Citrus Sinensis ID: 042109

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60-
SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL
ccccccEEEccccccHHHHHHHHcccccccccccccccEEEEEEEccccccccccEEEEEc
***GFLVCDVAEAV****************FTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.probableQ9SR70

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3OE2, chain A
Confidence level:confident
Coverage over the Query: 18-61
View the alignment between query and template
View the model in PyMOL