Citrus Sinensis ID: 042109


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60-
SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL
ccccccEEEccccccHHHHHHHHcccccccccccccccEEEEEEEccccccccccEEEEEc
ccEEEEEEcccccccHHHHHHHHccccHHEEEEcccccEEEEEEEccccEEEcccEEEEEc
SATGFLVCDVAEAVSTSRRALRaskipesefttlpnglkyydvkvgggpvakkgsrvavrl
satgflvcdvaeavstsrralraskipesefttlpnglkyydvkvgggpvakkgsrvavrl
SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDvkvgggpvakkgSRVAVRL
****FLVCDVAEAV****************FTTLPNGLKYYDVKVGG**************
***G**************************FTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL
SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVA**********
*ATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiii
SSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query61 2.2.26 [Sep-21-2011]
Q9SR70230 Peptidyl-prolyl cis-trans yes no 0.983 0.260 0.75 1e-17
Q9LM71 232 Peptidyl-prolyl cis-trans no no 0.934 0.245 0.389 9e-05
>sp|Q9SR70|FK164_ARATH Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic OS=Arabidopsis thaliana GN=FKBP16-4 PE=1 SV=1 Back     alignment and function desciption
 Score = 88.6 bits (218), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%)

Query: 1   SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVR 60
           +A+G L    AEAVSTSRRALRASK+PES+FTTLPNGLKYYD+KVG G  A KGSRVAV 
Sbjct: 70  TASGILSTGSAEAVSTSRRALRASKLPESDFTTLPNGLKYYDIKVGNGAEAVKGSRVAVH 129




PPIases accelerate the folding of proteins. It catalyzes the cis-trans isomerization of proline imidic peptide bonds in oligopeptides.
Arabidopsis thaliana (taxid: 3702)
EC: 5EC: .EC: 2EC: .EC: 1EC: .EC: 8
>sp|Q9LM71|FKB18_ARATH Peptidyl-prolyl cis-trans isomerase FKBP18, chloroplastic OS=Arabidopsis thaliana GN=FKBP18 PE=1 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query61
224138798 237 predicted protein [Populus trichocarpa] 0.983 0.253 0.816 4e-19
449440175 231 PREDICTED: peptidyl-prolyl cis-trans iso 0.983 0.259 0.816 7e-19
297829538 230 hypothetical protein ARALYDRAFT_897182 [ 0.983 0.260 0.8 5e-18
225441076 233 PREDICTED: probable FKBP-type peptidyl-p 0.983 0.257 0.766 2e-17
351722879 237 uncharacterized protein LOC100305843 [Gl 0.983 0.253 0.716 1e-16
357440275 237 FK506-binding protein [Medicago truncatu 0.934 0.240 0.754 3e-16
388491196 229 unknown [Lotus japonicus] 0.983 0.262 0.733 3e-16
15232828 230 FKBP-like peptidyl-prolyl cis-trans isom 0.983 0.260 0.75 5e-16
356548345 233 PREDICTED: LOW QUALITY PROTEIN: probable 0.983 0.257 0.7 6e-16
147828025 1303 hypothetical protein VITISV_022322 [Viti 0.967 0.045 0.696 2e-15
>gi|224138798|ref|XP_002322904.1| predicted protein [Populus trichocarpa] gi|222867534|gb|EEF04665.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score = 98.6 bits (244), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 49/60 (81%), Positives = 52/60 (86%)

Query: 1   SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVR 60
           +A G  VCDVAEA STSRRALRASKIPES+FTTL NGLKYYD+KVGGGP A KGSRVAV 
Sbjct: 77  TAVGIYVCDVAEAASTSRRALRASKIPESDFTTLSNGLKYYDLKVGGGPKAVKGSRVAVH 136




