Citrus Sinensis ID: 042070

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MGSKPAIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKGPAAKMD
ccccccccEEcccccccccccccccccccccccccccccccccccccccccccccccccHHHHccccccccccccccccHHHHHHHHHcccHHHHHHHHHHHHHcccccccccccccccccEEEcccccccccccccccccccccccHHHHHHHHHHcccccccccHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHccccccccHHHHHHcccccHHHHHHHHHcccccccc
cccccccEEEcccccccccccccccHHHccccccccHHcccccccccccccccccccccHHHHHHHHEccccccEEEcHHHHHHHHHHcHHHHHHHHHHHHHHcccccccccccccccccEEEEEcccccccccccccccccccccHHHHHHHHHHHHccccccccHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHccccccccHHHHHHHcccHHHHHHHHHHHccccccc
MGSKPAIITVAEKAPITAARKVhddldtklpkpyvpravvapdtenvkgtwghehnnMSVLQQHAAffdqdgdgiiypwetfrgfrligfnpiASFVFSFLVHMAMsyatsptwlpspffpiyvqnihkakhgsdtgtydtegryvpvnfENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILakddegylskEAVRRCFDGSLFDYcakvhkgpaakmd
mgskpaiitvaekapitaarkvhddldtklpkpyvpravvapDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKvhkgpaakmd
MGSKPAIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKGPAAKMD
*******ITV*****ITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVH********
***********EKAPITAARKVHD**DTKLPKPYVPRAVVA*****************SVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFD**************
MGSKPAIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKGPAAKMD
******IITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKG******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MGSKPAIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKGPAAKMD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query236 2.2.26 [Sep-21-2011]
Q9SQ57245 Peroxygenase OS=Sesamum i N/A no 0.932 0.897 0.65 4e-89
O81270245 Peroxygenase 1 OS=Arabido no no 0.974 0.938 0.613 4e-87
Q9FLN9243 Peroxygenase 2 OS=Arabido no no 0.949 0.921 0.647 5e-87
O22788236 Probable peroxygenase 3 O no no 0.953 0.953 0.617 3e-84
G1JSL4249 Peroxygenase 1 OS=Avena s N/A no 0.923 0.875 0.627 3e-79
Q7FAX1244 Peroxygenase OS=Oryza sat yes no 0.949 0.918 0.589 9e-79
A2XVG1244 Peroxygenase OS=Oryza sat N/A no 0.949 0.918 0.589 9e-79
B3H7A9210 Probable peroxygenase 7 O no no 0.711 0.8 0.446 1e-39
Q9CAB7195 Probable peroxygenase 4 O no no 0.737 0.892 0.454 3e-38
Q9CAB8192 Probable peroxygenase 5 O no no 0.703 0.864 0.439 4e-33
>sp|Q9SQ57|PXG_SESIN Peroxygenase OS=Sesamum indicum GN=SOP1 PE=1 SV=1 Back     alignment and function desciption
 Score =  327 bits (838), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 143/220 (65%), Positives = 183/220 (83%)

Query: 16  ITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGI 75
           +T  R V  DL+T +PKPY+ R +VAPD ++  GT GH H+N+SVLQQH AFFDQD +GI
Sbjct: 25  VTMERPVRTDLETSIPKPYMARGLVAPDMDHPNGTPGHVHDNLSVLQQHCAFFDQDDNGI 84

Query: 76  IYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSD 135
           IYPWET+ G R IGFN IAS + + ++++A+SY T P W+PSPFFPIY+ NIHKAKHGSD
Sbjct: 85  IYPWETYSGLRQIGFNVIASLIMAIVINVALSYPTLPGWIPSPFFPIYLYNIHKAKHGSD 144

Query: 136 TGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGA 195
           +GTYDTEGRY+P+NFEN+FSK+ART+PD+LT  E+W MT+++R AFDIFGWIASK+EW  
Sbjct: 145 SGTYDTEGRYLPMNFENLFSKHARTMPDRLTLGELWSMTEANREAFDIFGWIASKMEWTL 204

Query: 196 LYILAKDDEGYLSKEAVRRCFDGSLFDYCAKVHKGPAAKM 235
           LYILA+D +G+LSKEA+RRC+DGSLF+YCAK+ +G   KM
Sbjct: 205 LYILARDQDGFLSKEAIRRCYDGSLFEYCAKMQRGAEDKM 244
Calcium-binding peroxygenase involved in the degradation of storage lipid in oil bodies. May be involved in the interaction between oil bodies and vacuoles during seed germination.
Sesamum indicum (taxid: 4182)
EC: 1EC: .EC: 1EC: 1EC: .EC: 2EC: .EC: 3
>sp|O81270|PXG1_ARATH Peroxygenase 1 OS=Arabidopsis thaliana GN=PXG1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FLN9|PXG2_ARATH Peroxygenase 2 OS=Arabidopsis thaliana GN=PXG2 PE=1 SV=1 Back     alignment and function description
>sp|O22788|PXG3_ARATH Probable peroxygenase 3 OS=Arabidopsis thaliana GN=PXG3 PE=1 SV=1 Back     alignment and function description
>sp|G1JSL4|PXG1_AVESA Peroxygenase 1 OS=Avena sativa PE=1 SV=1 Back     alignment and function description
>sp|Q7FAX1|PXG_ORYSJ Peroxygenase OS=Oryza sativa subsp. japonica GN=PXG PE=2 SV=1 Back     alignment and function description
>sp|A2XVG1|PXG_ORYSI Peroxygenase OS=Oryza sativa subsp. indica GN=PXG PE=1 SV=1 Back     alignment and function description
>sp|B3H7A9|PXG7_ARATH Probable peroxygenase 7 OS=Arabidopsis thaliana GN=PXG7 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAB7|PXG4_ARATH Probable peroxygenase 4 OS=Arabidopsis thaliana GN=PXG4 PE=1 SV=1 Back     alignment and function description
>sp|Q9CAB8|PXG5_ARATH Probable peroxygenase 5 OS=Arabidopsis thaliana GN=PXG5 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
297808899238 predicted protein [Arabidopsis lyrata su 0.936 0.928 0.760 1e-101
356573135315 PREDICTED: uncharacterized protein LOC10 0.991 0.742 0.700 9e-99
449470214239 PREDICTED: peroxygenase-like [Cucumis sa 0.991 0.979 0.700 1e-98
356505977240 PREDICTED: uncharacterized protein LOC10 0.987 0.970 0.695 1e-97
351725291239 Ca+2-binding EF hand protein [Glycine ma 0.983 0.970 0.659 1e-92
225433245239 PREDICTED: uncharacterized protein LOC10 0.974 0.962 0.652 1e-88
157781823239 caleosin [Ficus pumila var. awkeotsang] 0.974 0.962 0.660 2e-88
255574921233 calcium ion binding protein, putative [R 0.974 0.987 0.659 3e-88
186526534220 caleosin-related family protein [Arabido 0.855 0.918 0.692 1e-87
75207182245 RecName: Full=Peroxygenase; AltName: Ful 0.932 0.897 0.65 2e-87
>gi|297808899|ref|XP_002872333.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297318170|gb|EFH48592.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
 Score =  374 bits (961), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 168/221 (76%), Positives = 193/221 (87%)

Query: 6   AIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHA 65
           +I TVAEKAPITA R+V  DLD +LPKPYVPRA+VAPD ENV GT GH+H +MSVLQQH 
Sbjct: 9   SIATVAEKAPITAERRVRTDLDDRLPKPYVPRAMVAPDMENVNGTRGHKHQDMSVLQQHV 68

Query: 66  AFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQ 125
           AFFDQDGDGIIYP ETFRGFR +GFN I+SF  + +VH+ MSYAT PTW+PSP FPIY++
Sbjct: 69  AFFDQDGDGIIYPSETFRGFRALGFNVISSFFLTIIVHLTMSYATLPTWMPSPTFPIYIK 128

Query: 126 NIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFG 185
           NIH+AKHGSDT TYDTEGRY+P N EN+FSKYARTVPDKLTR E+W MT+++RNAFD FG
Sbjct: 129 NIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARTVPDKLTRYELWQMTEANRNAFDFFG 188

Query: 186 WIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAK 226
           W ASK+EWG LY+LAKD+ G+LSKEAVRRCFDGSLFDYCAK
Sbjct: 189 WAASKMEWGVLYLLAKDENGHLSKEAVRRCFDGSLFDYCAK 229

Source: Arabidopsis lyrata subsp. lyrata

Species: Arabidopsis lyrata

Genus: Arabidopsis

Family: Brassicaceae

Order: Brassicales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|356573135|ref|XP_003554719.1| PREDICTED: uncharacterized protein LOC100813066 [Glycine max] Back     alignment and taxonomy information
>gi|449470214|ref|XP_004152813.1| PREDICTED: peroxygenase-like [Cucumis sativus] gi|449477738|ref|XP_004155108.1| PREDICTED: peroxygenase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|356505977|ref|XP_003521765.1| PREDICTED: uncharacterized protein LOC100802743 [Glycine max] Back     alignment and taxonomy information
>gi|351725291|ref|NP_001237343.1| Ca+2-binding EF hand protein [Glycine max] gi|2270994|gb|AAB71227.1| Ca+2-binding EF hand protein [Glycine max] gi|255625919|gb|ACU13304.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|225433245|ref|XP_002285439.1| PREDICTED: uncharacterized protein LOC100264814 [Vitis vinifera] gi|296083719|emb|CBI23708.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|157781823|gb|ABV72237.1| caleosin [Ficus pumila var. awkeotsang] Back     alignment and taxonomy information
>gi|255574921|ref|XP_002528367.1| calcium ion binding protein, putative [Ricinus communis] gi|223532235|gb|EEF34039.1| calcium ion binding protein, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|186526534|ref|NP_850891.2| caleosin-related family protein [Arabidopsis thaliana] gi|332006483|gb|AED93866.1| caleosin-related family protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|75207182|sp|Q9SQ57.1|PXG_SESIN RecName: Full=Peroxygenase; AltName: Full=Caleosin; Short=SiCLO gi|6478218|gb|AAF13743.1|AF109921_1 caleosin [Sesamum indicum] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query236
TAIR|locus:1005716867220 AT5G29560 "AT5G29560" [Arabido 0.690 0.740 0.736 2.5e-83
TAIR|locus:2116427245 ATS1 "AT4G26740" [Arabidopsis 0.974 0.938 0.613 1.5e-81
TAIR|locus:2161655243 ATPXG2 "AT5G55240" [Arabidopsi 0.944 0.917 0.650 3.2e-81
TAIR|locus:2051129236 RD20 "AT2G33380" [Arabidopsis 0.991 0.991 0.6 2.6e-79
UNIPROTKB|G4N8T9249 MGG_10107 "Caleosin domain-con 0.872 0.827 0.443 1.2e-44
TAIR|locus:2028105210 AT1G23240 "AT1G23240" [Arabido 0.762 0.857 0.439 1.1e-37
TAIR|locus:2033632195 CLO4 "AT1G70670" [Arabidopsis 0.758 0.917 0.447 1.7e-36
ASPGD|ASPL0000073305378 AN8591 [Emericella nidulans (t 0.741 0.462 0.430 7.2e-36
TAIR|locus:2033625192 AT1G70680 "AT1G70680" [Arabido 0.703 0.864 0.439 5.4e-31
TAIR|locus:2028095205 AT1G23250 "AT1G23250" [Arabido 0.631 0.726 0.342 7.2e-20
TAIR|locus:1005716867 AT5G29560 "AT5G29560" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 669 (240.6 bits), Expect = 2.5e-83, Sum P(2) = 2.5e-83
 Identities = 120/163 (73%), Positives = 139/163 (85%)

