-TERP; oxidoreductase(oxygenase); H 99.95
3dan_A473 Cytochrome P450 74A2; AOS heme cytochrome P450 str 99.95
3tyw_A417 Putative cytochrome P450; P450 monooxygenase, oxid 99.95
1s1f_A406 Putative cytochrome P450; cytochrome P450 oxidored 99.95
3ejb_B404 Biotin biosynthesis cytochrome P450-like enzyme; p 99.95
3abb_A408 CYP105D6, cytochrome P450 hydroxylase; oxidoreduct 99.95
2zwu_A415 Camphor 5-monooxygenase; P450CAM, camphor-hydroxyl 99.95
4dnj_A412 Putative cytochrome P450; oxidoreductase; HET: HEM 99.95
3lxh_A421 Cytochrome P450; heme, iron, metal-binding, monoox 99.95
3aba_A403 Cytochrome P450; oxidoreductase, heme, monooxygena 99.95
3a4g_A411 Vitamin D hydroxylase; cytochrome P450, hemoprotei 99.95
2y5n_A417 MYCG, P-450-like protein; oxidoreductase, mycinami 99.94
1z8o_A404 6-deoxyerythronolide B hydroxylase; heme, CYP, ery 99.94
3mgx_A415 Putative P450 monooxygenase; cytochrome P450 oxida 99.94
2z36_A413 MOXA, cytochrome P450 type compactin 3'',4''- hydr 99.94
3rwl_A426 Cytochrome P450 alkane hydroxylase 1 CYP153A7; P45 99.94
2xkr_A398 CYP142, putative cytochrome P450 142; oxidoreducta 99.94
2jjn_A411 Cytochrome P450 113A1; oxidoreductase, iron, heme, 99.94
1gwi_A411 CYP154C1, cytochrome P450 154C1; oxidoreductase, m 99.94
2z3t_A425 Cytochrome P450; monoxygenase, oxydoreductase, hem 99.94
3tkt_A450 Cytochrome P450; aromatic hydrocarbon binding of P 99.94
3r9b_A418 Cytochrome P450 164A2; monooxygenase, oxidoreducta 99.94
3buj_A397 CALO2; heme, iron, metal-binding, monooxygenase, o 99.93
2xbk_A404 PIMD protein; epoxidation, oxidoreductase; HET: HE 99.93
1odo_A408 Putative cytochrome P450 154A1; P450 monooxygenase 99.93
3oo3_A384 OXY protein; cytochrome P450, monooxygenase, PCD-t 99.93
2dkk_A411 Cytochrome P450; CYP158A1, INHI oxidoreductase; HE 99.93
2uuq_A414 CYP130, cytochrome P450 130; iron, heme, monooxyge 99.93
4dxy_A417 Cytochrome P450, CYP101D2; cytochrome P450 mutant, 99.92
2wiy_A394 XPLA-heme, cytochrome P450-like protein XPLA; CYT- 99.92
2wm5_A435 CYP124, putative cytochrome P450 124; metal-bindin 99.92
1n40_A396 P450 MT2, cytochrome P450 121; heme binding, oxyge 99.88
3b4x_A367 367AA long hypothetical cytochrome P450; HEM prote 99.87
1lfk_A398 OXYB, P450 monooxygenase; oxidative phenol couplin 99.87
2rfb_A343 Cytochrome P450; heme, iron, metal-binding, monoox 99.87
1io7_A368 Cytochrome P450 CYP119; thermophilic, cytochromo P 99.86
1q5d_A419 P450 epoxidase; cytochrome P450, epothilone, oxydo 99.85
3p3o_A416 Cytochrome P450; monooxygenase, oxidoreductase; HE 99.84
2yjn_B381 Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; 99.82
1q5d_A 419 P450 epoxidase; cytochrome P450, epothilone, oxydo 96.75
3b4x_A 367 367AA long hypothetical cytochrome P450; HEM prote 96.75
1io7_A 368 Cytochrome P450 CYP119; thermophilic, cytochromo P 96.42
1n40_A 396 P450 MT2, cytochrome P450 121; heme binding, oxyge 96.4
1lfk_A 398 OXYB, P450 monooxygenase; oxidative phenol couplin 95.23
2rfb_A 343 Cytochrome P450; heme, iron, metal-binding, monoox 94.08
3p3o_A 416 Cytochrome P450; monooxygenase, oxidoreductase; HE 91.93
>3tbg_A Cytochrome P450 2D6; monooxygenase, thioridazine, oxidoreductase; HET: RTZ HEM; 2.10A {Homo sapiens} PDB: 3qm4_A* 2f9q_A* Back     alignment and structure
Probab=100.00  E-value=2.3e-46  Score=294.82  Aligned_cols=178  Identities=26%  Similarity=0.427  Sum_probs=154.0

Q ss_pred             CCCCCCCCCCCCccccccCCCC-CCcHHHHHHHHHHhCCcEEEechHH----------HHHHHhhCCcCcCCCCchhhcc
Q 042053            2 SRKQLPPGPRPYPVIRNLLELG-EKPHKSLAELAKIHGPIMSLKLASM----------AKSILLDHDSSFCNRTVPRAMS   70 (181)
Q Consensus         2 ~~~~~ppgp~~~p~~G~~~~~~-~~~~~~~~~~~~~yG~v~~~~~~~~----------~~~~~~~~~~~~~~r~~~~~~~   70 (181)
                      |+.++||||.++|+|||++++. .+++..+.+|+++||+||++++++.          +++++.+++..|++|+......
T Consensus         7 s~~kLPPGP~~lP~iGn~~~~~~~~~~~~~~~~~~kYG~i~~~~~g~~~~vvv~~p~~i~~vl~~~~~~f~~r~~~~~~~   86 (479)
T 3tbg_A            7 SKGKLPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTPVVVLNGLAAVREALVTHGEDTADRPPVPITQ   86 (479)
T ss_dssp             --CCCCCCSCCBTTTBTGGGCCTTSHHHHHHHHHHHHCSEEEEEETTEEEEEEEHHHHHHHHHTTTGGGSCBCCCCGGGG
T ss_pred             CCCCCCCCCCCcCcccchHhhcCCCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCChhhcCCCchHHHH
Confidence            3557999999999999999985 7889999999999999999998876          8899999999999888766555


