Citrus Sinensis ID: 042128


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-
MESAHAIDMPESKKANGSGKGKAAVGAPAAAVATTKATPHPRGGWKKGVAIFDFVLRLAAIGAALGATATMGTADEILPFFTQFFQFEAQYDDFEVFMFFVIANGLVSAYLVLSLPFSILCIVRPHAVGPRLLLLIGDTVMMALTIGAAAAAASVVYLAHSGNPNANWLPICQQFGDFCQSTSSAVVASLIAAALLLILIVLSAFALRRRT
ccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEEEEEcccHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcc
*******************************************GWKKGVAIFDFVLRLAAIGAALGATATMGTADEILPFFTQFFQFEAQYDDFEVFMFFVIANGLVSAYLVLSLPFSILCIVRPHAVGPRLLLLIGDTVMMALTIGAAAAAASVVYLAHSGNPNANWLPICQQFGDFCQSTSSAVVASLIAAALLLILIVLSAFALRR**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHHHHxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MESAHAIDMPESKKANGSGKGKAAVGAPAAAVATTKATPHPRGGWKKGVAIFDFVLRLAAIGAALGATATMGTADEILPFFTQFFQFEAQYDDFEVFMFFVIANGLVSAYLVLSLPFSILCIVRPHAVGPRLLLLIGDTVMMALTIGAAAAAASVVYLAHSGNPNANWLPICQQFGDFCQSTSSAVVASLIAAALLLILIVLSAFALRRRT

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Casparian strip membrane protein POPTRDRAFT_767048 Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.probableB9HQ42
Casparian strip membrane protein 3 Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.probableQ9ZQI2
Casparian strip membrane protein VIT_06s0080g00840 Regulates membrane-cell wall junctions and localized cell wall deposition. Required for establishment of the Casparian strip membrane domain (CSD) and the subsequent formation of Casparian strips, a cell wall modification of the root endodermis that determines an apoplastic barrier between the intraorganismal apoplasm and the extraorganismal apoplasm and prevents lateral diffusion.probableA7QF77

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

No confident structure templates for the query are predicted