Query:     6 AIITVAEKAPITAARKVHDDLDTKLPKPYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHA 65
             +I TVAEKAP+TA R+V  DLD +LPKPYVPRA+VAPD ENV GT GH+H +MSVLQQH 
Sbjct:    10 SIATVAEKAPVTAERRVRTDLDDRLPKPYVPRAMVAPDMENVNGTRGHKHRDMSVLQQHI 69

Query:    66 AFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQ 125
             AFFDQDGDGIIYP ETFRGFR +GFN ++S   + +VH+ MSYAT PTW+PSP FPIY++
Sbjct:    70 AFFDQDGDGIIYPSETFRGFRALGFNLVSSIFLTIIVHLTMSYATLPTWMPSPTFPIYIK 129

Query:   126 NIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRA 168
             NIH+AKHGSDT TYDTEGRY+P N EN+FSKYARTVPDKLT A
Sbjct:   130 NIHRAKHGSDTSTYDTEGRYIPANLENMFSKYARTVPDKLTLA 172
GO:0005509 "calcium ion binding" evidence=ISS
GO:0005634 "nucleus" evidence=ISM
GO:0008150 "biological_process" evidence=ND
TAIR|locus:2116427 ATS1 "AT4G26740" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2161655 ATPXG2 "AT5G55240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2051129 RD20 "AT2G33380" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|G4N8T9 MGG_10107 "Caleosin domain-containing protein" [Magnaporthe oryzae 70-15 (taxid:242507)] Back     alignment and assigned GO terms
TAIR|locus:2028105 AT1G23240 "AT1G23240" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2033632 CLO4 "AT1G70670" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ASPGD|ASPL0000073305 AN8591 [Emericella nidulans (taxid:162425)] Back     alignment and assigned GO terms
TAIR|locus:2033625 AT1G70680 "AT1G70680" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2028095 AT1G23250 "AT1G23250" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
A2XVG1PXG_ORYSI1, ., 1, 1, ., 2, ., 30.58920.94910.9180N/Ano
Q9SQ57PXG_SESIN1, ., 1, 1, ., 2, ., 30.650.93220.8979N/Ano
Q7FAX1PXG_ORYSJ1, ., 1, 1, ., 2, ., 30.58920.94910.9180yesno
G1JSL4PXG1_AVESA1, ., 1, 1, ., 2, ., 30.62720.92370.8755N/Ano

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
Al_scaffold_0006_2832
At5g29560-like protein (238 aa)
(Arabidopsis lyrata)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query236
pfam05042174 pfam05042, Caleosin, Caleosin related protein 1e-112
>gnl|CDD|113799 pfam05042, Caleosin, Caleosin related protein Back     alignment and domain information 
 Score =  318 bits (818), Expect = e-112
 Identities = 118/174 (67%), Positives = 141/174 (81%)

Query: 53  HEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSP 112
           H+H  MSVLQQH AFFD++ DGIIYPWET++G R IGFN I S   +  +++ +SY T P
Sbjct: 1   HDHRGMSVLQQHVAFFDRNKDGIIYPWETYQGLRAIGFNYIVSAFAAIFINLGLSYPTLP 60

Query: 113 TWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWH 172
            W PSP FPIY++NIHKAKHGSD+G YDTEGR+VPVNFE IFSKYART PD LT  E+W 
Sbjct: 61  GWGPSPLFPIYIKNIHKAKHGSDSGVYDTEGRFVPVNFEEIFSKYARTHPDALTLGELWV 120

Query: 173 MTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCFDGSLFDYCAK 226
           MT+++R+A D FGW+ASK EWG LY LAKD+EG+LSKEAVRRCFDGSLF+  AK
Sbjct: 121 MTEANRDALDPFGWLASKGEWGLLYTLAKDEEGFLSKEAVRRCFDGSLFEKLAK 174

This family contains plant proteins related to caleosin. Caleosins contain calcium-binding domains and have an oleosin-like association with lipid bodies. Caleosins are present at relatively low levels and are mainly bound to microsomal membrane fractions at the early stages of seed development. As the seeds mature, overall levels of caleosins increased dramatically and they were associated almost exclusively with storage lipid bodies. This family is probably related to EF hands pfam00036. Length = 174

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 236
PF05042174 Caleosin: Caleosin related protein; InterPro: IPR0 100.0
PTZ00183158 centrin; Provisional 95.59
KOG0027151 consensus Calmodulin and related proteins (EF-Hand 95.53
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 94.8
PF1349966 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 93.61
PTZ00184149 calmodulin; Provisional 93.34
COG5126160 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [S 93.27
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 93.22
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 91.6
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 90.65
cd0005163 EFh EF-hand, calcium binding motif; A diverse supe 90.45
PF1340531 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J 89.93
PF0102344 S_100: S-100/ICaBP type calcium binding domain; In 87.27
smart0005429 EFh EF-hand, calcium binding motif. EF-hands are c 86.55
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 84.72
PF0003629 EF-hand_1: EF hand; InterPro: IPR018248 Many calci 83.36
PTZ00184149 calmodulin; Provisional 82.53
smart0002796 EH Eps15 homology domain. Pair of EF hand motifs t 81.45
>PF05042 Caleosin: Caleosin related protein; InterPro: IPR007736 This family contains plant proteins related to caleosin Back     alignment and domain information 
Probab=100.00  E-value=2.7e-97  Score=632.98  Aligned_cols=174  Identities=63%  Similarity=1.176  Sum_probs=172.5

Q ss_pred             CCCCCCChhccccccccCCCCceeccchhhhHHHhhcchHHHHHHHHHHHHhhcCCCCCCCCCCCCccceeecccccccc
Q 042070           53 HEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKH  132 (236)
Q Consensus        53 ~~~~~~TvLQqHvaFFDrD~DGiI~P~DTy~Gfr~LGf~~~~s~~aa~~Ih~~lSy~T~~sw~PdP~f~Iyi~nIHk~kH  132 (236)
                      |+|++||||||||+|||||+||||||||||+|||+||||+++|+++|++||++|||+|+|+|+|||+|||||+||||+||
T Consensus         1 h~~~~~T~LQqHvaFFDrd~DGiI~P~dTy~GFraLGf~~~~s~~aa~~I~~~lSy~T~~~w~p~P~f~Iyi~nIhk~kH   80 (174)
T PF05042_consen    1 HDHNNMTVLQQHVAFFDRDKDGIIYPWDTYQGFRALGFGILLSLLAAFIIHGALSYPTQPSWIPDPFFRIYIKNIHKGKH   80 (174)
T ss_pred             CCcccccHHhhhhceeCCCCCeeECHHHHHHHHHHhCCCHHHHHHHHHHHHcccCCccCCCCCCCCceeEEeeccccccc
Confidence            68999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             CCCCccccccccccccchhHHHHhhcCCCCCCCCHHHHHHHHHhcccccCcchhHHHHHhHHHHHHhhcCCCCccchhhh
Q 042070          133 GSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAV  212 (236)
Q Consensus       133 GSDSg~YD~eGRFvP~kFE~iFsKya~~~pd~LT~~El~~m~~~nR~~~D~~GW~a~~~EW~~~y~L~~~~dG~l~Kedi  212 (236)
                      |||||+||+||||||+|||+||+|||+++||+||++||++|+++|||++||+||+|+.+||.++|.|+||+||+|+||+|
T Consensus        81 GSDSg~YD~eGrFvp~kFe~iF~kya~~~~d~LT~~E~~~m~~~nr~~~D~~GW~a~~~EW~~~y~L~~d~dG~l~Ke~i  160 (174)
T PF05042_consen   81 GSDSGAYDTEGRFVPQKFEEIFSKYAKTGPDALTLRELWRMLKGNRNANDPFGWFAAFFEWGALYILAKDKDGFLSKEDI  160 (174)
T ss_pred             CCCccccccCCcCCHHHHHHHHHHhCCCCCCCcCHHHHHHHHHhccccCCcchhhhhhhHHHHHHHHHcCcCCcEeHHHH
Confidence            99999999999999999999999999999999999999999999999999999999999999999999999999999999


Q ss_pred             ccccccchhHHHHh
Q 042070          213 RRCFDGSLFDYCAK  226 (236)
Q Consensus       213 R~vYDGSlF~~ia~  226 (236)
                      |+|||||||++|||
T Consensus       161 R~vYDGSlF~~iak  174 (174)
T PF05042_consen  161 RGVYDGSLFYKIAK  174 (174)
T ss_pred             hhhcchHHHHHhhC
Confidence            99999999999986