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|449440175|ref|XP_004137860.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic-like [Cucumis sativus] gi|449501004|ref|XP_004161251.1| PREDICTED: peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|297829538|ref|XP_002882651.1| hypothetical protein ARALYDRAFT_897182 [Arabidopsis lyrata subsp. lyrata] gi|297328491|gb|EFH58910.1| hypothetical protein ARALYDRAFT_897182 [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|225441076|ref|XP_002264435.1| PREDICTED: probable FKBP-type peptidyl-prolyl cis-trans isomerase 1, chloroplastic isoform 1 [Vitis vinifera] gi|297740022|emb|CBI30204.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|351722879|ref|NP_001237515.1| uncharacterized protein LOC100305843 [Glycine max] gi|255626751|gb|ACU13720.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|357440275|ref|XP_003590415.1| FK506-binding protein [Medicago truncatula] gi|355479463|gb|AES60666.1| FK506-binding protein [Medicago truncatula] gi|388512787|gb|AFK44455.1| unknown [Medicago truncatula] Back     alignment and taxonomy information
>gi|388491196|gb|AFK33664.1| unknown [Lotus japonicus] Back     alignment and taxonomy information
>gi|15232828|ref|NP_187617.1| FKBP-like peptidyl-prolyl cis-trans isomerase-like protein [Arabidopsis thaliana] gi|75207316|sp|Q9SR70.1|FK164_ARATH RecName: Full=Peptidyl-prolyl cis-trans isomerase FKBP16-4, chloroplastic; Short=PPIase FKBP16-4; AltName: Full=FK506-binding protein 16-4; Short=AtFKBP16-4; AltName: Full=Immunophilin FKBP16-4; AltName: Full=Rotamase; Flags: Precursor gi|6143884|gb|AAF04431.1|AC010927_24 unknown protein [Arabidopsis thaliana] gi|20453145|gb|AAM19814.1| AT3g10060/T22K18_11 [Arabidopsis thaliana] gi|21689613|gb|AAM67428.1| AT3g10060/T22K18_11 [Arabidopsis thaliana] gi|332641334|gb|AEE74855.1| FKBP-like peptidyl-prolyl cis-trans isomerase-like protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|356548345|ref|XP_003542563.1| PREDICTED: LOW QUALITY PROTEIN: probable FKBP-type peptidyl-prolyl cis-trans isomerase 1, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|147828025|emb|CAN72920.1| hypothetical protein VITISV_022322 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query61
TAIR|locus:2100063230 AT3G10060 "AT3G10060" [Arabido 0.967 0.256 0.644 2.1e-13
TAIR|locus:2100063 AT3G10060 "AT3G10060" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 175 (66.7 bits), Expect = 2.1e-13, P = 2.1e-13
 Identities = 38/59 (64%), Positives = 42/59 (71%)

Query:     1 SATGFLVCDVAEAVSTSRRALRASKIPESEFTTLPNGLKYYDXXXXXXXXXXXXSRVAV 59
             +A+G L    AEAVSTSRRALRASK+PES+FTTLPNGLKYYD            SRVAV
Sbjct:    70 TASGILSTGSAEAVSTSRRALRASKLPESDFTTLPNGLKYYDIKVGNGAEAVKGSRVAV 128


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.318   0.129   0.355    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       61        49   0.00091  102 3  10 22  0.48    26
                                                     29  0.38    26


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  477 (51 KB)
  Total size of DFA:  83 KB (2065 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  8.10u 0.08s 8.18t   Elapsed:  00:00:01
  Total cpu time:  8.10u 0.08s 8.18t   Elapsed:  00:00:01
  Start:  Thu May  9 16:26:14 2013   End:  Thu May  9 16:26:15 2013


