Citrus Sinensis ID: 042110


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
MVGMAASEKSGVALVAQEKFSEPREVEKLVIAPVKKELALEAMNEKEALGMKATLESKGEVEFYVRKLGKNVCIKKNMLLISKEKKKEFQRVFTPSVIEPSSGIDRIIYCLCEHCFYRRPSKAGDEQLNVFRFPPLVAPIKCTVFTLVQNQQYEEVAKVISESLSVAGISHKIDITGASIGKRYARTDELGVPCAITVDSTSSVTIRERDSKDQMRVHVDDVASIVKALTDGQRTWEDVWANSPFPIPNPPNLLRNEMSNGGENFNLWGTVWAASPHSHPYILSLRM
cccccccccccccEEEEEEccccEEEEEEEEEEcHHHHHHHcccHHHHHHHHHHHHccccEEEEEEEcccEEEEccccEEEEEEEEccccEEEEEEEECccccHHHHHHHHHHHHcCECcccccccCEEEEEcccccccEEEEEEEEEccccHHHHHHHHHHHHHHccccEEECcccccccHHHcccccccccEEEEEccccEEEEECccccccEEEEHHHHHHHHHHHHcccccHHHHHHccccccccccccccccccccccccEEEEEEECccccccccEEEccc
**********GVALVAQEKFSEPREVEKLVIAPVKKELALEAMNEKEALGM**TLESKGEVEFYVRKLGKNVCIKKNMLLISKEKKKEFQRVFTPSVIEPSSGIDRIIYCLCEHCFYRRPSKAGDEQLNVFRFPPLVAPIKCTVFTLVQNQQYEEVAKVISESLSVAGISHKIDITGASIGKRYARTDELGVPCAITVDSTSSVTIRERDSKDQMRVHVDDVASIVKALTDGQRTWEDVWANSPFPI**************GENFNLWGTVWAASPHSHPYILSLRM
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MVGMAASEKSGVALVAQEKFSEPREVEKLVIAPVKKELALEAMNEKEALGMKATLESKGEVEFYVRKLGKNVCIKKNMLLISKEKKKEFQRVFTPSVIEPSSGIDRIIYCLCEHCFYRRPSKAGDEQLNVFRFPPLVAPIKCTVFTLVQNQQYEEVAKVISESLSVAGISHKIDITGASIGKRYARTDELGVPCAITVDSTSSVTIRERDSKDQMRVHVDDVASIVKALTDGQRTWEDVWANSPFPIPNPPNLLRNEMSNGGENFNLWGTVWAASPHSHPYILSLRM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Glycine--tRNA ligase 1, mitochondrial Catalyzes the attachment of glycine to tRNA(Gly). Is also able produce diadenosine tetraphosphate (Ap4A), a universal pleiotropic signaling molecule needed for cell regulation pathways, by direct condensation of 2 ATPs.probableO23627

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2ZT5, chain A
Confidence level:very confident
Coverage over the Query: 89-247
View the alignment between query and template
View the model in PyMOL