Caleosins contain calcium-binding domains and have an oleosin-like association with lipid bodies. Caleosins are present at relatively low levels and are mainly bound to microsomal membrane fractions at the early stages of seed development. As the seeds mature, overall levels of caleosins increased dramatically and they were associated almost exclusively with storage lipid bodies []. The calcium binding domain is probably related to the calcium-binding EF-hands motif IPR002048 from INTERPRO.
>PTZ00183 centrin; Provisional Back     alignment and domain information
>KOG0027 consensus Calmodulin and related proteins (EF-Hand superfamily) [Signal transduction mechanisms] Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PF13499 EF-hand_7: EF-hand domain pair; PDB: 1TCF_A 2TN4_A 1TN4_A 1A2X_A 2CT9_B 2OTG_B 2OS8_B 1SNL_A 3O4Y_A 3J04_E Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>COG5126 FRQ1 Ca2+-binding protein (EF-Hand superfamily) [Signal transduction mechanisms / Cytoskeleton / Cell division and chromosome partitioning / General function prediction only] Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>cd00051 EFh EF-hand, calcium binding motif; A diverse superfamily of calcium sensors and calcium signal modulators; most examples in this alignment model have 2 active canonical EF hands Back     alignment and domain information
>PF13405 EF-hand_6: EF-hand domain; PDB: 2AMI_A 3QRX_A 1W7J_B 1OE9_B 1W7I_B 1KFU_S 1KFX_S 2BL0_B 1Y1X_B 3MSE_B Back     alignment and domain information
>PF01023 S_100: S-100/ICaBP type calcium binding domain; InterPro: IPR013787 The calcium-binding domain found in S100 and CaBP-9k proteins is a subfamily of the EF-hand calcium-binding domain [] Back     alignment and domain information
>smart00054 EFh EF-hand, calcium binding motif Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information
>PF00036 EF-hand_1: EF hand; InterPro: IPR018248 Many calcium-binding proteins belong to the same evolutionary family and share a type of calcium-binding domain known as the EF-hand Back     alignment and domain information
>PTZ00184 calmodulin; Provisional Back     alignment and domain information
>smart00027 EH Eps15 homology domain Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

No hit with e-value below 0.005

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 97.42
1y1x_A191 Leishmania major homolog of programmed cell death 97.3
2lhi_A176 Calmodulin, serine/threonine-protein phosphatase c 97.25
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 97.14
2qac_A146 Myosin A tail domain interacting protein MTIP; mal 97.06
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 97.04
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 96.98
2obh_A143 Centrin-2; DNA repair complex EF hand superfamily 96.95
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 96.93
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 96.91
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 96.88
2jnf_A158 Troponin C; stretch activated muscle contraction, 96.86
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 96.85
3dtp_E196 RLC, myosin regulatory light chain; muscle protein 96.81
2ovk_B153 RLC, myosin regulatory light chain LC-2, mantle mu 96.8
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 96.79
3fwb_A161 Cell division control protein 31; gene gating, com 96.79
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 96.78
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 96.76
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 96.72
1exr_A148 Calmodulin; high resolution, disorder, metal trans 96.71
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 96.71
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 96.65
3akb_A166 Putative calcium binding protein; EF-hand, metal b 96.63
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 96.59
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 96.59
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 96.56
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 96.5
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 96.49
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 96.43
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 96.41
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 96.4
3pm8_A197 PFCDPK2, calcium-dependent protein kinase 2; malar 96.38
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 96.36
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 96.29
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 96.23
1wdc_B156 Scallop myosin; calcium binding protein, muscle pr 96.22
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 96.17
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 96.13
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 96.05
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 96.02
3li6_A66 Calcium-binding protein; calcium signaling protein 96.0
2ct9_A208 Calcium-binding protein P22; EF-hand, metal bindin 95.93
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 95.89
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 95.87
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 95.84
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 95.83
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 95.65
3u0k_A440 Rcamp; fluorescent protein, calcium binding, EF-ha 95.62
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 95.59
2lv7_A100 Calcium-binding protein 7; metal binding protein; 95.58
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 95.51
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.46
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 95.42
3dd4_A229 KV channel-interacting protein 4; EF-hands protein 95.4
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 95.37
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 95.32
1k94_A165 Grancalcin; penta-EF-hand protein, calcium binding 95.28
1sjj_A863 Actinin; 3-helix bundle, calponin homology domain, 95.25
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 95.18
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 95.12
2r2i_A198 Guanylyl cyclase-activating protein 1; EF hand, GC 95.08
1gjy_A167 Sorcin, CP-22, V19; calcium binding, calcium-bindi 95.03
3li6_A66 Calcium-binding protein; calcium signaling protein 94.98
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 94.94
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 94.9
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 94.88
1dgu_A183 Calcium-saturated CIB; helical, EF-hands, blood cl 94.86
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 94.83
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 94.83
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 94.8
1s6c_A183 KV4 potassium channel-interacting protein kchip1B; 94.8
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 94.79
3lij_A494 Calcium/calmodulin dependent protein kinase with A 94.78
3q5i_A504 Protein kinase; CDPK, malaria, phosphotransferase, 94.78
3sg6_A450 Gcamp2, myosin light chain kinase, green fluoresce 94.77
2znd_A172 Programmed cell death protein 6; penta-EF-hand pro 94.73
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 94.71
1alv_A173 Calpain, S-camld; calcium binding, calmodulin like 94.71
1avs_A90 Troponin C; muscle contraction, calcium-activated, 94.57
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 94.57
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 94.46
1c7v_A81 CAVP, calcium vector protein; EF-hand family, calc 94.44
3mwu_A486 Calmodulin-domain protein kinase 1; serine/threoni 94.32
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 94.29
2be4_A 272 Hypothetical protein LOC449832; DR.36843, BC083168 94.27
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 94.21
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 94.19
3i5g_C159 Myosin catalytic light chain LC-1, mantle muscle; 94.19
2ggz_A211 Guanylyl cyclase-activating protein 3; EF hand, gu 94.1
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 94.09
2bl0_C142 Myosin regulatory light chain; muscle protein, sli 93.95
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 93.91
1qv0_A195 Obelin, OBL; photoprotein, bioluminescence, atomic 93.87
1bjf_A193 Neurocalcin delta; calcium-binding, myristoylation 93.79
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 93.79
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 93.72
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 93.69
3fwb_A161 Cell division control protein 31; gene gating, com 93.6
1tiz_A67 Calmodulin-related protein, putative; helix-turn-h 93.45
1jba_A204 GCAP-2, protein (guanylate cyclase activating prot 93.4
1y1x_A191 Leishmania major homolog of programmed cell death 93.34
2f33_A263 Calbindin; EF-hand, Ca2+-binding, metal binding pr 93.26
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 93.13
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 93.05
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 93.0
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 92.98
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 92.97
3a4u_B143 Multiple coagulation factor deficiency protein 2; 92.97
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 92.87
1k9u_A78 Polcalcin PHL P 7; pollen allergen, calcium-bindin 92.86
2hpk_A208 Photoprotein berovin; structural genomics, PSI, pr 92.76
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 92.74
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 92.7
3qrx_A169 Centrin; calcium-binding, EF-hand, cell division, 92.67
3j04_B143 Myosin regulatory light chain 2, smooth muscle MA 92.62
1q80_A174 SCP, sarcoplasmic calcium-binding protein; all-alp 92.62
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 92.4
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 92.38
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 92.36
2hps_A186 Coelenterazine-binding protein with bound coelent; 92.29
1nya_A176 Calerythrin; EF-hand, metal binding protein; NMR { 92.19
2be4_A272 Hypothetical protein LOC449832; DR.36843, BC083168 92.13
1wdc_C156 Scallop myosin; calcium binding protein, muscle pr 92.11
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 92.08
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 92.06
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 91.98
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 91.91
2d8n_A207 Recoverin; structural genomics, NPPSFA, national p 91.85
2ehb_A207 Calcineurin B-like protein 4; protein complex, Ca( 91.77
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 91.25
3h4s_E135 KCBP interacting Ca2+-binding protein; kinesin, mo 91.14
2mys_B166 Myosin; muscle protein, motor protein; HET: MLY; 2 91.07
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 90.71
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 90.66
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 90.65
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 90.64
1avs_A90 Troponin C; muscle contraction, calcium-activated, 90.61
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 90.54
1fpw_A190 Yeast frequenin, calcium-binding protein NCS-1; EF 90.53
2mys_C149 Myosin; muscle protein, motor protein; HET: MLY; 2 90.5
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 90.47
2kgr_A111 Intersectin-1; structure, alternative splicing, ca 90.45
2kz2_A94 Calmodulin, CAM; TR2C, metal binding protein; NMR 89.96
2opo_A86 Polcalcin CHE A 3; calcium-binding protein, dimer, 89.77
3sjs_A220 URE3-BP sequence specific DNA binding protein; EF- 89.73
1uhk_A191 Aequorin 2, aequorin; EF-hand motif, complex, lumi 89.7
1g8i_A190 Frequenin, neuronal calcium sensor 1; calcium bind 89.52
1ij5_A323 Plasmodial specific LAV1-2 protein; fourty kDa cal 89.5
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 89.5
1qx2_A76 Vitamin D-dependent calcium-binding protein, INTE; 89.48
2hps_A186 Coelenterazine-binding protein with bound coelent; 89.39
2jjz_A150 Ionized calcium-binding adapter molecule 2; EF-han 89.37
1rro_A108 RAT oncomodulin; calcium-binding protein; 1.30A {R 89.27
4ds7_A147 Calmodulin, CAM; protein binding, metal binding, s 89.11
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 89.03
3fs7_A109 Parvalbumin, thymic; calcium-binding protein, EF-h 88.9
3cs1_A219 Flagellar calcium-binding protein; myristoylated, 88.85
1jfj_A134 Ehcabp, calcium-binding protein; EF-hand, helix-lo 88.79
2pvb_A108 Protein (parvalbumin); calcium binding protein, me 88.78
1c07_A95 Protein (epidermal growth factor receptor pathway 88.67
1s6i_A188 CDPK, calcium-dependent protein kinase SK5; EF-han 88.35
1qls_A99 S100C protein, calgizzarin; metal-binding protein/ 88.27
2ktg_A85 Calmodulin, putative; ehcam, Ca-binding protein, p 88.23
3ll8_B155 Calcineurin subunit B type 1; protein-peptide dock 88.08
1m45_A148 MLC1P, myosin light chain; protein-peptide complex 88.01
2pmy_A91 RAS and EF-hand domain-containing protein; rasef, 87.93
2b1u_A71 Calmodulin-like protein 5; CLSP, calmodulin-like S 87.85
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 87.62
1c07_A95 Protein (epidermal growth factor receptor pathway 87.6
2f2o_A179 Calmodulin fused with calmodulin-binding domain of 87.51
1top_A162 Troponin C; contractIle system protein; 1.78A {Gal 87.37
1k2h_A93 S100A1, S-100 protein, alpha chain; non-covalent h 87.33
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 87.26
1w7j_B151 Myosin light chain 1; motor protein, unconventiona 87.06
1fi6_A92 EH domain protein REPS1; EPS15 homology domain, EF 86.98
5pal_A109 Parvalbumin; calcium-binding protein; 1.54A {Triak 86.97
1rwy_A109 Parvalbumin alpha; EF-hand, calcium-binding, calci 86.91
1j7q_A86 CAVP, calcium vector protein; EF-hand family, calc 86.87
2joj_A77 Centrin protein; N-terminal domain, centrin soluti 86.87
3khe_A191 Calmodulin-like domain protein kinase isoform 3; c 86.8
1yx7_A83 Calsensin, LAN3-6 antigen; calcium-binding protein 86.61
2lmt_A148 Calmodulin-related protein 97A; spermatogenesis, m 86.53
3nyv_A484 Calmodulin-domain protein kinase 1; serine/threoni 86.53
3e3r_A204 Calcyphosin, calcyphosine; human calcyphosine, EF- 86.42
1k8u_A90 S100A6, calcyclin, CACY; calcium regulatory protei 86.26
2jnf_A158 Troponin C; stretch activated muscle contraction, 86.23
3mse_B180 Calcium-dependent protein kinase, putative; CDPKS, 85.88
1bu3_A109 Calcium-binding protein; 1.65A {Merluccius bilinea 85.82
2kn2_A92 Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco 85.74
2jul_A256 Calsenilin; EF-hand, calcium, LXXLL, DNA binding p 85.41
2lv7_A100 Calcium-binding protein 7; metal binding protein; 85.3
1s6j_A87 CDPK, calcium-dependent protein kinase SK5; EF-han 85.15
3ox6_A153 Calcium-binding protein 1; EF-hand, calcium-sensor 85.05
1juo_A198 Sorcin; calcium-binding proteins, penta-EF-hand, P 84.93
3i5g_B153 Myosin regulatory light chain LC-2, mantle muscle; 84.91
2kyc_A108 Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand p 84.85
1wy9_A147 Allograft inflammatory factor 1; EF-hand, calucium 84.81
2d58_A107 Allograft inflammatory factor 1; EF-hand, metal bi 84.77
3akb_A166 Putative calcium binding protein; EF-hand, metal b 84.67
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 84.48
3a4u_B143 Multiple coagulation factor deficiency protein 2; 84.46
3bow_A714 Calpain-2 catalytic subunit; cysteine protease, in 84.4
2bl0_B145 Myosin regulatory light chain; muscle protein, sli 84.3
1pva_A110 Parvalbumin; calcium binding; 1.65A {Esox lucius} 84.14
2i7a_A174 Calpain 13; calcium-dependent cytoplasmic cysteine 84.06
1qjt_A99 EH1, epidermal growth factor receptor substrate su 84.0
1cb1_A78 Calbindin D9K; calcium-binding protein; NMR {Sus s 83.93
1djx_A 624 PLC-D1, phosphoinositide-specific phospholipase C, 83.85
2ovk_C159 Myosin catalytic light chain LC-1, mantle muscle, 83.76
3fia_A121 Intersectin-1; EH 1 domain, NESG, structural genom 83.59
1exr_A148 Calmodulin; high resolution, disorder, metal trans 83.45
1qxp_A 900 MU-like calpain; M-calpain, MU-calpain, catalytic 83.43
1wlz_A105 DJBP, CAP-binding protein complex interacting prot 82.95
2zfd_A226 Calcineurin B-like protein 2; calcium binding prot 82.88
2aao_A166 CDPK, calcium-dependent protein kinase, isoform AK 82.4
3k21_A191 PFCDPK3, calcium-dependent protein kinase 3; calci 82.19
1s1e_A224 KV channel interacting protein 1; kchip, calcium-b 82.03
2lvv_A226 Flagellar calcium-binding protein TB-24; EF-hand, 82.02
1dtl_A161 Cardiac troponin C; helix-turn-helix, structural p 81.91
2sas_A185 Sarcoplasmic calcium-binding protein; 2.40A {Branc 81.91
1snl_A103 Nucleobindin 1, calnuc; EF-hand, calcium-binding, 81.76
2l2e_A190 Calcium-binding protein NCS-1; NCS1P, myristoylate 81.43
2ccm_A191 Calexcitin; EF hand, calcium, signaling protein; 1 81.16
1iq3_A110 Ralbp1-interacting protein (partner of ralbp1); EF 81.04
2bec_A202 Calcineurin B homologous protein 2; calcineurin-ho 80.5
2l4h_A214 Calcium and integrin-binding protein 1; metal bind 80.46
1ggw_A140 Protein (CDC4P); light chain, cytokinesis, cell cy 80.33
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
Probab=97.42  E-value=0.00018  Score=57.34  Aligned_cols=142  Identities=13%  Similarity=0.030  Sum_probs=79.3