GO:0000413 "protein peptidyl-prolyl isomerization" evidence=IBA
GO:0003755 "peptidyl-prolyl cis-trans isomerase activity" evidence=ISS;IBA
GO:0005528 "FK506 binding" evidence=ISS;IBA
GO:0005634 "nucleus" evidence=ISM
GO:0006457 "protein folding" evidence=IEA
GO:0018208 "peptidyl-proline modification" evidence=IBA
GO:0009543 "chloroplast thylakoid lumen" evidence=ISS;IDA
GO:0009579 "thylakoid" evidence=IDA
GO:0009535 "chloroplast thylakoid membrane" evidence=IDA
GO:0009507 "chloroplast" evidence=IDA
GO:0009534 "chloroplast thylakoid" evidence=IDA
GO:0042631 "cellular response to water deprivation" evidence=RCA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q9SR70FK164_ARATH5, ., 2, ., 1, ., 80.750.98360.2608yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Your Input:
estExt_fgenesh4_pg.C_LG_XVI0861
hypothetical protein (237 aa)
(Populus trichocarpa)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query61
COG0545205 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans 2e-05
>gnl|CDD|223619 COG0545, FkpA, FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
 Score = 38.9 bits (91), Expect = 2e-05
 Identities = 14/29 (48%), Positives = 17/29 (58%)

Query: 32  TTLPNGLKYYDVKVGGGPVAKKGSRVAVR 60
            TLP+GL+Y  +K G G   KKG  V V 
Sbjct: 97  KTLPSGLQYKVLKAGDGAAPKKGDTVTVH 125


Length = 205

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 61
COG0545205 FkpA FKBP-type peptidyl-prolyl cis-trans isomerase 99.12
PRK11570206 peptidyl-prolyl cis-trans isomerase; Provisional 99.06
PRK10902269 FKBP-type peptidyl-prolyl cis-trans isomerase; Pro 98.95
KOG0552226 consensus FKBP-type peptidyl-prolyl cis-trans isom 98.48
TIGR03516177 ppisom_GldI peptidyl-prolyl isomerase, gliding mot 98.05
PF01346124 FKBP_N: Domain amino terminal to FKBP-type peptidy 97.54
KOG0544108 consensus FKBP-type peptidyl-prolyl cis-trans isom 96.72
>COG0545 FkpA FKBP-type peptidyl-prolyl cis-trans isomerases 1 [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
Probab=99.12  E-value=8.8e-11  Score=82.64  Aligned_cols=50  Identities=34%  Similarity=0.527  Sum_probs=45.4

Q ss_pred             hhhcccHHHHhhCCCCCCCcccCCCCCeEEEeEcccCCCcCCCCeEEEeC
Q 042109           12 EAVSTSRRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL   61 (61)
Q Consensus        12 ~~~~~~~~a~~~~~~~~~~~v~~pSGLqy~dl~~G~G~~p~~G~tV~VhY   61 (61)
                      ++...-..+|+++|.++.++.++||||||++++.|+|+.|++|++|.|||
T Consensus        77 ~~~~~~~~~f~~~~~k~~~v~~~~sgl~y~~~~~G~G~~~~~~~~V~vhY  126 (205)
T COG0545          77 AANAAEGKAFLEKNAKEKGVKTLPSGLQYKVLKAGDGAAPKKGDTVTVHY  126 (205)
T ss_pred             HHhHHhHHHHHhhhcccCCceECCCCcEEEEEeccCCCCCCCCCEEEEEE
Confidence            33444566899999999999999999999999999999999999999999



>PRK11570 peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>PRK10902 FKBP-type peptidyl-prolyl cis-trans isomerase; Provisional Back     alignment and domain information
>KOG0552 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR03516 ppisom_GldI peptidyl-prolyl isomerase, gliding motility-associated Back     alignment and domain information
>PF01346 FKBP_N: Domain amino terminal to FKBP-type peptidyl-prolyl isomerase; InterPro: IPR000774 Peptidyl-prolyl cis-trans isomerase (PPIase) catalyses the cis-trans isomerisation of proline imidic peptide bonds in oligopeptides [, ] Back     alignment and domain information
>KOG0544 consensus FKBP-type peptidyl-prolyl cis-trans isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query61
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 1e-06
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 9e-06
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 5e-05
2f4e_A 180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 1e-04
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 1e-04
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 8e-04
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Length = 129 Back     alignment and structure
 Score = 41.2 bits (97), Expect = 1e-06
 Identities = 13/31 (41%), Positives = 17/31 (54%)

Query: 29 SEFTTLPNGLKYYDVKVGGGPVAKKGSRVAV 59
           EF+  P+GL + D  VG GP A KG  +  
Sbjct: 5  CEFSVSPSGLAFCDKVVGYGPEAVKGQLIKA 35


>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 1euv_B 3v60_A 3v61_A 3v62_A* Length = 209 Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Length = 133 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Length = 180 Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Length = 134 Back     alignment and structure
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} Length = 219 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query61
3oe2_A219 Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, 98.95
1jvw_A 167 Macrophage infectivity potentiator; chagas disease 98.93
1fd9_A213 Protein (macrophage infectivity potentiator prote; 98.92
2jwx_A157 FKBP38NTD, FK506-binding protein 8 variant; apopto 98.82
1q6h_A224 FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; 98.76
1u79_A129 FKBP-type peptidyl-prolyl CIS-trans isomerase 3; T 98.64
2y78_A133 Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, 98.51
1yat_A113 FK506 binding protein; HET: FK5; 2.50A {Saccharomy 98.34
2f4e_A 180 ATFKBP42; FKBP-like, alpha-beta, signaling protein 98.32
3kz7_A119 FK506-binding protein 3; FKPB ppiase rapamycin, is 98.32
2vn1_A129 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR 98.31
4dip_A125 Peptidyl-prolyl CIS-trans isomerase FKBP14; struct 98.28
2d9f_A135 FK506-binding protein 8 variant; FKBP, rapamycin, 98.28
2lgo_A130 FKBP; infectious disease, isomerase, giardiasis, s 98.27
2awg_A118 38 kDa FK-506 binding protein; FKBP-type, ppiase, 98.26
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 98.18
3b7x_A134 FK506-binding protein 6; isomerase, repeat, rotama 98.16
2lkn_A 165 AH receptor-interacting protein; FKBP-type domain, 98.08
1r9h_A135 FKB-6, FK506 binding protein family; structural ge 97.96
2ppn_A107 FK506-binding protein 1A; high resolution protein 97.95
2if4_A 338 ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, 97.94
3o5q_A128 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 97.75
1q1c_A 280 FK506-binding protein 4; rotamase, TPR repeat, nuc 97.62
3jxv_A 356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 97.61
3o5e_A144 Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 97.6
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 97.47
1p5q_A 336 FKBP52, FK506-binding protein 4; isomerase; 2.80A 97.31
1q1c_A280 FK506-binding protein 4; rotamase, TPR repeat, nuc 96.24
3jxv_A356 70 kDa peptidyl-prolyl isomerase; FKBP- binding do 96.14
1kt0_A 457 FKBP51, 51 kDa FK506-binding protein; FKBP-like pp 90.04
>3oe2_A Peptidyl-prolyl CIS-trans isomerase; FKBP, ppiase, FK506; HET: TAR SRT; 1.60A {Pseudomonas syringae PV} SCOP: d.26.1.0 Back     alignment and structure
Probab=98.95  E-value=2.3e-10  Score=78.73  Aligned_cols=44  Identities=25%  Similarity=0.448  Sum_probs=42.5

Q ss_pred             HHHHhhCCCCCCCcccCCCCCeEEEeEcccCCCcCCCCeEEEeC
Q 042109           18 RRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL   61 (61)
Q Consensus        18 ~~a~~~~~~~~~~~v~~pSGLqy~dl~~G~G~~p~~G~tV~VhY   61 (61)
                      -.+|+++|..+++++++||||+|++|++|+|+.|..||+|.|||
T Consensus        99 ~~~fl~~n~~~~gv~~~~sGl~y~vl~~G~G~~p~~gd~V~V~Y  142 (219)
T 3oe2_A           99 ERTFMAGEKAKPGVKELADGILMTELTPGTGPKPDANGRVEVRY  142 (219)
T ss_dssp             HHHHHHHHHTSTTCEECGGGCEEEEEECCCSCCCCTTSEEEEEE
T ss_pred             HHHHHHHhccCCCcEECCCCeEEEEEecCCCccCCCCCEEEEEE
Confidence            47899999999999999999999999999999999999999998



>1jvw_A Macrophage infectivity potentiator; chagas disease, X-RAY rotamase, isomeras; 1.70A {Trypanosoma cruzi} SCOP: d.26.1.1 Back     alignment and structure
>1fd9_A Protein (macrophage infectivity potentiator prote; FKBP domain, long alpha helix, dimerisation VIA helical INTE isomerase; 2.41A {Legionella pneumophila} SCOP: d.26.1.1 PDB: 2uz5_A 2vcd_A* Back     alignment and structure
>2jwx_A FKBP38NTD, FK506-binding protein 8 variant; apoptosis, beta barrel, central helix, with flexible N-terminal extension, isomerase; NMR {Homo sapiens} Back     alignment and structure
>1q6h_A FKBP-type peptidyl-prolyl CIS-trans isomerase FKP; chaperone, peptidyl-prolyl isomerase, heat shock protein, FK family; HET: MSE; 1.97A {Escherichia coli} SCOP: d.26.1.1 PDB: 1q6i_A* 1q6u_A Back     alignment and structure
>1u79_A FKBP-type peptidyl-prolyl CIS-trans isomerase 3; TFKBP13, FK-506 binding protein; 1.85A {Arabidopsis thaliana} SCOP: d.26.1.1 PDB: 1y0o_A Back     alignment and structure
>2y78_A Peptidyl-prolyl CIS-trans isomerase; MIP, ppiase, virulence; HET: SO4 GOL; 0.91A {Burkholderia pseudomallei} PDB: 2ke0_A 2ko7_A* 2l2s_A* 4dz2_A* 4dz3_A* Back     alignment and structure
>1yat_A FK506 binding protein; HET: FK5; 2.50A {Saccharomyces cerevisiae} SCOP: d.26.1.1 Back     alignment and structure
>2f4e_A ATFKBP42; FKBP-like, alpha-beta, signaling protein; 2.32A {Arabidopsis thaliana} Back     alignment and structure
>3kz7_A FK506-binding protein 3; FKPB ppiase rapamycin, isomerase, nucleus, phosphoprotein, R isomerase-inhibitor complex; HET: RAP; 1.95A {Mus musculus} SCOP: d.26.1.1 PDB: 1pbk_A* Back     alignment and structure
>2vn1_A 70 kDa peptidylprolyl isomerase; FKBP, FK506, TPR repeat; HET: FK5; 2.35A {Plasmodium falciparum} PDB: 2ofn_A 2ki3_A 3ihz_A* 3ni6_A 3pa7_A Back     alignment and structure
>4dip_A Peptidyl-prolyl CIS-trans isomerase FKBP14; structural genomics, structural genomics consortium, SGC, PE prolyl CIS-trans isomerase; 1.82A {Homo sapiens} Back     alignment and structure
>2d9f_A FK506-binding protein 8 variant; FKBP, rapamycin, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2lgo_A FKBP; infectious disease, isomerase, giardiasis, ssgcid, structura genomics, seattle structural genomics center for infectious; NMR {Giardia lamblia} Back     alignment and structure
>2awg_A 38 kDa FK-506 binding protein; FKBP-type, ppiase, BCL-2 inhibitor, SHH signalling antagonist, structural genomics consortium, SGC; 1.60A {Homo sapiens} PDB: 2f2d_A 3ey6_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3b7x_A FK506-binding protein 6; isomerase, repeat, rotamase, TPR repeat, williams-beuren syndrome, structural genomics consortium, SGC; 2.10A {Homo sapiens} Back     alignment and structure
>2lkn_A AH receptor-interacting protein; FKBP-type domain, immunophilin homolog, protein binding; NMR {Homo sapiens} Back     alignment and structure
>1r9h_A FKB-6, FK506 binding protein family; structural genomics, peptidylprolyl isomerase, PSI, protein structure initiative; 1.80A {Caenorhabditis elegans} SCOP: d.26.1.1 Back     alignment and structure
>2ppn_A FK506-binding protein 1A; high resolution protein structure, isomerase; 0.92A {Homo sapiens} SCOP: d.26.1.1 PDB: 1b6c_A 1a7x_A 1d7h_A 1d7i_A 1d7j_A* 1f40_A* 1fap_A* 1d6o_A* 1fkd_A* 1fkf_A* 1fkg_A* 1fkh_A* 1fki_A* 1fkj_A* 1fkr_A 1fks_A 1fkt_A 1j4h_A* 1j4i_A* 1j4r_A* ... Back     alignment and structure
>2if4_A ATFKBP42; FKBP-like, alpha-beta, TPR-like, alpha, signaling protein; 2.85A {Arabidopsis thaliana} Back     alignment and structure
>3o5q_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 0.96A {Homo sapiens} PDB: 3o5m_A 3o5l_A 3o5o_A 3o5p_A 3o5r_A* 4drk_A* 4drm_A* 4drn_A* 4dro_A* 4drp_A* 4drq_A* 3o5j_A 3o5g_A 3o5i_A 3o5k_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>3o5e_A Peptidyl-prolyl CIS-trans isomerase FKBP5; FK-506 binding domain, HSP90 cochaperone, immunophiline, PEP prolyl isomerase; 1.60A {Homo sapiens} PDB: 3o5f_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure
>1p5q_A FKBP52, FK506-binding protein 4; isomerase; 2.80A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 PDB: 1qz2_A Back     alignment and structure
>1q1c_A FK506-binding protein 4; rotamase, TPR repeat, nuclear protein, phosphorylation, isomerase; 1.90A {Homo sapiens} SCOP: d.26.1.1 d.26.1.1 PDB: 1n1a_A 1rot_A 1rou_A Back     alignment and structure
>3jxv_A 70 kDa peptidyl-prolyl isomerase; FKBP- binding domain five-stranded anti-parallel beta-sheet alpha-helix crossing THis sheet; 2.08A {Triticum aestivum} PDB: 3jym_A Back     alignment and structure
>1kt0_A FKBP51, 51 kDa FK506-binding protein; FKBP-like ppiase, TPR repeats, isomerase; 2.70A {Homo sapiens} SCOP: a.118.8.1 d.26.1.1 d.26.1.1 PDB: 1kt1_A 3o5d_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 61
d1u79a_125 d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis tha 9e-07
d1ppja1 232 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 4e-04
d1hr6b1 222 d.185.1.1 (B:24-245) Mitochondrial processing pept 4e-04
d3cx5a1 213 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 7e-04
d1yata_113 d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeas 0.003
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 125 Back     information, alignment and structure

class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: FKBP13
species: Thale cress (Arabidopsis thaliana) [TaxId: 3702]
 Score = 40.2 bits (93), Expect = 9e-07
 Identities = 13/26 (50%), Positives = 16/26 (61%)

Query: 30 EFTTLPNGLKYYDVKVGGGPVAKKGS 55
          EF+  P+GL + D  VG GP A KG 
Sbjct: 2  EFSVSPSGLAFCDKVVGYGPEAVKGQ 27


>d1ppja1 d.185.1.1 (A:2-233) Cytochrome bc1 core subunit 1 {Cow (Bos taurus) [TaxId: 9913]} Length = 232 Back     information, alignment and structure
>d1hr6b1 d.185.1.1 (B:24-245) Mitochondrial processing peptidase (MPP) beta chain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 222 Back     information, alignment and structure
>d3cx5a1 d.185.1.1 (A:27-239) Cytochrome bc1 core subunit 1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 213 Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 113 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query61
d1fd9a_204 Macrophage infectivity potentiator protein (MIP) { 99.1
d1q6ha_210 Peptidyl-prolyl cis-trans isomerase FkpA {Escheric 99.06
d1u79a_125 FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 99.03
d1jvwa_160 Macrophage infectivity potentiator protein (MIP) { 98.94
d1yata_113 Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyc 98.22
d2ppna1107 FK-506 binding protein (FKBP12), an immunophilin { 98.0
d1kt1a3115 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 97.92
d1kt1a2111 FKBP51, N-terminal domains {Monkey (Saimiri bolivi 97.85
d1q1ca2117 FKBP52, N-terminal domains {Human (Homo sapiens) [ 97.85
d1r9ha_118 FKB-6, N-terminal domain {Caenorhabditis elegans [ 97.82
d1q1ca1120 FKBP52, N-terminal domains {Human (Homo sapiens) [ 97.76
d1pbka_116 FKBP25 {Human (Homo sapiens) [TaxId: 9606]} 97.06
>d1fd9a_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Legionella pneumophila [TaxId: 446]} Back     information, alignment and structure
class: Alpha and beta proteins (a+b)
fold: FKBP-like
superfamily: FKBP-like
family: FKBP immunophilin/proline isomerase
domain: Macrophage infectivity potentiator protein (MIP)
species: Legionella pneumophila [TaxId: 446]
Probab=99.10  E-value=1.4e-11  Score=80.67  Aligned_cols=44  Identities=25%  Similarity=0.398  Sum_probs=41.6

Q ss_pred             HHHHhhCCCCCCCcccCCCCCeEEEeEcccCCCcCCCCeEEEeC
Q 042109           18 RRALRASKIPESEFTTLPNGLKYYDVKVGGGPVAKKGSRVAVRL   61 (61)
Q Consensus        18 ~~a~~~~~~~~~~~v~~pSGLqy~dl~~G~G~~p~~G~tV~VhY   61 (61)
                      ..+|++++...++++++||||+|++++.|+|+.|.+||+|.|||
T Consensus        80 ~~~fl~~~~~~~~v~~~~sGl~y~v~~~G~G~~p~~~d~v~v~y  123 (204)
T d1fd9a_          80 GEAFLTENKNKPGVVVLPSGLQYKVINSGNGVKPGKSDTVTVEY  123 (204)
T ss_dssp             HHHHHHHHHHSTTEEECTTSCEEEEEECCCSCCCCTTCEEEEEE
T ss_pred             HHHHHHhcccCCceEEecCccEEEEeecCCCcccCCCCEEEEEE
Confidence            45799999989999999999999999999999999999999998



>d1q6ha_ d.26.1.1 (A:) Peptidyl-prolyl cis-trans isomerase FkpA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u79a_ d.26.1.1 (A:) FKBP13 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1jvwa_ d.26.1.1 (A:) Macrophage infectivity potentiator protein (MIP) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1yata_ d.26.1.1 (A:) Calcineurin (FKBP12.6) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2ppna1 d.26.1.1 (A:1-107) FK-506 binding protein (FKBP12), an immunophilin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kt1a3 d.26.1.1 (A:139-253) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1kt1a2 d.26.1.1 (A:28-138) FKBP51, N-terminal domains {Monkey (Saimiri boliviensis) [TaxId: 27679]} Back     information, alignment and structure
>d1q1ca2 d.26.1.1 (A:141-257) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1r9ha_ d.26.1.1 (A:) FKB-6, N-terminal domain {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1q1ca1 d.26.1.1 (A:21-140) FKBP52, N-terminal domains {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1pbka_ d.26.1.1 (A:) FKBP25 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure