Citrus Sinensis ID: 042070


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MGSKPAIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKGPAAKMD
ccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccEEEcccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHcccccHHHHHHHHHcccccccc
*******ITV*EKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVH********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSKPAIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKGPAAKMD

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peroxygenase Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline and epoxidation of oleic acid.probableQ7FAX1
Peroxygenase Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination and in the oxylipin signaling pathways and plant defense responses. Can catalyze sulfoxidation of thiobenzamide, hydroxylation of aniline and epoxidation of oleic acid.probableA2XVG1
Peroxygenase Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination.probableQ9SQ57

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2BE4, chain A
Confidence level:confident
Coverage over the Query: 59-97,147-217
View the alignment between query and template
View the model in PyMOL
Template: 2BE4, chain A
Confidence level:probable
Coverage over the Query: 59-216
View the alignment between query and template
View the model in PyMOL
Template: 1JUO, chain A
Confidence level:probable
Coverage over the Query: 56-110,140-216
View the alignment between query and template
View the model in PyMOL