Q ss_pred             CCCcccccCCCCCCCCCCCCCCCCCCChhccccccccCCCCceeccchhhhHHHhhcchH-----HHHHHHHHHHHhhcC
Q 042070           33 PYVPRAVVAPDTENVKGTWGHEHNNMSVLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNP-----IASFVFSFLVHMAMS  107 (236)
Q Consensus        33 p~~~Ra~~a~~~~~p~Gt~~~~~~~~TvLQqHvaFFDrD~DGiI~P~DTy~Gfr~LGf~~-----~~s~~aa~~Ih~~lS  107 (236)
                      |..+.+...+.+.-|.|-+.........|++ ..-||.|+||.|...|--..++.+|++.     --..+..+ +...  
T Consensus         7 ~~~~g~~~~~~~~~~~~~~~~~~~~~~~l~~-F~~~D~d~~G~i~~~el~~~l~~lg~~~~~~~~~~~~~~~l-~~~~--   82 (198)
T 1juo_A            7 PGAGGGYYPGGYGGAPGGPAFPGQTQDPLYG-YFAAVAGQDGQIDADELQRCLTQSGIAGGYKPFNLETCRLM-VSML--   82 (198)
T ss_dssp             --------------------CTTCCCCTTHH-HHHHHHTTTTEECHHHHHHHHHHHTTTCSSCCCCHHHHHHH-HHHH--
T ss_pred             CCCCCCeeCCCcCCCCCCCCCCccccHHHHH-HHHHhCCCCCcCCHHHHHHHHHHhcccCCCCCCCHHHHHHH-HHHh--
Confidence            4444455555555555544344456677888 7789999999999999999999998741     11111111 1100  


Q ss_pred             CCCCCCCCCCCccceeeccccccccCCCCccccccccccc----------cchhHHHHhhcCCCCCCCCHHHHHHHHHhc
Q 042070          108 YATSPTWLPSPFFPIYVQNIHKAKHGSDTGTYDTEGRYVP----------VNFENIFSKYARTVPDKLTRAEIWHMTQSS  177 (236)
Q Consensus       108 y~T~~sw~PdP~f~Iyi~nIHk~kHGSDSg~YD~eGRFvP----------~kFE~iFsKya~~~pd~LT~~El~~m~~~n  177 (236)
                       -+                             |.+|...-          +++..+|..+++++.+.||..|+.++++..
T Consensus        83 -D~-----------------------------d~~g~i~~~eF~~~~~~~~~~~~~F~~~D~d~~G~I~~~el~~~l~~~  132 (198)
T 1juo_A           83 -DR-----------------------------DMSGTMGFNEFKELWAVLNGWRQHFISFDTDRSGTVDPQELQKALTTM  132 (198)
T ss_dssp             -CT-----------------------------TCSSCEEHHHHHHHHHHHHHHHHHHHTTCTTCCSEECHHHHHHHHHHT
T ss_pred             -CC-----------------------------CCCCeECHHHHHHHHHHHHHHHHHHHHhCCCCCCcCCHHHHHHHHHHh
Confidence             00                             01122221          466778999999998899999999999865


Q ss_pred             ccccCcchhHHHHHhHHHHHHhhcCCCCccchhhhcccc
Q 042070          178 RNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRCF  216 (236)
Q Consensus       178 R~~~D~~GW~a~~~EW~~~y~L~~~~dG~l~KediR~vY  216 (236)
                      ....       ..-|...++..+ +.||.|+.++...++
T Consensus       133 g~~~-------~~~~~~~l~~~~-d~dg~i~~~eF~~~~  163 (198)
T 1juo_A          133 GFRL-------SPQAVNSIAKRY-STNGKITFDDYIACC  163 (198)
T ss_dssp             TCCC-------CHHHHHHHHHHT-CSSSSEEHHHHHHHH
T ss_pred             CCCC-------CHHHHHHHHHHh-CCCCeEcHHHHHHHH
Confidence            3221       223444444444 899999988876654
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2lhi_A Calmodulin, serine/threonine-protein phosphatase catalytic subunit A1; yeast calmodulin, CNA1, metal binding protein; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>2qac_A Myosin A tail domain interacting protein MTIP; malaria invasion, structural genomics, PSI, protein structur initiative, structural genomics of pathogenic protozoa CONS SGPP; 1.70A {Plasmodium falciparum} PDB: 2auc_A Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2obh_A Centrin-2; DNA repair complex EF hand superfamily protein-peptide compl cycle; 1.80A {Homo sapiens} SCOP: a.39.1.5 PDB: 3kf9_A 1m39_A 2a4j_A 2k2i_A 1oqp_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>3dtp_E RLC, myosin regulatory light chain; muscle protein, smooth muscle, myosin subfragment 2, heavy meromyosin, essential light chain; 20.00A {Avicularia avicularia} Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>3pm8_A PFCDPK2, calcium-dependent protein kinase 2; malaria, structural genomics, structural genomics CONS SGC; 2.00A {Plasmodium falciparum K1} Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1wdc_B Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Y 1kqm_B* 1kwo_B* 1l2o_B* 1qvi_Y* 1s5g_Y* 1sr6_B 1b7t_Y 3jtd_B 3jvt_B 1scm_B 1kk8_B* 1dfk_Y 1dfl_Y* 2w4t_Y 2w4v_Y 2w4w_Y 2otg_B* 2os8_B* 3pn7_B ... Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2ct9_A Calcium-binding protein P22; EF-hand, metal binding protein; 2.20A {Rattus norvegicus} PDB: 2e30_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>3u0k_A Rcamp; fluorescent protein, calcium binding, EF-hand, genetically E calcium indicator; HET: NFA CRK; 2.10A {Entacmaea quadricolor} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>3dd4_A KV channel-interacting protein 4; EF-hands protein, ION transport, ionic channel, membrane, PO potassium channel, potassium transport, transport; 3.00A {Mus musculus} PDB: 2e6w_A Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1k94_A Grancalcin; penta-EF-hand protein, calcium binding protein, metal binding protein; 1.70A {Homo sapiens} SCOP: a.39.1.8 PDB: 1k95_A 1f4q_A 1f4o_A Back     alignment and structure
>1sjj_A Actinin; 3-helix bundle, calponin homology domain, calmodulin-like domain, actin binding protein, contractIle protein; 20.00A {Gallus gallus} SCOP: i.15.1.1 Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>2r2i_A Guanylyl cyclase-activating protein 1; EF hand, GCAP, guanylate cyclase activating protein, GCAP1, GCAP-1, calcium, lipoprotein, myristate; HET: MYR; 2.00A {Gallus gallus} Back     alignment and structure
>1gjy_A Sorcin, CP-22, V19; calcium binding, calcium-binding, phosphorylation; 2.2A {Chinese hamster} SCOP: a.39.1.8 Back     alignment and structure
>3li6_A Calcium-binding protein; calcium signaling protein, assemble free energy, dynamic behaviour, cytoskeleton, metal binding; 2.50A {Entamoeba histolytica} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>1dgu_A Calcium-saturated CIB; helical, EF-hands, blood clotting; NMR {Homo sapiens} SCOP: a.39.1.5 PDB: 1dgv_A 1xo5_A 1y1a_A* Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>1s6c_A KV4 potassium channel-interacting protein kchip1B; EF-hand, transport protein; 2.00A {Rattus norvegicus} SCOP: a.39.1.5 PDB: 2nz0_A 2i2r_E Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* Back     alignment and structure
>3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} Back     alignment and structure
>3sg6_A Gcamp2, myosin light chain kinase, green fluorescent PROT calmodulin chimera; calcium sensor, fluorescent protein; HET: CRO; 1.70A {Gallus gallus} PDB: 3evu_A* 3ek4_A* 3ek7_A* 3evv_A* 3ek8_A* 3ekh_A* 3sg2_A* 3sg3_A* 3sg7_A* 3ekj_A* 3sg4_A* 3sg5_A* 3evr_A* 3o78_A* 3o77_A* 1trf_A Back     alignment and structure
>2znd_A Programmed cell death protein 6; penta-EF-hand protein, calcium binding protein, apoptosis, calcium, endoplasmic reticulum, membrane, nucleus; 1.70A {Homo sapiens} PDB: 2zn9_A 2zn8_A 1hqv_A 3aak_A 2zne_A 2zrs_A 2zrt_A 3aaj_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1alv_A Calpain, S-camld; calcium binding, calmodulin like, domain of cystein protease; 1.90A {Sus scrofa} SCOP: a.39.1.8 PDB: 1alw_A* 1nx0_A 1nx1_A 1nx2_A 1nx3_A* 1kfu_S 1kfx_S 3bow_B 1u5i_B 1df0_B 3df0_B 1aj5_A 1dvi_A 1np8_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1c7v_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1c7w_A Back     alignment and structure
>3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>3i5g_C Myosin catalytic light chain LC-1, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_C 3i5h_C 3i5i_C Back     alignment and structure
>2ggz_A Guanylyl cyclase-activating protein 3; EF hand, guanylate cyclase activating protein, GCAP, GCAP3, GCAP-3, lyase activator; 3.00A {Homo sapiens} Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2bl0_C Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>1qv0_A Obelin, OBL; photoprotein, bioluminescence, atomic resolution, Ca binding, EF-hand, luminescent protein; HET: CZH; 1.10A {Obelia longissima} SCOP: a.39.1.5 PDB: 1qv1_A* 1sl9_A* 1el4_A* 2f8p_A* 1sl7_A 1jf2_A* 1s36_A* 1jf0_A* 3kpx_A* Back     alignment and structure
>1bjf_A Neurocalcin delta; calcium-binding, myristoylation, neuronal specific guanylate cyclase activator; 2.40A {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3fwb_A Cell division control protein 31; gene gating, complex, cell cycle, cell division, mitosis, MR transport, nuclear pore complex, nucleus, phosphoprotein; 2.50A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2gv5_A 2doq_A 3fwc_A Back     alignment and structure
>1tiz_A Calmodulin-related protein, putative; helix-turn-helix, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} SCOP: a.39.1.5 Back     alignment and structure
>1jba_A GCAP-2, protein (guanylate cyclase activating protein 2); EF-hand, calcium-binding protein, guanylyl cyclase regulation, lyase; NMR {Bos taurus} SCOP: a.39.1.5 Back     alignment and structure
>1y1x_A Leishmania major homolog of programmed cell death protein; SGPP, structural genomics, PSI; 1.95A {Leishmania major} SCOP: a.39.1.8 Back     alignment and structure
>2f33_A Calbindin; EF-hand, Ca2+-binding, metal binding protein; NMR {Rattus norvegicus} PDB: 2g9b_A Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1k9u_A Polcalcin PHL P 7; pollen allergen, calcium-binding, EF-hand, cross-reactivity; 1.75A {Phleum pratense} SCOP: a.39.1.10 Back     alignment and structure
>2hpk_A Photoprotein berovin; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics, secsg; 2.00A {Beroe abyssicola} Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>3qrx_A Centrin; calcium-binding, EF-hand, cell division, calcium binding, ME binding protein-toxin complex; 2.20A {Chlamydomonas reinhardtii} PDB: 2ggm_A 2ami_A 1zmz_A Back     alignment and structure
>3j04_B Myosin regulatory light chain 2, smooth muscle MA isoform; phosphorylation, 2D crystalline arrays, myosin regulation, M light chains, structural protein; 20.00A {Gallus gallus} Back     alignment and structure
>1q80_A SCP, sarcoplasmic calcium-binding protein; all-alpha, metal binding protein; NMR {Neanthes diversicolor} SCOP: a.39.1.5 PDB: 2scp_A Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>1nya_A Calerythrin; EF-hand, metal binding protein; NMR {Saccharopolyspora erythraea} SCOP: a.39.1.5 Back     alignment and structure
>2be4_A Hypothetical protein LOC449832; DR.36843, BC083168, calicium binding, EF-hand superfamily, S genomics, protein structure initiative, PSI; 2.10A {Danio rerio} PDB: 2q4u_A Back     alignment and structure
>1wdc_C Scallop myosin; calcium binding protein, muscle protein; 2.00A {Argopecten irradians} SCOP: a.39.1.5 PDB: 1kk7_Z 1kqm_C* 1kwo_C* 1l2o_C* 1qvi_Z* 1s5g_Z* 1sr6_C 1b7t_Z 3jvt_C 3jtd_C 1kk8_C* 2ec6_C 1dfk_Z 1dfl_Z* 2w4t_Z 2w4v_Z 2w4w_Z 2otg_C* 2os8_C* 3pn7_C ... Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2d8n_A Recoverin; structural genomics, NPPSFA, national project on protein STR and functional analyses, riken structural genomics/proteomi initiative; 2.20A {Homo sapiens} PDB: 2i94_A 1iku_A* 1jsa_A* 1omr_A 1rec_A 1la3_A* 1omv_A 2het_A Back     alignment and structure
>2ehb_A Calcineurin B-like protein 4; protein complex, Ca(II) IONS bound to SOS3 (EF-hands 1 and 4 FISL motif; 2.10A {Arabidopsis thaliana} PDB: 1v1g_A 1v1f_A Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3h4s_E KCBP interacting Ca2+-binding protein; kinesin, motor protein, regulation, complex, calcium, EF- hand, calmodulin, ATP-binding, microtubule; HET: ADP; 2.40A {Arabidopsis thaliana} Back     alignment and structure
>2mys_B Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1i84_U* 1m8q_B* 1mvw_B* 1o18_E* 1o19_B* 1o1a_B* 1o1b_B* 1o1c_B* 1o1d_B* 1o1e_B* 1o1f_B* 1o1g_B* 2w4a_B 2w4g_B 2w4h_B Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1avs_A Troponin C; muscle contraction, calcium-activated, E-F hand calcium-binding protein; 1.75A {Gallus gallus} SCOP: a.39.1.5 PDB: 1blq_A 1skt_A 1tnp_A 1tnq_A 1zac_A 1smg_A 1npq_A 1trf_A Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1fpw_A Yeast frequenin, calcium-binding protein NCS-1; EF-hand, metal binding protein; NMR {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 2ju0_A Back     alignment and structure
>2mys_C Myosin; muscle protein, motor protein; HET: MLY; 2.80A {Gallus gallus} SCOP: a.39.1.5 PDB: 1m8q_C* 1mvw_C* 1o18_F* 1o19_C* 1o1a_C* 1o1b_C* 1o1c_C* 1o1d_C* 1o1e_C* 1o1f_C* 1o1g_C* Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>2kgr_A Intersectin-1; structure, alternative splicing, calcium, cell junction, cell projection, coiled coil, endocytosis, membrane, phosphoprotein; NMR {Homo sapiens} Back     alignment and structure
>2kz2_A Calmodulin, CAM; TR2C, metal binding protein; NMR {Gallus gallus} Back     alignment and structure
>2opo_A Polcalcin CHE A 3; calcium-binding protein, dimer, domain-swapping, EF-hand; 1.75A {Chenopodium album} SCOP: a.39.1.10 PDB: 1h4b_A Back     alignment and structure
>3sjs_A URE3-BP sequence specific DNA binding protein; EF-hand, structural genomics, seattle S genomics center for infectious disease, ssgcid; 1.90A {Entamoeba histolytica} PDB: 3sia_A 3sib_A Back     alignment and structure
>1uhk_A Aequorin 2, aequorin; EF-hand motif, complex, luminescent protein; HET: CZN; 1.60A {Aequorea victoria} SCOP: a.39.1.5 PDB: 1ej3_A* 1uhi_A* 1uhj_A* 1uhh_A* 1sl8_A Back     alignment and structure
>1g8i_A Frequenin, neuronal calcium sensor 1; calcium binding-protein, EF-hand, calcium ION, metal binding protein; HET: 1PE P6G; 1.90A {Homo sapiens} SCOP: a.39.1.5 PDB: 2lcp_A Back     alignment and structure
>1ij5_A Plasmodial specific LAV1-2 protein; fourty kDa calcium binding protein, CBP40, metal binding protein; 3.00A {Physarum polycephalum} SCOP: a.39.1.9 PDB: 1ij6_A Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>1qx2_A Vitamin D-dependent calcium-binding protein, INTE; EF-hand (helix-loop-helix) calcium binding protein, four-HEL domain, protein engineering; HET: FME; 1.44A {Bos taurus} SCOP: a.39.1.1 PDB: 1kcy_A 1kqv_A 1ksm_A 1n65_A 1ht9_A 4icb_A 1cdn_A 1clb_A 2bca_A 1ig5_A 1igv_A 3icb_A 1d1o_A 1b1g_A 2bcb_A 1boc_A 1bod_A Back     alignment and structure
>2hps_A Coelenterazine-binding protein with bound coelent; bioluminescence, southeast collabora structural genomics, secsg, structural genomics, PSI; HET: CTZ; 1.72A {Renilla muelleri} PDB: 2hq8_A Back     alignment and structure
>2jjz_A Ionized calcium-binding adapter molecule 2; EF-hand, actin crosslinking, ionized calciu binding adapter molecule 2, metal-binding protein; 2.15A {Homo sapiens} PDB: 2jjz_B 2vtg_A Back     alignment and structure
>1rro_A RAT oncomodulin; calcium-binding protein; 1.30A {Rattus rattus} SCOP: a.39.1.4 PDB: 1omd_A 2nln_A 1ttx_A Back     alignment and structure
>4ds7_A Calmodulin, CAM; protein binding, metal binding, structura; 2.15A {Kluyveromyces lactis} PDB: 1lkj_A 2lhh_A 1f54_A 1f55_A Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>3fs7_A Parvalbumin, thymic; calcium-binding protein, EF-hand, acetylation, calcium, metal binding protein; 1.95A {Gallus gallus} SCOP: a.39.1.4 PDB: 2kqy_A Back     alignment and structure
>3cs1_A Flagellar calcium-binding protein; myristoylated, palmitoylated, SEN membrane targeting, EF-hand, cell projection, cilium; 2.00A {Trypanosoma cruzi} Back     alignment and structure
>1jfj_A Ehcabp, calcium-binding protein; EF-hand, helix-loop-helix, metal binding protein; NMR {Entamoeba histolytica} SCOP: a.39.1.5 PDB: 1jfk_A 2nxq_A 3px1_A 3qjk_A 2jnx_A 2i18_A Back     alignment and structure
>2pvb_A Protein (parvalbumin); calcium binding protein, metal binding protein; 0.91A {Esox lucius} SCOP: a.39.1.4 PDB: 1pvb_A 2pal_A 1pal_A 3pal_A 4pal_A 4cpv_A 1cdp_A 5cpv_A 1b8r_A 1b9a_A 1b8l_A 1b8c_A 1a75_B 1a75_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>1s6i_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>1qls_A S100C protein, calgizzarin; metal-binding protein/inhibitor, S100 family, EF-hand protein, complex (ligand/annexin), ligand of annexin II; 2.3A {Sus scrofa} SCOP: a.39.1.2 PDB: 1nsh_A Back     alignment and structure
>3ll8_B Calcineurin subunit B type 1; protein-peptide docking, protein targeting, AKA beta-augmentation, calmodulin-binding, membrane, hydrolase; 2.00A {Homo sapiens} PDB: 1mf8_B* 2p6b_B 1aui_B 1m63_B* 1tco_B* Back     alignment and structure
>1m45_A MLC1P, myosin light chain; protein-peptide complex, myosin light chain, cell cycle protein; 1.65A {Saccharomyces cerevisiae} SCOP: a.39.1.5 PDB: 1m46_A 1n2d_A 2fcd_A 2fce_A Back     alignment and structure
>2pmy_A RAS and EF-hand domain-containing protein; rasef, calcium-binding domain, structural genomics, structural genomics consortium, SGC; 2.30A {Homo sapiens} Back     alignment and structure
>2b1u_A Calmodulin-like protein 5; CLSP, calmodulin-like SKIN protein, solution structure, backbone dynamic, structural genomics; NMR {Homo sapiens} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>1c07_A Protein (epidermal growth factor receptor pathway substrate 15); calcium binding, signaling domain, NPF binding, FW binding, EF-hand, EH domain; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2f2o_A Calmodulin fused with calmodulin-binding domain of calcineurin; EF-hands, calcium, metal binding protein; 2.17A {Bos taurus} PDB: 2f2p_A Back     alignment and structure
>1top_A Troponin C; contractIle system protein; 1.78A {Gallus gallus} SCOP: a.39.1.5 PDB: 1ncy_A 1ncz_A 1ncx_A 1ytz_C* 1yv0_C 1tnw_A 1tnx_A 5tnc_A 2w49_0 2w4u_0 4tnc_A 1a2x_A 1tcf_A 1tn4_A 2tn4_A 1aj4_A 1jc2_A 1fi5_A 1sbj_A 1scv_A ... Back     alignment and structure
>1k2h_A S100A1, S-100 protein, alpha chain; non-covalent homodimer, X-type four-helix bundle, metal binding protein; NMR {Rattus norvegicus} SCOP: a.39.1.2 PDB: 1zfs_A 2k2f_A 2kbm_A 2l0p_A 2jpt_A Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>1w7j_B Myosin light chain 1; motor protein, unconventional myosin, myosin V, chicken, molecular motor, ATPase, ELC, IQ motif, muscle protein, ATP-binding; HET: ADP; 2A {Homo sapiens} SCOP: a.39.1.5 PDB: 1w7i_B* 1oe9_B* 3j04_C 1br1_B* 1br4_B* 1i84_T* 3dtp_C 2w4a_C 2w4g_C 2w4h_C Back     alignment and structure
>1fi6_A EH domain protein REPS1; EPS15 homology domain, EF hand, calcium, RAS signal transduction, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>5pal_A Parvalbumin; calcium-binding protein; 1.54A {Triakis semifasciata} SCOP: a.39.1.4 Back     alignment and structure
>1rwy_A Parvalbumin alpha; EF-hand, calcium-binding, calcium-binding protein; HET: PG4; 1.05A {Rattus norvegicus} SCOP: a.39.1.4 PDB: 1rtp_1* 2jww_A 3f45_A 1s3p_A 1xvj_A 1rjv_A 1rk9_A 1g33_A Back     alignment and structure
>1j7q_A CAVP, calcium vector protein; EF-hand family, calcium binding protein, metal binding protein; NMR {Branchiostoma lanceolatum} SCOP: a.39.1.5 PDB: 1j7r_A Back     alignment and structure
>2joj_A Centrin protein; N-terminal domain, centrin solution structure, EF-hand calcium binding protein, cell cycle; NMR {Euplotes octocarinatus} Back     alignment and structure
>3khe_A Calmodulin-like domain protein kinase isoform 3; calcium dependent kinase, structural genomics, structural GE consortium, SGC, ATP-binding; 1.95A {Toxoplasma gondii} Back     alignment and structure
>1yx7_A Calsensin, LAN3-6 antigen; calcium-binding protein EF-hand, helix-loop- helix, nervous system, metal binding protein; NMR {Haemopis marmorata} PDB: 1yx8_A Back     alignment and structure
>2lmt_A Calmodulin-related protein 97A; spermatogenesis, metal binding protein; NMR {Drosophila melanogaster} PDB: 2lmu_A 2lmv_A Back     alignment and structure
>3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* Back     alignment and structure
>3e3r_A Calcyphosin, calcyphosine; human calcyphosine, EF-hand, phosphoprotein, calcium binding; 2.65A {Homo sapiens} Back     alignment and structure
>1k8u_A S100A6, calcyclin, CACY; calcium regulatory protein, calcium free, signaling protein; HET: MSE; 1.15A {Homo sapiens} SCOP: a.39.1.2 PDB: 1k96_A 1k9k_A 1k9p_A 1a03_A 1cnp_A 1jwd_A 2cnp_A 2jtt_A Back     alignment and structure
>2jnf_A Troponin C; stretch activated muscle contraction, EF-hand, metal binding protein; NMR {Lethocerus indicus} PDB: 2k2a_A Back     alignment and structure
>3mse_B Calcium-dependent protein kinase, putative; CDPKS, malaria, structural genomics consortium, SGC, transfe; 2.10A {Plasmodium falciparum} Back     alignment and structure
>1bu3_A Calcium-binding protein; 1.65A {Merluccius bilinearis} SCOP: a.39.1.4 Back     alignment and structure
>2kn2_A Calmodulin; S MAPK phosphatase 1, NTMKP1, tobacco MKP1, metal binding Pro; NMR {Glycine max} Back     alignment and structure
>2jul_A Calsenilin; EF-hand, calcium, LXXLL, DNA binding protein, dimer, alternative splicing, apoptosis, cytoplasm, endoplasmic reticulum, golgi apparatus; NMR {Mus musculus} Back     alignment and structure
>2lv7_A Calcium-binding protein 7; metal binding protein; NMR {Homo sapiens} Back     alignment and structure
>1s6j_A CDPK, calcium-dependent protein kinase SK5; EF-hand, helix-loop-helix, calcium-binding, calmodulin superfamily, transferase, plant protein; NMR {Glycine max} SCOP: a.39.1.5 Back     alignment and structure
>3ox6_A Calcium-binding protein 1; EF-hand, calcium-sensor; 2.40A {Homo sapiens} PDB: 3ox5_A 2lan_A 2lap_A 2k7b_A 2k7c_A 2k7d_A Back     alignment and structure
>1juo_A Sorcin; calcium-binding proteins, penta-EF-hand, PEF, X-RAY, metal transport; 2.20A {Homo sapiens} SCOP: a.39.1.8 PDB: 2jc2_A Back     alignment and structure
>3i5g_B Myosin regulatory light chain LC-2, mantle muscle; rigor-like, squid, muscle myosin, contractIle protein; 2.60A {Todarodes pacificus} PDB: 3i5f_B 3i5h_B 3i5i_B Back     alignment and structure
>2kyc_A Parvalbumin-3, parvalbumin, thymic CPV3; EF-hand protein, calcium binding protein; NMR {Gallus gallus} PDB: 2kyf_A Back     alignment and structure
>1wy9_A Allograft inflammatory factor 1; EF-hand, calucium binding, metal binding protein; 2.10A {Mus musculus} PDB: 2g2b_A Back     alignment and structure
>2d58_A Allograft inflammatory factor 1; EF-hand, metal binding protein; 1.90A {Homo sapiens} Back     alignment and structure
>3akb_A Putative calcium binding protein; EF-hand, metal binding protein; 1.50A {Streptomyces coelicolor} PDB: 3aka_A Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>3a4u_B Multiple coagulation factor deficiency protein 2; lectin, ergic, ER, golgi, transport, disulfide bond, endopla reticulum, ER-golgi transport; 1.84A {Homo sapiens} PDB: 2vrg_A 3lcp_C Back     alignment and structure
>3bow_A Calpain-2 catalytic subunit; cysteine protease, inhibitor, cell membrane, hydrolase, MEMB protease, thiol protease, phosphoprotein; 2.40A {Rattus norvegicus} PDB: 3df0_A 1df0_A 1u5i_A 1kfu_L 1kfx_L Back     alignment and structure
>2bl0_B Myosin regulatory light chain; muscle protein, slime mould, EF-hand; 1.75A {Physarum polycephalum} Back     alignment and structure
>1pva_A Parvalbumin; calcium binding; 1.65A {Esox lucius} SCOP: a.39.1.4 PDB: 2pas_A 3pat_A Back     alignment and structure
>2i7a_A Calpain 13; calcium-dependent cytoplasmic cysteine proteinases, like, EF-hand, structural genomics, structural genomics CON SGC, hydrolase; 1.80A {Homo sapiens} Back     alignment and structure
>1qjt_A EH1, epidermal growth factor receptor substrate substrate 15, EPS15; EH domain, EF-hand, solution structure, S100 protein; NMR {Mus musculus} SCOP: a.39.1.6 Back     alignment and structure
>1cb1_A Calbindin D9K; calcium-binding protein; NMR {Sus scrofa} SCOP: a.39.1.1 Back     alignment and structure
>1djx_A PLC-D1, phosphoinositide-specific phospholipase C, isozyme delta1; phosphoric diester hydrolase, hydrolase, lipid degradation, transducer; HET: I3P; 2.30A {Rattus norvegicus} SCOP: a.39.1.7 b.7.1.1 c.1.18.1 PDB: 1djg_A 1dji_A 1djh_A* 1djw_A* 1djy_A* 1djz_A* 2isd_A 1qas_A 1qat_A Back     alignment and structure
>3fia_A Intersectin-1; EH 1 domain, NESG, structural genomics, PSI- 2, protein structure initiative, northeast structural genomics consortium; 1.45A {Homo sapiens} PDB: 2khn_A Back     alignment and structure
>1exr_A Calmodulin; high resolution, disorder, metal transport; 1.00A {Paramecium tetraurelia} SCOP: a.39.1.5 PDB: 1n0y_A 1osa_A 1clm_A 1mxe_A 2bbm_A 2bbn_A 4cln_A 4djc_A 2wel_D* 2x51_B 2vas_B* 2bkh_B 3gn4_B 3l9i_C 2ygg_B* 2w73_A 1lvc_D* 1wrz_A 2bki_B 2r28_A ... Back     alignment and structure
>1qxp_A MU-like calpain; M-calpain, MU-calpain, catalytic triad, Ca(2+) requirement, hydrolase chimera; 2.80A {Rattus norvegicus} SCOP: a.39.1.8 a.39.1.8 b.14.1.1 d.3.1.3 Back     alignment and structure
>1wlz_A DJBP, CAP-binding protein complex interacting protein 1 isoform A; EF-hand like, unknown function; 1.60A {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2zfd_A Calcineurin B-like protein 2; calcium binding protein, protein-protein complex, ATP-bindin kinase, nucleotide-binding; 1.20A {Arabidopsis thaliana} SCOP: a.39.1.5 PDB: 1uhn_A Back     alignment and structure
>2aao_A CDPK, calcium-dependent protein kinase, isoform AK1; calmodulin-like domain, EF calcium binding protein, transferase; 2.00A {Arabidopsis thaliana} Back     alignment and structure
>3k21_A PFCDPK3, calcium-dependent protein kinase 3; calcium kinase structural genomics malaria, structural genom consortium, SGC, ATP-binding; 1.15A {Plasmodium falciparum} PDB: 3o4y_A Back     alignment and structure
>1s1e_A KV channel interacting protein 1; kchip, calcium-binding protein, EF-finger, transport protein; 2.30A {Homo sapiens} SCOP: a.39.1.5 Back     alignment and structure
>2lvv_A Flagellar calcium-binding protein TB-24; EF-hand, metal binding protein; NMR {Trypanosoma brucei brucei} Back     alignment and structure
>1dtl_A Cardiac troponin C; helix-turn-helix, structural protein; HET: BEP; 2.15A {Gallus gallus} SCOP: a.39.1.5 PDB: 1j1d_A 1j1e_A 2jt3_A 2jt0_A 1la0_A 2jtz_A* 2jt8_A* 2kfx_T* 1wrk_A* 1wrl_A* 1ap4_A 1lxf_C* 1mxl_C 1spy_A 2krd_C* 2l1r_A* 3rv5_A* 2ctn_A 2kgb_C 2jxl_A ... Back     alignment and structure
>2sas_A Sarcoplasmic calcium-binding protein; 2.40A {Branchiostoma lanceolatum} SCOP: a.39.1.5 Back     alignment and structure
>1snl_A Nucleobindin 1, calnuc; EF-hand, calcium-binding, metal binding protein; NMR {Homo sapiens} SCOP: a.39.1.7 Back     alignment and structure
>2l2e_A Calcium-binding protein NCS-1; NCS1P, myristoylated, metal binding protein; HET: MYR; NMR {Schizosaccharomyces pombe} Back     alignment and structure
>2ccm_A Calexcitin; EF hand, calcium, signaling protein; 1.8A {Loligo pealeii} Back     alignment and structure
>1iq3_A Ralbp1-interacting protein (partner of ralbp1); EF-hand domain, POB1 EH domain, riken structural genomics/proteomics initiative, RSGI; NMR {Homo sapiens} SCOP: a.39.1.6 Back     alignment and structure
>2bec_A Calcineurin B homologous protein 2; calcineurin-homologous protein, calcium-binding protein, NHE1 regulating protein; 2.70A {Homo sapiens} Back     alignment and structure
>2l4h_A Calcium and integrin-binding protein 1; metal binding protei; NMR {Homo sapiens} PDB: 2l4i_A 2lm5_A Back     alignment and structure
>1ggw_A Protein (CDC4P); light chain, cytokinesis, cell cycle, EF-hand; NMR {Schizosaccharomyces pombe} SCOP: a.39.1.5 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 236
d1ij5a_321 a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-bind 0.003
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Length = 321 Back     information, alignment and structure

class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
domain: Cbp40 (plasmodial specific CaII-binding protein LAV1-2)
species: Physarum polycephalum [TaxId: 5791]

 Score = 35.8 bits (81), Expect = 0.003
 Identities = 18/149 (12%), Positives = 37/149 (24%)

Query: 68  FDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNI 127
               G G     +  +             +    V +        +++        +  +
Sbjct: 131 SAVSGSGKFSFQDLKQVLAKYADTIPEGPLKKLFVMVENDTKGRMSYITLVAVANDLAAL 190

Query: 128 HKAKHGSDTGTYDTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWI 187
                  DT +  T  R              ++V D L R      +     +  +   +
Sbjct: 191 VADFRKIDTNSNGTLSRKEFREHFVRLGFDKKSVQDALFRYADEDESDDVGFSEYVHLGL 250

Query: 188 ASKLEWGALYILAKDDEGYLSKEAVRRCF 216
              +          D  G LSKE V++  
Sbjct: 251 CLLVLRILYAFADFDKSGQLSKEEVQKVL 279

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query236
d1lkja_146 Calmodulin {Baker's yeast (Saccharomyces cerevisia 97.13
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 96.85
d2mysc_145 Myosin Regulatory Chain {Chicken (Gallus gallus) [ 96.82
d1ggwa_140 Cdc4p {Fission yeast (Schizosaccharomyces pombe) [ 96.61
d2obha1141 Calmodulin {Human (Homo sapiens) [TaxId: 9606]} 96.51
d1w7jb1139 Myosin Essential Chain {Human (Homo sapiens) [TaxI 96.37
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 96.3
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 96.23
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 96.18
d1m45a_146 Myosin Light Chain Mlc1p {Baker's yeast (Saccharom 96.09
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 95.99
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 95.74
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 95.71
d1wlza183 DJ-1-binding protein, DJBP {Human (Homo sapiens) [ 95.68
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.67
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 95.63
d1s6ia_182 Calcium-dependent protein kinase sk5 CLD {Soybean 95.63
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 95.61
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.5
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 95.35
d1wdcb_142 Myosin Essential Chain {Bay scallop (Aequipecten i 95.32
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 95.24
d1avsa_81 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 95.19
d1wdcc_152 Myosin Regulatory Chain {Bay scallop (Aequipecten 94.99
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 94.46
d1hqva_181 Apoptosis-linked protein alg-2 {Mouse (Mus musculu 94.39
d2pq3a173 Calmodulin {Rattus norvegicus [TaxId: 10116]} 94.16
d1qv0a_189 Calcium-regulated photoprotein {Hydrozoa (Obelia l 94.11
d1c07a_95 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 93.88
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 93.8
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 93.78
d1ij5a_321 Cbp40 (plasmodial specific CaII-binding protein LA 93.75
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 93.53
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 92.98
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 92.86
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 92.84
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 92.84
d1c7va_68 Calcium vector protein {Amphioxus (Branchiostoma l 92.52
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 92.44
d1qjta_99 Eps15 {Mouse (Mus musculus) [TaxId: 10090]} 92.28
d1jfja_134 EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 92.19
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 91.95
d1dtla_156 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 91.78
d1wrka182 Troponin C {Human (Homo sapiens), cardiac isoform 91.69
d2scpa_174 Sarcoplasmic calcium-binding protein {Sandworm (Ne 91.68
d1tiza_67 Calmodulin-related protein T21P5.17 {Thale cress ( 91.52
d2sasa_185 Sarcoplasmic calcium-binding protein {Amphioxus (B 91.27
d1nyaa_176 Calerythrin {Saccharopolyspora erythraea [TaxId: 1 90.91
d1rwya_109 Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} 90.31
d1juoa_172 Sorcin {Human (Homo sapiens) [TaxId: 9606]} 90.24
d1uhka1187 Calcium-regulated photoprotein {Jellyfish (Aequore 89.51
d1exra_146 Calmodulin {Ciliate (Paramecium tetraurelia) [TaxI 89.5
d2hf5a133 Troponin C {Human (Homo sapiens), cardiac isoform 89.33
d2jxca195 Eps15 {Human (Homo sapiens) [TaxId: 9606]} 88.91
d1y1xa_182 Programmed cell death 6 protein-like protein {Leis 88.85
d2opoa181 Polcalcin Che a 3 {Pigweed (Chenopodium album) [Ta 88.69
d1rroa_108 Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116 88.6
d1fi6a_92 Reps1 {Mouse (Mus musculus) [TaxId: 10090]} 88.6
d1iq3a_110 Pob1 {Human (Homo sapiens) [TaxId: 9606]} 88.58
d1topa_162 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 88.5
d1jbaa_189 Guanylate cyclase activating protein 2, GCAP-2 {Co 87.77
d2pvba_107 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 87.6
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 87.48
d1fi5a_81 Troponin C {Chicken (Gallus gallus), cardiac isofo 87.26
d1oqpa_77 Caltractin (centrin 2) {Green algae (Chlamydomonas 87.18
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 87.16
d1e8aa_87 Calcyclin (S100) {Human (Homo sapiens), calgranuli 87.12
d1pvaa_109 Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} 86.28
d1k94a_165 Grancalcin {Human (Homo sapiens) [TaxId: 9606]} 84.34
d1omra_201 Recoverin {Cow (Bos taurus) [TaxId: 9913]} 84.13
d1fpwa_190 Frequenin (neuronal calcium sensor 1) {Baker's yea 84.0
d1jc2a_75 Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} 83.91
d1snla_99 Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [Tax 83.06
d1f54a_77 Calmodulin {Baker's yeast (Saccharomyces cerevisia 82.82
d1auib_165 Calcineurin regulatory subunit (B-chain) {Human (H 82.28
d1df0a1186 Calpain large subunit, C-terminal domain (domain I 82.14
d2mysb_145 Myosin Essential Chain {Chicken (Gallus gallus) [T 81.96
d2zkmx1170 Phospholipase C-beta-2 {Human (Homo sapiens) [TaxI 81.55
d2fcea161 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 80.99
d1fw4a_65 Calmodulin {Cow (Bos taurus) [TaxId: 9913]} 80.36
d2zfda1183 Calcineurin B-like protein 2 {Thale cress (Arabido 80.19
d5pala_109 Parvalbumin {Leopard shark (Triakis semifasciata) 80.06
>d1lkja_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
class: All alpha proteins
fold: EF Hand-like
superfamily: EF-hand
family: Calmodulin-like
domain: Calmodulin
species: Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]

Probab=97.13  E-value=0.00013  Score=54.39  Aligned_cols=133  Identities=16%  Similarity=0.235  Sum_probs=87.2

Q ss_pred             hhccccccccCCCCceeccchhhhHHHhhcchHHHHHHHHHHHHhhcCCCCCCCCCCCCccceeeccccccccCCCCccc
Q 042070           60 VLQQHAAFFDQDGDGIIYPWETFRGFRLIGFNPIASFVFSFLVHMAMSYATSPTWLPSPFFPIYVQNIHKAKHGSDTGTY  139 (236)
Q Consensus        60 vLQqHvaFFDrD~DGiI~P~DTy~Gfr~LGf~~~~s~~aa~~Ih~~lSy~T~~sw~PdP~f~Iyi~nIHk~kHGSDSg~Y  139 (236)
                      .|++--..||+|+||.|.+.|....++.+|+++.-..+..++.+.......   .+.   |.-.+.-++...+..++   
T Consensus        11 ~l~~~F~~~D~d~~G~i~~~e~~~~l~~~g~~~~~~~~~~~~~~~~~~~~~---~~~---~~~~~~~~~~~~~~~~~---   81 (146)
T d1lkja_          11 EFKEAFALFDKDNNGSISSSELATVMRSLGLSPSEAEVNDLMNEIDVDGNH---QIE---FSEFLALMSRQLKSNDS---   81 (146)
T ss_dssp             HHHHHHHHHCCSSSSEEEHHHHHHHHHHHTCCCCHHHHHHHHHHHCSSSCC---EEE---HHHHHHHHHHHTCCCCH---
T ss_pred             HHHHHHHHHCCCCCCcEeHHHHHHHHHhcCCCCCHHHHHHHHHHhccCCcc---ccc---HHHHHHHHHHhhccccH---
Confidence            356667789999999999999999999999998765555554444433221   111   11112222222222221   


Q ss_pred             cccccccccchhHHHHhhcCCCCCCCCHHHHHHHHHhcccccCcchhHHHHHhHHHHHHhhcCCCCccchhhhccc
Q 042070          140 DTEGRYVPVNFENIFSKYARTVPDKLTRAEIWHMTQSSRNAFDIFGWIASKLEWGALYILAKDDEGYLSKEAVRRC  215 (236)
Q Consensus       140 D~eGRFvP~kFE~iFsKya~~~pd~LT~~El~~m~~~nR~~~D~~GW~a~~~EW~~~y~L~~~~dG~l~KediR~v  215 (236)
                             -++...+|.+|++.+.+.||..|+.+++.........       -|...++.-+.+.||.++-++...+
T Consensus        82 -------~~~~~~aF~~~D~d~~G~I~~~el~~~l~~~g~~~~~-------~~~~~~~~~~dd~dG~I~~~eF~~~  143 (146)
T d1lkja_          82 -------EQELLEAFKVFDKNGDGLISAAELKHVLTSIGEKLTD-------AEVDDMLREVSDGSGEINIQQFAAL  143 (146)
T ss_dssp             -------HHHHHHHHHHHCSSSSCEEEHHHHHHHHHHHTCSCCH-------HHHHHHHHHHCCSSSEEEHHHHHHH
T ss_pred             -------HHHHHHHHHHhCCCCCCcCcHHHHHHHHHHcCCcccH-------HHHHHHHHhccCCCCeEeHHHHHHH
Confidence                   2567788999999999999999999999766543332       2334444455588999998876544
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d2mysc_ a.39.1.5 (C:) Myosin Regulatory Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1ggwa_ a.39.1.5 (A:) Cdc4p {Fission yeast (Schizosaccharomyces pombe) [TaxId: 4896]} Back     information, alignment and structure
>d2obha1 a.39.1.5 (A:26-166) Calmodulin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w7jb1 a.39.1.5 (B:11-149) Myosin Essential Chain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1m45a_ a.39.1.5 (A:) Myosin Light Chain Mlc1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1wlza1 a.39.1.7 (A:229-311) DJ-1-binding protein, DJBP {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1s6ia_ a.39.1.5 (A:) Calcium-dependent protein kinase sk5 CLD {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d1wdcb_ a.39.1.5 (B:) Myosin Essential Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1avsa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wdcc_ a.39.1.5 (C:) Myosin Regulatory Chain {Bay scallop (Aequipecten irradians) [TaxId: 31199]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1hqva_ a.39.1.8 (A:) Apoptosis-linked protein alg-2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2pq3a1 a.39.1.5 (A:3-75) Calmodulin {Rattus norvegicus [TaxId: 10116]} Back     information, alignment and structure
>d1qv0a_ a.39.1.5 (A:) Calcium-regulated photoprotein {Hydrozoa (Obelia longissima), obelin [TaxId: 32570]} Back     information, alignment and structure
>d1c07a_ a.39.1.6 (A:) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1ij5a_ a.39.1.9 (A:) Cbp40 (plasmodial specific CaII-binding protein LAV1-2) {Physarum polycephalum [TaxId: 5791]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1c7va_ a.39.1.5 (A:) Calcium vector protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1qjta_ a.39.1.6 (A:) Eps15 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1jfja_ a.39.1.5 (A:) EHCABP {Entamoeba (Entamoeba histolytica) [TaxId: 5759]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1dtla_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1wrka1 a.39.1.5 (A:4-85) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2scpa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Sandworm (Nereis diversicolor) [TaxId: 126592]} Back     information, alignment and structure
>d1tiza_ a.39.1.5 (A:) Calmodulin-related protein T21P5.17 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2sasa_ a.39.1.5 (A:) Sarcoplasmic calcium-binding protein {Amphioxus (Branchiostoma lanceolatum) [TaxId: 7740]} Back     information, alignment and structure
>d1nyaa_ a.39.1.5 (A:) Calerythrin {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1rwya_ a.39.1.4 (A:) Parvalbumin {Rat (Rattus rattus) [TaxId: 10117]} Back     information, alignment and structure
>d1juoa_ a.39.1.8 (A:) Sorcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uhka1 a.39.1.5 (A:3-189) Calcium-regulated photoprotein {Jellyfish (Aequorea aequorea), aequorin [TaxId: 168712]} Back     information, alignment and structure
>d1exra_ a.39.1.5 (A:) Calmodulin {Ciliate (Paramecium tetraurelia) [TaxId: 5888]} Back     information, alignment and structure
>d2hf5a1 a.39.1.5 (A:81-113) Troponin C {Human (Homo sapiens), cardiac isoform [TaxId: 9606]} Back     information, alignment and structure
>d2jxca1 a.39.1.6 (A:121-215) Eps15 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1y1xa_ a.39.1.8 (A:) Programmed cell death 6 protein-like protein {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d2opoa1 a.39.1.10 (A:6-86) Polcalcin Che a 3 {Pigweed (Chenopodium album) [TaxId: 3559]} Back     information, alignment and structure
>d1rroa_ a.39.1.4 (A:) Oncomodulin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1fi6a_ a.39.1.6 (A:) Reps1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1iq3a_ a.39.1.6 (A:) Pob1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1topa_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1jbaa_ a.39.1.5 (A:) Guanylate cyclase activating protein 2, GCAP-2 {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2pvba_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fi5a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus), cardiac isoform [TaxId: 9031]} Back     information, alignment and structure
>d1oqpa_ a.39.1.5 (A:) Caltractin (centrin 2) {Green algae (Chlamydomonas reinhardtii) [TaxId: 3055]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1e8aa_ a.39.1.2 (A:) Calcyclin (S100) {Human (Homo sapiens), calgranulin C, s100a12 [TaxId: 9606]} Back     information, alignment and structure
>d1pvaa_ a.39.1.4 (A:) Parvalbumin {Pike (Esox lucius) [TaxId: 8010]} Back     information, alignment and structure
>d1k94a_ a.39.1.8 (A:) Grancalcin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1omra_ a.39.1.5 (A:) Recoverin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fpwa_ a.39.1.5 (A:) Frequenin (neuronal calcium sensor 1) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1jc2a_ a.39.1.5 (A:) Troponin C {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d1snla_ a.39.1.7 (A:) Nucleobindin 1 (CALNUC) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1f54a_ a.39.1.5 (A:) Calmodulin {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1auib_ a.39.1.5 (B:) Calcineurin regulatory subunit (B-chain) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1df0a1 a.39.1.8 (A:515-700) Calpain large subunit, C-terminal domain (domain IV) {Rat (Rattus norvegicus), M-type [TaxId: 10116]} Back     information, alignment and structure
>d2mysb_ a.39.1.5 (B:) Myosin Essential Chain {Chicken (Gallus gallus) [TaxId: 9031]} Back     information, alignment and structure
>d2zkmx1 a.39.1.7 (X:142-311) Phospholipase C-beta-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fcea1 a.39.1.5 (A:84-144) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1fw4a_ a.39.1.5 (A:) Calmodulin {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d2zfda1 a.39.1.5 (A:32-214) Calcineurin B-like protein 2 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d5pala_ a.39.1.4 (A:) Parvalbumin {Leopard shark (Triakis semifasciata) [TaxId: 30493]} Back     information, alignment and structure