Q ss_pred             cccc--CCcceeeecCCCchHHHHHhhhhccccc----------------------------------------------
Q 042053           71 SHQH--YEFSLAWMPVSRPWKSLRKICNMHIFTN----------------------------------------------  102 (181)
Q Consensus        71 ~~~~--~~~~~~~~~~g~~w~~~r~~~~~~l~~~----------------------------------------------  102 (181)
                      .+..  .+.+++++.+|+.|+++|+++.+.+...                                              
T Consensus        87 ~~~~~~~~~~~~~~~~g~~w~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~  166 (479)
T 3tbg_A           87 ILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIAS  166 (479)
T ss_dssp             GGTCBTTBCCSTTCCSSHHHHHHHHHHHHHHHHTTSTTCHHHHHHHHHHHHHHHHHHTTTTCCBCTHHHHHHHHHHHHHH
T ss_pred             HhccCCCCCceeeCCCCHHHHHHHHHHHHHhcchhhhHHHHHHHHHHHHHHHHHHHHhccCCcccHHHHHHHHHHHHHHH
Confidence            4432  2455677777999999999988655332                                              


Q ss_pred             --------------------------------------------------------------------------------
Q 042053          103 --------------------------------------------------------------------------------  102 (181)
Q Consensus       103 --------------------------------------------------------------------------------  102 (181)
                                                                                                      
T Consensus       167 ~~fg~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~  246 (479)
T 3tbg_A          167 LTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLLHIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPP  246 (479)
T ss_dssp             HHHSCCCCTTCHHHHHHHHHHHHHHHTTSSHHHHHHHHSGGGGGSHHHHHHHTHHHHHHHHHHHHHHHHHHHHCCTTSCC
T ss_pred             hhcCCcccccchhhhhhhhhhhhhhhhhhhhhhhhhcccchhccchhhHHHHHHHHHHHHHHHHHHHHHHHHhhhccccc
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 042053          103 --------------------------------------------------------------------------------  102 (181)
Q Consensus       103 --------------------------------------------------------------------------------  102 (181)
                                                                                                      
T Consensus       247 ~d~~~~~~~~~~~~~~~~~~~l~~~~i~~~~~~~~~AG~dTta~~l~~~l~~L~~~P~~q~kl~~Ei~~~~~~~~~~~~~  326 (479)
T 3tbg_A          247 RDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMVTTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMG  326 (479)
T ss_dssp             CSHHHHHHHHHHHTTTCTTCSCSHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCHH
T ss_pred             chhhhhhhhhhhhcccCCccchhhHHHHHHHHHHHHhhhhhhHHHHHHHHHHhccCHHHHHHHHHHHHHHHhhccccchh
Confidence                                                                                            


Q ss_pred             ---------------------------------eeEccEEEecCcEEhhhHHhhhcCCCcCCCCCccCCccccCCCcccc
Q 042053          103 ---------------------------------REIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFK  149 (181)
Q Consensus       103 ---------------------------------~~~~g~~ip~g~~v~~~~~~~~~dp~~~~~p~~F~PeRfl~~~~~~~  149 (181)
                                                       ++++||.|||||.|.++.+++|+||++|+||++|+||||++++.+..
T Consensus       327 ~l~~lpyl~avi~EtlRl~p~~~~~~~~~~~~d~~~~g~~IP~Gt~V~~~~~~~h~d~~~~~dP~~F~PeRfl~~~~~~~  406 (479)
T 3tbg_A          327 DQAHMPYTTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFV  406 (479)
T ss_dssp             HHTTCHHHHHHHHHHHHHHCSSTTCCCEECSSCEEETTEEECTTCEEEEEHHHHHTCTTTSSSTTSCCGGGGBCTTCCBC
T ss_pred             hhccccccccceeeeccccccccccceeecCCCceECCEEecCCCeeeechhhhcCChhhCCCccccCccccCCCCcccC
Confidence                                             78899999999999999999999999999999999999998876655


Q ss_pred             CCccceecccCCCccCCChHHHHHHHHhhhc
Q 042053          150 GKNFELIPFGAGWQIYPGLPLAIKMLYLGFS  180 (181)
Q Consensus       150 ~~~~~~~pFg~G~r~C~G~~~A~~~~~~~l~  180 (181)
                       ++.+|+|||+|+|.|+|++||++|++++||
T Consensus       407 -~~~~~~pFG~G~R~C~G~~lA~~e~~~~la  436 (479)
T 3tbg_A          407 -KPEAFLPFSAGRRACLGEPLARMELFLFFT  436 (479)
T ss_dssp             -CCTTCCTTCCSTTSCTTHHHHHHHHHHHHH
T ss_pred             -CCCceecCCCCCcCChhHHHHHHHHHHHHH
Confidence             568899999999999999999999999987
>3swz_A Steroid 17-alpha-hydroxylase/17,20 lyase; cytochrome P450, CYP17A1, P450C17, P450 17A1, monooxyg 17A-hydroxylase, heme protein; HET: HEM TOK; 2.40A {Homo sapiens} PDB: 3ruk_A* Back     alignment and structure
>3ld6_A Lanosterol 14-alpha demethylase; cytochrome P450, ketoconazole, S genomics, structural genomics consortium, SGC; HET: HEM KKK BCD; 2.80A {Homo sapiens} PDB: 3juv_A* 3jus_A* Back     alignment and structure
>3e6i_A CYPIIE1, P450-J, cytochrome P450 2E1; CYP2E1, monooxygenase, acetaminophen, oxidoreductase, heme, endoplasmic reticulum, iron, membrane; HET: HEM; 2.20A {Homo sapiens} PDB: 3e4e_A* 3gph_A* 3koh_A* 3lc4_A* 3t3z_A* Back     alignment and structure
>3pm0_A Cypib1, cytochrome P450 1B1; CYP1B1, monooxygenase, alpha-naphthoflavone, 17BETA-estradiol, oxidoreductase; HET: HEM BHF; 2.70A {Homo sapiens} Back     alignment and structure
>3nxu_A Cytochrome P450 3A4; alpha beta protein, cytochrome P450 fold, hemoprotein, monoo cytochrome P450 reductase, endoplasmic reticulum; HET: HEM RIT; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1w0e_A* 1w0g_A* 2j0d_A* 2v0m_A* 1w0f_A* 1tqn_A* 3ua1_A* 3tjs_A* Back     alignment and structure
>3k9v_A 1,25-dihydroxyvitamin D(3) 24-hydroxylase, mitochondrial; mitochondrial cytochrome P450, monotopic membrane protein, monooxygenase; HET: HEM CPS; 2.50A {Rattus norvegicus} PDB: 3k9y_A* Back     alignment and structure
>1po5_A Cytochrome P450 2B4; oxidoreductase, membrane protein, CYP 2B4, CYP LM2, cytochro monooxygenase; HET: HEM; 1.60A {Oryctolagus cuniculus} SCOP: a.104.1.1 PDB: 3mvr_A* 2bdm_A* 3g5n_A* 3g93_A* 3kw4_A* 3me6_A* 1suo_A* 3r1a_A* 3r1b_A* 2q6n_A* 3tk3_A* 3ibd_A* 3qoa_A* 3qu8_A* Back     alignment and structure
>3czh_A Cytochrome P450 2R1; vitamin D, vitamin S 25-hydroxylase, drug metabolism, structural genomics, structural genomics consortium, SGC; HET: BCD HEM D2V; 2.30A {Homo sapiens} SCOP: a.104.1.1 PDB: 2ojd_A* 3c6g_A* 3dl9_A* Back     alignment and structure
>2fdv_A Cytochrome P450 2A6; CYP2A6, monooxygenase, drug metabolizing enzyme, coumarin 7-hydroxylase, nicotine oxidase, oxidoreductase; HET: HEM D2G; 1.65A {Homo sapiens} PDB: 1z11_A* 1z10_A* 2fdu_A* 2fdw_A* 2fdy_A* 3t3r_A* 2pg5_A* 2pg7_A* 2pg6_A* 3t3q_A* 3ebs_A* 2p85_A* 3t3s_A* Back     alignment and structure
>1r9o_A Cytochrome P450 2C9; monooxygenase, drug metabolizing enzyme, oxidoreductas; HET: HEM FLP; 2.00A {Homo sapiens} SCOP: a.104.1.1 PDB: 1og5_A* 1og2_A* 2nnj_A* 1pq2_A* 2nni_A* 2nnh_A* 2vn0_A* 1nr6_A* 1dt6_A* 1n6b_A* Back     alignment and structure
>2hi4_A Cytochrome P450 1A2; CYP1A2, monooxygenase, drug metabolizing enzyme, alpha-naphthoflavone, benzo(H)flavone, 7,8- benzoflavone, oxidoreductase; HET: HEM BHF; 1.95A {Homo sapiens} Back     alignment and structure
>3s79_A Cytochrome P450 19A1; oxidoreductase; HET: HEM ASD; 2.75A {Homo sapiens} PDB: 3eqm_A* 3s7s_A* 4gl5_A* 4gl7_A* Back     alignment and structure
>3dbg_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP170A1, molecular mechanism, heme, iron, metal-binding, monooxygenase; HET: HEM; 2.60A {Streptomyces coelicolor A3} PDB: 3el3_A* Back     alignment and structure
>2ve3_A Putative cytochrome P450 120; oxidoreductase, monooxygenase, metal-binding, heme, iron; HET: HEM REA; 2.10A {Synechocystis SP} PDB: 2ve4_A* Back     alignment and structure
>2cib_A Cytochrome P450 51; heme, heme lipid synthesis, metal-binding, monooxygenase, NADP, oxidoreductase, protein-inhibitor complex; HET: HEM CM6; 1.50A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 2bz9_A* 1x8v_A* 2ci0_A* 2vku_A* 2w09_A* 2w0b_A* 2w0a_A* 1h5z_A* 1ea1_A* 1e9x_A* 1u13_A* Back     alignment and structure
>3qz1_A Steroid 21-hydroxylase; P450 monooxygenase, oxidoreductase; HET: HEM 3QZ; 3.00A {Bos taurus} Back     alignment and structure
>3n9y_A Cholesterol SIDE-chain cleavage enzyme; cytochrome P450, cholesterol SIDE chain cleavage, structural genomics, structural genomics consortium, SGC; HET: HEM CLR; 2.10A {Homo sapiens} PDB: 3n9z_A* 3na1_A* 3na0_A* 3mzs_A* Back     alignment and structure
>3gw9_A Sterol 14alpha-demethylase; CYP51, cytochrome P450, heme, oxidoreductase, monooxygenase, sterol biosynthesis, lipids, endoplasmic reticulum; HET: HEM VNI; 1.87A {Trypanosoma brucei} PDB: 3tik_A* 3g1q_A* 3p99_A* 2wv2_A* 2x2n_A* 3khm_A* 3k1o_A* 3ksw_A* 2wx2_A* 2wuz_A* 3l4d_A* Back     alignment and structure
>3v8d_A Cholesterol 7-alpha-monooxygenase; cytochrome, oxidoreductase; HET: HEM 0GV; 1.90A {Homo sapiens} PDB: 3sn5_A* 3dax_A* Back     alignment and structure
>1jfb_A Nitric-oxide reductase cytochrome P450 55A1; cytochrome P450NOR, atomic resolutio structural genomics/proteomics initiative, RSGI; HET: HEM; 1.00A {Fusarium oxysporum} SCOP: a.104.1.1 PDB: 1jfc_A* 1gej_A* 1ged_A* 1ehe_A* 1gei_A* 1rom_A* 2rom_A* 1ehf_A* 1cl6_A* 1ehg_A* 1cmj_A* 1f25_A* 1f24_A* 1xqd_A* 1f26_A* 1cmn_A* 1ulw_A* Back     alignment and structure
>3dax_A Cytochrome P450 7A1; cholesterol, cholesterol 7-alpha hydroxylase, structural genomics, structural genomics consortium, SGC, cholesterol metabolism; HET: HEM; 2.15A {Homo sapiens} PDB: 3sn5_A* Back     alignment and structure
>2cd8_A Cytochrome P450 monooxygenase; oxidoreductase, PIKC, macrolide monooxygenase, antibiotic biosynthesis, heme, iron, metal-binding; HET: HEM PXI; 1.7A {Streptomyces venezuelae} PDB: 2c6h_A* 2bvj_A* 2ca0_A* 2c7x_A* 2vzm_A* 2vz7_A* 2vsj_A* 2wi9_A* 2whw_A* Back     alignment and structure
>2ij2_A Cytochrome P450 BM3; monoxygenase, heme binding protein, atomic resolution, oxidoreductase; HET: HEM; 1.20A {Bacillus megaterium} SCOP: a.104.1.1 PDB: 2hpd_A* 1fag_A* 1jpz_A* 1zo9_A* 1zo4_A* 1zoa_A* 3m4v_A* 3ekb_A* 3ben_A* 1fah_A* 2nnb_A* 3kx3_A* 3ekd_A* 3ekf_A* 1smi_A* 1smj_A* 3kx4_A* 2ij3_A* 2ij4_A* 3hf2_A* ... Back     alignment and structure
>3b98_A Prostaglandin I2 synthase; prostacyclin synthase, cytochrome P450 8A1, CYP8A1, isomerase; HET: HEM; 2.08A {Danio rerio} PDB: 3b99_A* Back     alignment and structure
>3mdm_A Cholesterol 24-hydroxylase; CYP46A1, P450 46A1, thioperamide, monooxygenase, metab enzyme, oxidoreductase, heme, cholesterol metabolism; HET: HEM FJZ; 1.60A {Homo sapiens} PDB: 2q9g_A* 2q9f_A* 3mdr_A* 3mdt_A* 3mdv_A* 4enh_A* 4fia_A* Back     alignment and structure
>3b6h_A Prostacyclin synthase; enzyme-inhibitor complex, CYP8A1, cytochrome P450, endoplasmic reticulum, fatty acid biosynthesis, heme, iron, isomerase; HET: BOG MXD HEM; 1.62A {Homo sapiens} PDB: 2iag_A* Back     alignment and structure
>1ued_A P450 OXYC, P450 monooxygenase; cytochrome P450 vancomycin biosynthesis, oxidoreductase; HET: HEM PG4; 1.90A {Amycolatopsis orientalis} SCOP: a.104.1.1 Back     alignment and structure
>4fb2_A P450CIN; heme, monooxygenase, cindoxin, oxidoreductase; HET: HEM EDO; 1.37A {Citrobacter braakii} PDB: 4fmx_A* 4fyz_A* 1t2b_A* 3bdz_A* 3be0_A* Back     alignment and structure
>3dsk_A Cytochrome P450 74A, chloroplast; P450 fold, fatty acid biosynthesis, heme, iron, synthesis, lyase, metal-binding, oxylipin biosynthesis; HET: HEM T25; 1.55A {Arabidopsis thaliana} PDB: 2rcm_A* 3dsj_A* 3dsi_A* 2rcl_A* 2rch_A* 3cli_A* Back     alignment and structure
>2zbx_A Cytochrome P450-SU1; beta prism, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.50A {Streptomyces griseolus} PDB: 2zby_A* 2zbz_A* 3cv8_A* 3cv9_A* Back     alignment and structure
>1izo_A P450bsbeta, cytochrome P450 152A1; heme protein, protein-fatty acid complex, riken structural genomics/proteomics initiative, RSGI; HET: HEM PAM; 2.10A {Bacillus subtilis} SCOP: a.104.1.1 PDB: 2zqj_A* 2zqx_A* Back     alignment and structure
>3awm_A Fatty acid alpha-hydroxylase; cytochrome P450, peroxygenase, oxidoreductase; HET: HEM PLM; 1.65A {Sphingomonas paucimobilis} PDB: 3awq_A* 3awp_A* Back     alignment and structure
>1n97_A CYP175A1; electron transport; HET: SRT HEM; 1.80A {Thermus thermophilus} SCOP: a.104.1.1 PDB: 1wiy_A* Back     alignment and structure
>3ivy_A Cytochrome P450 CYP125; cholesterol, monooxygenase, H iron, metal-binding, oxidoreductase; HET: HEM; 1.35A {Mycobacterium tuberculosis} PDB: 3iw0_A* 3iw1_A* 3iw2_A* 2x5w_A* 2x5l_A* 2xc3_A* 2xn8_A* Back     alignment and structure
>3nc3_A Cytochrome P450 CYPX; cytochrome P450 oxidase, HAEM protein, oxidoreductase; HET: HEM; 2.66A {Bacillus subtilis} PDB: 3nc5_A* 3nc6_A* 3nc7_A* Back     alignment and structure
>3oft_A Cytochrome P450, CYP101C1; oxidoreductase; HET: HEM; 1.90A {Novosphingobium aromaticivorans} PDB: 3ofu_A* Back     alignment and structure
>1cpt_A Cytochrome P450-TERP; oxidoreductase(oxygenase); HET: HEM; 2.30A {Pseudomonas SP} SCOP: a.104.1.1 Back     alignment and structure
>3dan_A Cytochrome P450 74A2; AOS heme cytochrome P450 structure, fatty acid biosynthesis, heme, iron, lipid synthesis, lyase, metal-binding; HET: HEM; 1.80A {Parthenium argentatum} PDB: 3dam_A* 3dbm_A* Back     alignment and structure
>3tyw_A Putative cytochrome P450; P450 monooxygenase, oxidoreductase; HET: HEM; 2.90A {Streptomyces coelicolor} PDB: 4fxb_A* Back     alignment and structure
>1s1f_A Putative cytochrome P450; cytochrome P450 oxidoreductase, CYP158A2, anti biosynthesis, oxidoreductase; HET: HEM PIM; 1.50A {Streptomyces coelicolor} SCOP: a.104.1.1 PDB: 1se6_A* 2d0e_A* 1t93_A* 2d09_A* 3tzo_A* Back     alignment and structure
>3ejb_B Biotin biosynthesis cytochrome P450-like enzyme; protein-protein complex, cytochrome P450 fold, carrier protein, 4-helix bundle, cytoplasm; HET: ZMP HTG HEM; 2.00A {Bacillus subtilis} SCOP: a.104.1.0 PDB: 3ejd_B* 3eje_B* Back     alignment and structure
>3abb_A CYP105D6, cytochrome P450 hydroxylase; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding; HET: HEM; 2.30A {Streptomyces avermitilis} Back     alignment and structure
>2zwu_A Camphor 5-monooxygenase; P450CAM, camphor-hydroxylase, heme, iron, metal-binding, oxidoreductase, substrate-soaking, cytoplasm; HET: HEM CAM; 1.30A {Pseudomonas putida} PDB: 1gem_A* 1iwi_A* 2l8m_A* 2z97_A* 1gek_A* 2zax_A* 2zaw_A* 2zwt_A* 1rf9_A* 1lwl_A* 1iwk_A* 1iwj_A* 2zui_A* 2fe6_A* 1geb_A* 1yrc_A* 1noo_A* 1cp4_A* 1pha_A* 1phc_A* ... Back     alignment and structure
>4dnj_A Putative cytochrome P450; oxidoreductase; HET: HEM ANN; 1.80A {Rhodopseudomonas palustris} PDB: 2fr7_A* 4do1_A* 4dnz_A* Back     alignment and structure
>3lxh_A Cytochrome P450; heme, iron, metal-binding, monooxygena oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} SCOP: a.104.1.0 PDB: 3lxi_A* Back     alignment and structure
>3aba_A Cytochrome P450; oxidoreductase, heme, monooxygenase, macrolide, filipi metal-binding, oxidoreductase-antibiotic complex; HET: HEM FLI; 1.80A {Streptomyces avermitilis} PDB: 3e5j_A* 3e5k_A* 3e5l_A* Back     alignment and structure
>3a4g_A Vitamin D hydroxylase; cytochrome P450, hemoprotein, monoox oxidoreductase; HET: HEM; 1.75A {Pseudonocardia autotrophica} PDB: 3a4h_A* 3a51_A* 3a4z_A* 3a50_A* Back     alignment and structure
>2y5n_A MYCG, P-450-like protein; oxidoreductase, mycinamicin biosynthesis; HET: HEM MYV; 1.62A {Micromonospora griseorubida} PDB: 2y46_A* 2y5z_A* 2y98_A* 2yca_A* 2ygx_A* Back     alignment and structure
>1z8o_A 6-deoxyerythronolide B hydroxylase; heme, CYP, erythromycin, oxidoreductase; HET: HEM DEB; 1.70A {Saccharopolyspora erythraea} SCOP: a.104.1.1 PDB: 1z8p_A* 1z8q_A* 1jio_A* 1jip_A* 1eup_A* 1egy_A* 1jin_A* 1oxa_A* Back     alignment and structure
>3mgx_A Putative P450 monooxygenase; cytochrome P450 oxidase, HAEM protein, vancomycin biosynthes carrier protein, oxidoreductase; HET: HEM; 2.10A {Amycolatopsis balhimycina} Back     alignment and structure
>2z36_A MOXA, cytochrome P450 type compactin 3'',4''- hydroxylase; CYP105, oxidoreductase; HET: HEM MES; 2.80A {Nonomuraea recticatena} Back     alignment and structure
>3rwl_A Cytochrome P450 alkane hydroxylase 1 CYP153A7; P450 monooxygenase, oxidoreductase; HET: HEM; 2.00A {Sphingopyxis macrogoltabida} Back     alignment and structure
>2xkr_A CYP142, putative cytochrome P450 142; oxidoreductase; HET: HEM; 1.60A {Mycobacterium tuberculosis} Back     alignment and structure
>2jjn_A Cytochrome P450 113A1; oxidoreductase, iron, heme, monooxygenase, metal-binding, AN biosynthesis, TIE-ROD mechanism of action; HET: HEM; 1.59A {Saccharopolyspora erythraea} PDB: 2jjo_A* 2jjp_A* 2xfh_A* 2wio_A* 2vrv_A* Back     alignment and structure
>1gwi_A CYP154C1, cytochrome P450 154C1; oxidoreductase, macrolide antibiotics, 12- and 14- carbon macrolactone monooxygenase, heme; HET: HEM; 1.92A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>2z3t_A Cytochrome P450; monoxygenase, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM; 1.90A {Streptomyces SP} PDB: 2z3u_A* 3a1l_A* Back     alignment and structure
>3tkt_A Cytochrome P450; aromatic hydrocarbon binding of P450 E oxidoreductase; HET: HEM; 2.20A {Novosphingobium aromaticivorans} Back     alignment and structure
>3r9b_A Cytochrome P450 164A2; monooxygenase, oxidoreductase; HET: HEM D12; 1.89A {Mycobacterium smegmatis} PDB: 3r9c_A* Back     alignment and structure
>3buj_A CALO2; heme, iron, metal-binding, monooxygenase, oxidoreducta binding protein; HET: HEM; 2.47A {Micromonospora echinospora} Back     alignment and structure
>2xbk_A PIMD protein; epoxidation, oxidoreductase; HET: HEM XBK; 1.95A {Streptomyces natalensis} PDB: 2x9p_A* Back     alignment and structure
>1odo_A Putative cytochrome P450 154A1; P450 monooxygenase, oxidoreductase; HET: HEM PIM; 1.85A {Streptomyces coelicolor} SCOP: a.104.1.1 Back     alignment and structure
>3oo3_A OXY protein; cytochrome P450, monooxygenase, PCD-teicoplanin aglycone, oxidoreductase; HET: HEM; 2.20A {Actinoplanes teichomyceticus} SCOP: a.104.1.0 PDB: 3o1a_A* Back     alignment and structure
>2dkk_A Cytochrome P450; CYP158A1, INHI oxidoreductase; HET: HEM; 1.97A {Streptomyces coelicolor} PDB: 2nz5_A* 2nza_A* Back     alignment and structure
>2uuq_A CYP130, cytochrome P450 130; iron, heme, monooxygenase, metal-binding, oxidoreductase, hypothetical protein; HET: HEM; 1.46A {Mycobacterium tuberculosis} PDB: 2uvn_A* 2whf_A* 2wh8_A* 2wgy_A* Back     alignment and structure
>4dxy_A Cytochrome P450, CYP101D2; cytochrome P450 mutant, HAEM-dependent, mono-oxygenases, oxidoreductase; HET: HEM; 2.00A {Novosphingobium aromaticivorans} PDB: 3nv6_A* 3nv5_A* Back     alignment and structure
>2wiy_A XPLA-heme, cytochrome P450-like protein XPLA; CYT-P450, RDX, bioremediation, electron transport; HET: HEM; 1.49A {Rhodococcus} PDB: 2wiv_A* Back     alignment and structure
>2wm5_A CYP124, putative cytochrome P450 124; metal-binding, oxidoreductase, omega-hydroxylation, iron, heme, fatty acid, monooxygenase; HET: HEM; 1.50A {Mycobacterium tuberculosis} PDB: 2wm4_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure
>2yjn_B Erycii, DTDP-4-keto-6-deoxy-hexose 3,4-isomerase; transferase, cytochrome P450; 3.09A {Saccharopolyspora erythraea} Back     alignment and structure
>1q5d_A P450 epoxidase; cytochrome P450, epothilone, oxydoreductase, heme-enzyme, oxidoreductase; HET: HEM EPB; 1.93A {Sorangium cellulosum} SCOP: a.104.1.1 PDB: 1q5e_A* 1pkf_A* Back     alignment and structure
>3b4x_A 367AA long hypothetical cytochrome P450; HEM protein, heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 1.94A {Sulfolobus tokodaii} PDB: 1ue8_A* Back     alignment and structure
>1io7_A Cytochrome P450 CYP119; thermophilic, cytochromo P450, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: HEM; 1.50A {Sulfolobus solfataricus} SCOP: a.104.1.1 PDB: 1f4u_A* 1f4t_A* 1io9_A* 1io8_A* Back     alignment and structure
>1n40_A P450 MT2, cytochrome P450 121; heme binding, oxygen binding, P450 fold, structural genomics, PSI, protein structure initiative; HET: HEM; 1.06A {Mycobacterium tuberculosis} SCOP: a.104.1.1 PDB: 1n4g_A* 2ij5_A* 2ij7_A* 3g5f_A* 3g5h_A* 3cy0_A* 3cy1_A* 3cxv_A* 3cxx_A* 3cxz_A* 3cxy_A* Back     alignment and structure
>1lfk_A OXYB, P450 monooxygenase; oxidative phenol coupling reaction P450 vancomycin, oxidoreductase; HET: HEM; 1.70A {Amycolatopsis orientalis} SCOP: a.104.1.1 PDB: 1lg9_A* 1lgf_A* Back     alignment and structure
>2rfb_A Cytochrome P450; heme, iron, metal-binding, monooxygenase, oxidoreductase; HET: HEM; 2.50A {Picrophilus torridus} PDB: 2rfc_A* Back     alignment and structure
>3p3o_A Cytochrome P450; monooxygenase, oxidoreductase; HET: HEM; 1.54A {Streptomyces thioluteus} PDB: 3p3x_A* 3p3z_A* 3p3l_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d1r9oa_ 467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-16
d1r9oa_467 a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Huma 1e-05
d1po5a_ 465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 5e-14
d1po5a_465 a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabb 1e-08
d3czha1 463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 2e-13
d3czha1463 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2 5e-08
d2ij2a1 453 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus 2e-12
d2ciba1 445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 4e-12
d2ciba1445 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-stero 7e-06
d1tqna_ 472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 2e-11
d1tqna_472 a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Huma 3e-07
d1izoa_ 411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 4e-04
d1izoa_411 a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Ba 0.003
d1q5da_401 a.104.1.1 (A:) Cytochrome P450epok {Sorangium cell 8e-04
d1odoa_401 a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyce 8e-04
d1z8oa1402 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharo 0.004
d1n97a_385 a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [Tax 0.004
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure

class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 74.0 bits (180), Expect = 1e-16
 Identities = 33/118 (27%), Positives = 53/118 (44%), Gaps = 13/118 (11%)

Query: 3   RKQLPPGPRPYPVIRNLLELGEK-PHKSLAELAKIHGPIMSLKL----------ASMAKS 51
           R +LPPGP P PVI N+L++G K   KSL  L+K++GP+ +L                K 
Sbjct: 1   RGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKE 60

Query: 52  ILLDHDSSFCNRTVPRAMSSHQHYEFSLAWMPVSRPWKSLRKICNMHIFTNREIAGFI 109
            L+D    F  R +   ++   +  F + +    + WK +R+   M +         I
Sbjct: 61  ALIDLGEEFSGRGIF-PLAERANRGFGIVFSN-GKKWKEIRRFSLMTLRNFGMGKRSI 116
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Length = 467 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 465 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Length = 463 Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Length = 453 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Length = 445 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Length = 472 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Length = 411 Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Length = 401 Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Length = 401 Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Length = 402 Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Length = 385 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d1r9oa_467 Mammalian cytochrome p450 2c9 {Human (Homo sapiens 100.0
d1po5a_465 Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus 100.0
d3czha1463 Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapie 100.0
d1tqna_472 Mammalian cytochrome P450 3a4 {Human (Homo sapiens 100.0
d2ciba1445 Cytochrome p450 14 alpha-sterol demethylase (cyp51 100.0
d2ij2a1453 Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 100.0
d1izoa_411 Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis 99.98
d1odoa_401 Cyp154a1 monooxygenase {Streptomyces coelicolor [T 99.97
d1n97a_385 Cyp175a1 {Thermus thermophilus [TaxId: 274]} 99.96
d1ueda_403 p450 monoxygenase OxyC {Amycolatopsis orientalis [ 99.96
d1z8oa1402 Cytochrome P450-ERYF {Saccharopolyspora erythraea 99.95
d1q5da_401 Cytochrome P450epok {Sorangium cellulosum [TaxId: 99.95
d1jfba_399 Cytochrome P450-NOR, nitric reductase {Fungus (Fus 99.95
d1gwia_403 Cyp154c1 monooxygenase {Streptomyces coelicolor [T 99.95
d1cpta_428 Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306] 99.95
d1s1fa_399 Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} 99.95
d1io7a_366 Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2 99.93
d1re9a_404 Cytochrome P450-CAM {Pseudomonas putida [TaxId: 30 99.92
d1lfka_394 p450 monoxygenase OxyB {Amycolatopsis orientalis [ 99.92
d1ue8a_367 Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 11195 99.92
d1n40a_395 Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tub 99.83
>d1r9oa_ a.104.1.1 (A:) Mammalian cytochrome p450 2c9 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: All alpha proteins
fold: Cytochrome P450
superfamily: Cytochrome P450
family: Cytochrome P450
domain: Mammalian cytochrome p450 2c9
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=2.4e-44  Score=279.68  Aligned_cols=176  Identities=28%  Similarity=0.518  Sum_probs=146.5

Q ss_pred             CCCCCCCCCCCccccccCCCC-CCcHHHHHHHHHHhCCcEEEechHH----------HHHHHhhCCcCcCCCCchhhccc
Q 042053            3 RKQLPPGPRPYPVIRNLLELG-EKPHKSLAELAKIHGPIMSLKLASM----------AKSILLDHDSSFCNRTVPRAMSS   71 (181)
Q Consensus         3 ~~~~ppgp~~~p~~G~~~~~~-~~~~~~~~~~~~~yG~v~~~~~~~~----------~~~~~~~~~~~~~~r~~~~~~~~   71 (181)
                      +-++||||+++|+|||++.+. .+++.++.+++++||+||++++++.          +++++.+++..|++|+.......
T Consensus         1 ~~~lPPGP~~~P~lG~~~~l~~~~~~~~~~~~~~kyG~i~~~~~g~~~~vvv~dpe~i~~il~~~~~~f~~r~~~~~~~~   80 (467)
T d1r9oa_           1 RGKLPPGPTPLPVIGNILQIGIKDISKSLTNLSKVYGPVFTLYFGLKPIVVLHGYEAVKEALIDLGEEFSGRGIFPLAER   80 (467)
T ss_dssp             CCBCCCCSSSCC-----CCBCHHHHHHHHHHHHHHHCSEEEEESSSCEEEEECSHHHHHHHHTTTTTTTCEECCCSCCCT
T ss_pred             CCCCCcCCCCCCccccHHHhCCcCHHHHHHHHHHHhCCEEEEEECCeeEEEECCHHHHHHHHHhCCcccCCCCcchhhhh
Confidence            357999999999999999995 6788999999999999999998877          88999888888887765544433


Q ss_pred             cccCCcceeeecCCCchHHHHHhhhhccccc-------------------------------------------------
Q 042053           72 HQHYEFSLAWMPVSRPWKSLRKICNMHIFTN-------------------------------------------------  102 (181)
Q Consensus        72 ~~~~~~~~~~~~~g~~w~~~r~~~~~~l~~~-------------------------------------------------  102 (181)
                      .. .+.+++++. |+.|+++|+++.+.+.+.                                                 
T Consensus        81 ~~-~g~~l~~~~-g~~~~~~R~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~d~~~~~~~~~~~~i~~~~~  158 (467)
T d1r9oa_          81 AN-RGFGIVFSN-GKKWKEIRRFSLMTLRNFGMGKRSIEDRVQEEARCLVEELRKTKASPCDPTFILGCAPCNVICSIIF  158 (467)
T ss_dssp             TT-CTTSSTTCC-HHHHHHHHHHHHHHHTTSSSCSSCHHHHHHHHHHHHHHHHHTTTTSCBCTHHHHHHHHHHHHHHHHH
T ss_pred             cC-CCCceeeCC-ChHHHHHHHHHHHHhhccccchhHHHHHHHHHHHHHHHHHHhhccccccHHHHHHHHHhhhhhhhcc
Confidence            33 356676665 999999999988765443                                                 


Q ss_pred             --------------------------------------------------------------------------------
Q 042053          103 --------------------------------------------------------------------------------  102 (181)
Q Consensus       103 --------------------------------------------------------------------------------  102 (181)
                                                                                                      
T Consensus       159 g~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~~~~~d~  238 (467)
T d1r9oa_         159 HKRFDYKDQQFLNLMEKLNENIKILSSPWIQICNNFSPIIDYFPGTHNKLLKNVAFMKSYILEKVKEHQESMDMNNPQDF  238 (467)
T ss_dssp             SCCCCTTCHHHHHHHHHHHHHHHHHTCCBC-------CCCSCCTTCHHHHHHHHHHHHHHHHHHHHHHHHTCCTTCCCSH
T ss_pred             cccchhhhhhHHHHHHHHHHHHHHhhchhhhhhhhhhhhhhcCchhHHHHHHHHHHHHHHHHHHHHHHHHhhccccchhh
Confidence                                                                                            


Q ss_pred             --------------------------------------------------------------------------------
Q 042053          103 --------------------------------------------------------------------------------  102 (181)
Q Consensus       103 --------------------------------------------------------------------------------  102 (181)
                                                                                                      
T Consensus       239 ~~~~~~~~~~~~~~~~~~~~~~~i~~~~~~~~~Ag~dTTa~~l~~~l~~L~~~p~~~~~l~~Ei~~~~~~~~~~~~~~~~  318 (467)
T d1r9oa_         239 IDCFLMKMEKEKHNQPSEFTIESLENTAVDLFGAGTETTSTTLRYALLLLLKHPEVTAKVQEEIERVIGRNRSPCMQDRS  318 (467)
T ss_dssp             HHHHHHHHHHHTTSCSCSCCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHCHHHHHHHHHHHHHHTCSSSCCCGGGGG
T ss_pred             hhhhhhhhhhhhccCCcccchhHHHHHHHHHHHcccccchhHHHHHHHHhhcCchHHHHHHhhhhhhcCCCCCCcHHHhh
Confidence                                                                                            


Q ss_pred             ------------------------------eeEccEEEecCcEEhhhHHhhhcCCCcCCCCCccCCccccCCCccccCCc
Q 042053          103 ------------------------------REIAGFIVLKCAKVLVNVWATVKYESILDNAHYFTPERLLGSDIDFKGKN  152 (181)
Q Consensus       103 ------------------------------~~~~g~~ip~g~~v~~~~~~~~~dp~~~~~p~~F~PeRfl~~~~~~~~~~  152 (181)
                                                    ++++||.||||+.|.++.+++|+|+++|+||++|+||||++++.+.. .+
T Consensus       319 ~l~yL~a~i~E~lRl~p~~~~~~r~~~~~~~~~~g~~ip~gt~v~~~~~~~~~d~~~~~dp~~F~PeRfl~~~~~~~-~~  397 (467)
T d1r9oa_         319 HMPYTDAVVHEVQRYIDLLPTSLPHAVTCDIKFRNYLIPKGTTILISLTSVLHDNKEFPNPEMFDPHHFLDEGGNFK-KS  397 (467)
T ss_dssp             GCHHHHHHHHHHHHHHTSSTTCSCEECSSCEEETTEEECTTCEEEECSHHHHTCTTTSSSTTSCCGGGGBCTTSCBC-CC
T ss_pred             hhhhhhhhccccccccccCCcccccccccccccceeEEecCCccccchhhhcCCcccCcCcceeCccccCCCCCCcC-CC
Confidence                                          77899999999999999999999999999999999999998776655 56


Q ss_pred             cceecccCCCccCCChHHHHHHHHhhhcC
Q 042053          153 FELIPFGAGWQIYPGLPLAIKMLYLGFSY  181 (181)
Q Consensus       153 ~~~~pFg~G~r~C~G~~~A~~~~~~~l~~  181 (181)
                      .+|+|||+|+|.|+|++||++|++++||+
T Consensus       398 ~~~~pFg~G~r~C~G~~~A~~e~~~~la~  426 (467)
T d1r9oa_         398 KYFMPFSAGKRICVGEALAGMELFLFLTS  426 (467)
T ss_dssp             TTCCTTCCGGGSCTTHHHHHHHHHHHHHH
T ss_pred             CCcccCCCCCcCChHHHHHHHHHHHHHHH
Confidence            78999999999999999999999999873
>d1po5a_ a.104.1.1 (A:) Mammalian cytochrome p450 2b4 {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d3czha1 a.104.1.1 (A:40-502) Vitamin D 25-hydroxylase Cyp2R1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1tqna_ a.104.1.1 (A:) Mammalian cytochrome P450 3a4 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ciba1 a.104.1.1 (A:5-449) Cytochrome p450 14 alpha-sterol demethylase (cyp51) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2ij2a1 a.104.1.1 (A:3-455) Cytochrome P450 bm-3 {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1izoa_ a.104.1.1 (A:) Cytochrome p450 152a1 (Bs-beta) {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1odoa_ a.104.1.1 (A:) Cyp154a1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1n97a_ a.104.1.1 (A:) Cyp175a1 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ueda_ a.104.1.1 (A:) p450 monoxygenase OxyC {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1z8oa1 a.104.1.1 (A:3-404) Cytochrome P450-ERYF {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1q5da_ a.104.1.1 (A:) Cytochrome P450epok {Sorangium cellulosum [TaxId: 56]} Back     information, alignment and structure
>d1jfba_ a.104.1.1 (A:) Cytochrome P450-NOR, nitric reductase {Fungus (Fusarium oxysporum) [TaxId: 5507]} Back     information, alignment and structure
>d1gwia_ a.104.1.1 (A:) Cyp154c1 monooxygenase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1cpta_ a.104.1.1 (A:) Cytochrome P450-TERP {Pseudomonas sp. [TaxId: 306]} Back     information, alignment and structure
>d1s1fa_ a.104.1.1 (A:) Cyp158a2 {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1io7a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1re9a_ a.104.1.1 (A:) Cytochrome P450-CAM {Pseudomonas putida [TaxId: 303]} Back     information, alignment and structure
>d1lfka_ a.104.1.1 (A:) p450 monoxygenase OxyB {Amycolatopsis orientalis [TaxId: 31958]} Back     information, alignment and structure
>d1ue8a_ a.104.1.1 (A:) Cyp119 {Archaeon Sulfolobus tokodaii [TaxId: 111955]} Back     information, alignment and structure
>d1n40a_ a.104.1.1 (A:) Cyp121 monooxygenase (P450 Mt2) {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure