Citrus Sinensis ID: 042179

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-----
MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPDSLKSRKLINSSSCTSANNDNDFWMLLEYRFFSIHSLSCV
cEEEEEEEEEEEcccccccccEEEEEEccccccccccccccccccccccccccccEEEEEEEccccccccccccEEEEccccccccEEEccccccEEEccccEEEEEEEEEccccEEEEEEEEccccccEEEEEEEEccccccccEEEEEccccccccccEEEEEEEEEccccccccccccccccccccccccccccHHHHHHHHHHEEEEEEcc
ccEEEEEEEEEcccccccccEEEEEEEcccccccccccccEEEEEEccccccccEEEEEEEEccccccccccccEEEEEccEEEEcccccccccccEccccccEEEEEEEccccEEEEEEEcccccccccEEEEEEccHHHccccEEEEEEccccccccEEEEEEEEEcccccccccHHHHccccccccccccccccEEEEEEEEEEEEEEcccc
MISTTFTIRisqypnsgagdgmtfifapdtnpsplhsdgsflgimsrsphvgsvSQLALELDTFmnefdpdanhigidatnmskpitvtslngtgidlksgrnikvqidydgrTKMLYVSMAyseyplgrilekpiimsdvvpssvyvgftaatgdfseshqvldwtfttmplppdslksrklinsssctsanndnDFWMLLEYRFFSIHSLSCV
MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLngtgidlksgrnikVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPDSLKSRKLINSSSCTSANNDNDFWMLLEYRFFSIHSLSCV
MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPDSLKSRKLINSSSCTSANNDNDFWMLLEYRFFSIHSLSCV
******TIRI**********GMTFIFA**************LGI******VGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMP*********************NDNDFWMLLEYRFFSIHSL***
MISTTFTIRISQYPNSGAGDGMTFIFAPDTNP****SDGSFLGIMSRSPHVGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFT*******************************LLEYRFFSIHSLSCV
MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPDSLKSRKLINSSSCTSANNDNDFWMLLEYRFFSIHSLSCV
MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPDSLKSRKLINSSSCTSANNDNDFWMLLEYRFFSIHSLSCV
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPDSLKSRKLINSSSCTSANNDNDFWMLLEYRFFSIHSLSCV
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query215 2.2.26 [Sep-21-2011]
Q01806277 Lectin 1 OS=Medicago trun N/A no 0.730 0.566 0.375 1e-19
P81371240 Seed lectin OS=Vatairea m N/A no 0.758 0.679 0.340 5e-19
Q9FG33 652 Probable L-type lectin-do yes no 0.795 0.262 0.310 9e-18
P05045275 Seed lectin subunit I OS= N/A no 0.772 0.603 0.324 1e-17
Q39527290 Lectin-related protein (F N/A no 0.734 0.544 0.345 3e-17
P93535292 Seed lectin OS=Styphnolob N/A no 0.739 0.544 0.329 3e-17
B3EWQ9281 Lectin alpha chain OS=Lab N/A no 0.851 0.651 0.303 7e-17
Q01807280 Truncated lectin 2 OS=Med N/A no 0.674 0.517 0.329 3e-16
P02871233 Favin OS=Vicia faba PE=1 SV=1 N/A no 0.725 0.669 0.352 3e-16
P05088275 Erythroagglutinating phyt N/A no 0.739 0.578 0.327 3e-16
>sp|Q01806|LEC1_MEDTR Lectin 1 OS=Medicago truncatula GN=LEC1 PE=3 SV=1 Back     alignment and function desciption
 Score = 96.7 bits (239), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 63/168 (37%), Positives = 93/168 (55%), Gaps = 11/168 (6%)

Query: 4   TTFTIRISQYPNSGAGDGMTFIFAP-DTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELD 62
           T FT  I+   +S   DG+ F  AP DT P  +   G FLG+ +   +  S+  +A+E+D
Sbjct: 96  TLFTFAITAPYSSNVADGLAFFIAPVDTQPQNIGRAG-FLGVFNSETYNKSIQTVAVEID 154

Query: 63  TFMNEFDPDAN-HIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSM 121
           TF N +DP  N HIGI+  N  K I+ TS       L++GR   V + +D  T +L V +
Sbjct: 155 TFHNTWDPKINRHIGINV-NCIKSISTTSW-----VLENGREANVLVRFDAHTNVLSVVL 208

Query: 122 AYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATG-DFSESHQVLDWTF 168
           +Y   P   IL   + + D+VP  V +GF+AATG +F+E H +  W+F
Sbjct: 209 SYPGLPDSYILSDVVPLKDIVPEWVRIGFSAATGAEFAE-HDIRYWSF 255
Lectin that may be involved in a cell recognition process.
Medicago truncatula (taxid: 3880)
>sp|P81371|LECS_VATMA Seed lectin OS=Vatairea macrocarpa PE=1 SV=1 Back     alignment and function description
>sp|Q9FG33|LRKS5_ARATH Probable L-type lectin-domain containing receptor kinase S.5 OS=Arabidopsis thaliana GN=LECRKS5 PE=2 SV=1 Back     alignment and function description
>sp|P05045|LEC1_DOLBI Seed lectin subunit I OS=Dolichos biflorus PE=1 SV=2 Back     alignment and function description
>sp|Q39527|LECR_CLAKE Lectin-related protein (Fragment) OS=Cladrastis kentukea PE=1 SV=1 Back     alignment and function description
>sp|P93535|LECS_STYJP Seed lectin OS=Styphnolobium japonicum PE=2 SV=1 Back     alignment and function description
>sp|B3EWQ9|LECA2_LABPU Lectin alpha chain OS=Lablab purpureus PE=1 SV=1 Back     alignment and function description
>sp|Q01807|LEC2_MEDTR Truncated lectin 2 OS=Medicago truncatula GN=LEC2 PE=3 SV=1 Back     alignment and function description
>sp|P02871|LEC_VICFA Favin OS=Vicia faba PE=1 SV=1 Back     alignment and function description
>sp|P05088|PHAE_PHAVU Erythroagglutinating phytohemagglutinin OS=Phaseolus vulgaris GN=DLEC1 PE=1 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
359476128 661 PREDICTED: probable L-type lectin-domain 0.832 0.270 0.611 3e-56
255548946 584 conserved hypothetical protein [Ricinus 0.804 0.296 0.563 1e-46
296082025 569 unnamed protein product [Vitis vinifera] 0.595 0.224 0.609 1e-38
11596188268 lectin-related protein precursor [Citrus 0.823 0.660 0.502 2e-34
284434504 727 putative lectin-like protein kinase [Phy 0.837 0.247 0.338 1e-19
116787627 636 unknown [Picea sitchensis] 0.762 0.257 0.371 1e-19
326497031 671 predicted protein [Hordeum vulgare subsp 0.711 0.228 0.341 3e-19
115440305 696 Os01g0779300 [Oryza sativa Japonica Grou 0.762 0.235 0.324 5e-19
224115424 678 predicted protein [Populus trichocarpa] 0.823 0.261 0.358 4e-18
84874550261 chimeric lectin [synthetic construct] 0.720 0.593 0.363 5e-18
>gi|359476128|ref|XP_002282629.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] Back     alignment and taxonomy information
 Score =  223 bits (569), Expect = 3e-56,   Method: Compositional matrix adjust.
 Identities = 110/180 (61%), Positives = 137/180 (76%), Gaps = 1/180 (0%)

Query: 1   MISTTFTIRISQYPNS-GAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLAL 59
           +I+TTFT+RIS +PNS G+GDGM FI A D+ PSP  S GSFLGI+ RS   G V QLA+
Sbjct: 89  LITTTFTVRISPFPNSTGSGDGMAFIMAQDSQPSPAGSFGSFLGILDRSTEGGVVRQLAV 148

Query: 60  ELDTFMNEFDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYV 119
           ELDT+MNEFDPDANHIGID T+++ PI   SL+GTG+DLKSGR +KV+IDYDG  + L++
Sbjct: 149 ELDTYMNEFDPDANHIGIDTTSIAIPIAAKSLSGTGVDLKSGREVKVKIDYDGWRETLHI 208

Query: 120 SMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPDSLK 179
           S+ Y+  PL   L   I +SD VPSSVYVGFT +TG  SE+HQVLDW FT++P+   S K
Sbjct: 209 SVGYAGNPLLSFLNHSIALSDTVPSSVYVGFTGSTGTVSETHQVLDWAFTSIPITCSSSK 268

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255548946|ref|XP_002515529.1| conserved hypothetical protein [Ricinus communis] gi|223545473|gb|EEF46978.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|296082025|emb|CBI21030.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|11596188|gb|AAG38522.1|AF283537_1 lectin-related protein precursor [Citrus x paradisi] Back     alignment and taxonomy information
>gi|284434504|gb|ADB85269.1| putative lectin-like protein kinase [Phyllostachys edulis] Back     alignment and taxonomy information
>gi|116787627|gb|ABK24581.1| unknown [Picea sitchensis] Back     alignment and taxonomy information
>gi|326497031|dbj|BAK02100.1| predicted protein [Hordeum vulgare subsp. vulgare] Back     alignment and taxonomy information
>gi|115440305|ref|NP_001044432.1| Os01g0779300 [Oryza sativa Japonica Group] gi|15289871|dbj|BAB63567.1| putative lectin-like receptor kinase 1;1 [Oryza sativa Japonica Group] gi|113533963|dbj|BAF06346.1| Os01g0779300 [Oryza sativa Japonica Group] gi|215768375|dbj|BAH00604.1| unnamed protein product [Oryza sativa Japonica Group] Back     alignment and taxonomy information
>gi|224115424|ref|XP_002317031.1| predicted protein [Populus trichocarpa] gi|222860096|gb|EEE97643.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|84874550|gb|ABC68272.1| chimeric lectin [synthetic construct] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query215
TAIR|locus:2170224 652 AT5G06740 [Arabidopsis thalian 0.795 0.262 0.310 4.7e-20
TAIR|locus:2162212 681 AT5G55830 [Arabidopsis thalian 0.865 0.273 0.328 3.7e-19
TAIR|locus:2020608 666 AT1G70110 [Arabidopsis thalian 0.813 0.262 0.347 8.9e-18
TAIR|locus:2138381 686 AT4G04960 [Arabidopsis thalian 0.767 0.240 0.348 9.4e-18
TAIR|locus:2143528 711 AT5G03140 [Arabidopsis thalian 0.753 0.227 0.348 1e-17
TAIR|locus:2083986 715 AT3G53380 [Arabidopsis thalian 0.753 0.226 0.343 5.7e-17
TAIR|locus:2144055 616 AT5G60310 [Arabidopsis thalian 0.758 0.264 0.371 2.5e-16
TAIR|locus:2025037258 AT1G07460 [Arabidopsis thalian 0.869 0.724 0.314 2.9e-16
TAIR|locus:2144025 657 AT5G60280 [Arabidopsis thalian 0.818 0.267 0.317 5.9e-16
TAIR|locus:2119936 669 AT4G29050 [Arabidopsis thalian 0.748 0.240 0.351 6.1e-16
TAIR|locus:2170224 AT5G06740 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 247 (92.0 bits), Expect = 4.7e-20, P = 4.7e-20
 Identities = 55/177 (31%), Positives = 101/177 (57%)

Query:     3 STTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQL-ALEL 61
             +TTF I IS   + G G+G+ F+  P+   +P +S G +LG+++   +  + S++ ++E 
Sbjct:    91 NTTFVINISNKTDPG-GEGLAFVLTPEET-APQNSSGMWLGMVNERTNRNNESRIVSVEF 148

Query:    62 DTFMNEFDP-DANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVS 120
             DT  +  D  D NH+ ++  N++  +   SL+G GI + SG ++   + YDG+   +YVS
Sbjct:   149 DTRKSHSDDLDGNHVALNVNNINS-VVQESLSGRGIKIDSGLDLTAHVRYDGKNLSVYVS 207

Query:   121 MAYSEYPLGRIL-EKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTTMPLPPD 176
                  +    ++  + I +S  +P +VYVGFTA+T +F+E + V  W+F  + +  D
Sbjct:   208 RNLDVFEQRNLVFSRAIDLSAYLPETVYVGFTASTSNFTELNCVRSWSFEGLKIDGD 264
GO:0004672 "protein kinase activity" evidence=IEA
GO:0004674 "protein serine/threonine kinase activity" evidence=IEA
GO:0005524 "ATP binding" evidence=IEA
GO:0005886 "plasma membrane" evidence=ISM
GO:0006468 "protein phosphorylation" evidence=IEA
GO:0016301 "kinase activity" evidence=ISS
GO:0016772 "transferase activity, transferring phosphorus-containing groups" evidence=IEA
GO:0030246 "carbohydrate binding" evidence=ISS
GO:0000041 "transition metal ion transport" evidence=RCA
TAIR|locus:2162212 AT5G55830 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2020608 AT1G70110 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2138381 AT4G04960 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2083986 AT3G53380 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144055 AT5G60310 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025037 AT1G07460 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2144025 AT5G60280 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2119936 AT4G29050 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00032635001
SubName- Full=Chromosome chr4 scaffold_6, whole genome shotgun sequence; (599 aa)
(Vitis vinifera)
Predicted Functional Partners:
 
Sorry, there are no predicted associations at the current settings.
 

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
cd06899236 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume 7e-47
pfam00139231 pfam00139, Lectin_legB, Legume lectin domain 2e-45
cd01951223 cd01951, lectin_L-type, legume lectins 9e-27
>gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
 Score =  154 bits (391), Expect = 7e-47
 Identities = 65/173 (37%), Positives = 100/173 (57%), Gaps = 7/173 (4%)

Query: 3   STTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQ-LALEL 61
           ST+F+  I+    S  GDG+ F  AP  +  P  S G +LG+ + S +  S +  +A+E 
Sbjct: 64  STSFSFSITPPNPSLGGDGLAFFLAPTDSLPP-ASSGGYLGLFNSSNNGNSSNHIVAVEF 122

Query: 62  DTFMNEF--DPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYV 119
           DTF N    DPD NH+GID  ++   +     +  G  LKSG+ ++  IDYD  +K L V
Sbjct: 123 DTFQNPEFGDPDDNHVGIDVNSL-VSVKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSV 181

Query: 120 SMAYSEYPLGR--ILEKPIIMSDVVPSSVYVGFTAATGDFSESHQVLDWTFTT 170
           ++AYS     +  +L  P+ +S V+P  VYVGF+A+TG  +E H +L W+F++
Sbjct: 182 TLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFSS 234

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236
>gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain Back     alignment and domain information
>gnl|CDD|173886 cd01951, lectin_L-type, legume lectins Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 215
cd06899236 lectin_legume_LecRK_Arcelin_ConA legume lectins, l 100.0
PF00139236 Lectin_legB: Legume lectin domain; InterPro: IPR00 100.0
cd01951223 lectin_L-type legume lectins. The L-type (legume-t 100.0
cd07308218 lectin_leg-like legume-like lectins: ERGIC-53, ERG 99.77
cd06902225 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran 99.59
cd06901248 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr 99.5
cd06903215 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem 99.21
PF03388229 Lectin_leg-like: Legume-like lectin family; InterP 99.16
KOG3838 497 consensus Mannose lectin ERGIC-53, involved in gly 98.62
cd06900255 lectin_VcfQ VcfQ bacterial pilus biogenesis protei 98.51
KOG3839351 consensus Lectin VIP36, involved in the transport 98.34
>cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor Back     alignment and domain information 
Probab=100.00  E-value=2.7e-45  Score=315.20  Aligned_cols=169  Identities=40%  Similarity=0.699  Sum_probs=149.4

Q ss_pred             CcEEEEEEEEeeCCCCCCCCeeEEEEccCCCCCCCCCCCccccccCCCCCC-CccceEEEEEccccc-cc-CCCCCeeEE
Q 042179            1 MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHV-GSVSQLALELDTFMN-EF-DPDANHIGI   77 (215)
Q Consensus         1 ~FsT~FtF~I~~~~~~~~gDGlAFvl~~~~~~~~~~~~G~~LGl~~~~~~g-~~~~~vAVEFDT~~N-~~-Dp~~nHVgI   77 (215)
                      +|+|+|+|+|.+.....+||||||||+|.+.. +.+..|++|||.+..+.+ ...+.|||||||++| ++ ||+.+||||
T Consensus        62 sFst~F~F~i~~~~~~~~gdGlAF~i~~~~~~-~~~~~G~~lG~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHigI  140 (236)
T cd06899          62 SFSTSFSFSITPPNPSLGGDGLAFFLAPTDSL-PPASSGGYLGLFNSSNNGNSSNHIVAVEFDTFQNPEFGDPDDNHVGI  140 (236)
T ss_pred             eEEEEEEEEEEcCCCCCCCCeEEEEEecCCCC-CCCCCcceeeeecCCCCCCcccceEEEEeecccCcccCCCCCCeEEE
Confidence            69999999999866678999999999998753 346889999999876554 234599999999999 56 999999999


Q ss_pred             ecCCCCCceeeeecCCcCcccCCCCeEEEEEEEcCCccEEEEEEEecC--CCceeeeeeeeecCCCCCCeEEEEEEeecC
Q 042179           78 DATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSE--YPLGRILEKPIIMSDVVPSSVYVGFTAATG  155 (215)
Q Consensus        78 dvns~~~S~~t~~~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~--~p~~plls~~vdL~~~l~~~v~VGFSAsTG  155 (215)
                      |+|++. |..+..+....+.|.+|+.++|||+||+.+++|+|+|+...  +|..|+|+..+||+++|+++|||||||+||
T Consensus       141 dvn~~~-S~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG  219 (236)
T cd06899         141 DVNSLV-SVKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLAYSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTG  219 (236)
T ss_pred             EcCCcc-cceeeccccccccccCCCeEEEEEEEcCCCCEEEEEEEeCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcC
Confidence            999998 88777775445568999999999999999999999999853  788999999999999999999999999999


Q ss_pred             CcccceEEEEEEEEee
Q 042179          156 DFSESHQVLDWTFTTM  171 (215)
Q Consensus       156 ~~~e~h~I~sWsF~s~  171 (215)
                      ...|.|+|++|+|++.
T Consensus       220 ~~~~~h~i~sWsF~s~  235 (236)
T cd06899         220 LLTELHYILSWSFSSN  235 (236)
T ss_pred             CCcceEEEEEEEEEcC
Confidence            9999999999999875

This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin
>PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported Back     alignment and domain information
>cd01951 lectin_L-type legume lectins Back     alignment and domain information
>cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 Back     alignment and domain information
>cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain Back     alignment and domain information
>cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain Back     alignment and domain information
>PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates Back     alignment and domain information
>KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information
>cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain Back     alignment and domain information
>KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
1bjq_A253 The Dolichos Biflorus Seed Lectin In Complex With A 5e-18
3ujo_A281 Galactose-Specific Seed Lectin From Dolichos Lablab 1e-17
1lul_A253 Db58, A Legume Lectin From Dolichos Biflorus Length 4e-17
2bqp_A234 The Structure Of The Pea Lectin-D-Glucopyranose Com 4e-17
1n47_A233 Isolectin B4 From Vicia Villosa In Complex With The 6e-17
2sba_A253 Soybean Agglutinin Complexed With 2,6-Pentasacchari 3e-16
3usu_A256 Crystal Structure Of Butea Monosperma Seed Lectin L 5e-16
3usu_B242 Crystal Structure Of Butea Monosperma Seed Lectin L 5e-16
1fat_A252 Phytohemagglutinin-L Length = 252 2e-15
1g8w_A233 Improved Structure Of Phytohemagglutinin-L From The 3e-15
2e7q_A237 Crystal Structure Of Basic Winged Bean Lectin In Co 3e-15
1wbl_A241 Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga 4e-15
1wbf_A242 Winged Bean Lectin, Saccharide Free Form Length = 2 4e-15
3n35_A242 Erythrina Corallodendron Lectin Mutant (Y106g) With 2e-14
3ipv_B239 Crystal Structure Of Spatholobus Parviflorus Seed L 2e-14
1sfy_A239 Crystal Structure Of Recombinant Erythrina Corallod 2e-14
1gz9_A239 High-Resolution Crystal Structure Of Erythrina Cris 3e-14
1lte_A239 Structure Of A Legume Lectin With An Ordered N-Link 4e-14
3ipv_A251 Crystal Structure Of Spatholobus Parviflorus Seed L 4e-14
2fmd_A240 Structural Basis Of Carbohydrate Recognition By Bow 5e-14
3zvx_A261 Structure Of The Lectin From Platypodium Elegans In 6e-14
1ax0_A239 Erythrina Corallodendron Lectin In Complex With N-A 1e-13
1fyu_A255 Crystal Structure Of Erythrina Corallodendron Lecti 1e-13
1uzy_A242 Erythrina Crystagalli Lectin Length = 242 1e-13
1fay_A238 Winged Bean Acidic Lectin Complexed With Methyl-Alp 1e-13
1qnw_A242 Lectin Ii From Ulex Europaeus Length = 242 2e-13
2eig_A234 Lotus Tetragonolobus Seed Lectin (Isoform) Length = 1e-12
1fny_A237 Legume Lectin Of The Bark Of Robinia Pseudoacacia. 3e-12
1fx5_A242 Crystal Structure Analysis Of Ulex Europaeus Lectin 4e-12
1dbn_A239 Maackia Amurensis Leukoagglutinin (Lectin) With Sia 7e-11
1gsl_A243 Lectin (Fourth Isolated From (Griffonia Simplicifol 9e-11
1hql_A257 The Xenograft Antigen In Complex With The B4 Isolec 2e-10
1gnz_A257 Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m 2e-10
1n3o_A252 Pterocarcpus Angolensis Lectin In Complex With Alph 8e-10
1q8o_A252 Pterocartpus Angolensis Lectin Pal In Complex With 8e-10
1lgc_A181 Interaction Of A Legume Lectin With The N2 Fragment 3e-09
1ofs_A187 Pea Lectin-sucrose Complex Length = 187 4e-09
2ltn_A181 Design, Expression, And Crystallization Of Recombin 4e-09
1rin_A180 X-Ray Crystal Structure Of A Pea Lectin-Trimannosid 4e-09
1lgb_A181 Interaction Of A Legume Lectin With The N2 Fragment 4e-09
1lof_C181 X-Ray Structure Of A Biantennary Octasaccharide-Lec 1e-08
2lal_A181 Crystal Structure Determination And Refinement At 2 1e-08
1avb_A226 Arcelin-1 From Phaseolus Vulgaris L Length = 226 1e-08
1loa_A181 Three-Dimensional Structures Of Complexes Of Lathyr 2e-08
2b7y_A182 Fava Bean Lectin-Glucose Complex Length = 182 3e-08
1mvq_A236 Cratylia Mollis Lectin (Isoform 1) In Complex With 2e-07
1qmo_E133 Structure Of Fril, A Legume Lectin That Delays Hema 2e-07
2jec_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 4e-07
2je9_A239 Crystal Structure Of Recombinant Dioclea Grandiflor 4e-07
2gdf_A237 Crystal Structure Of Dioclea Violacea Seed Lectin L 4e-07
3u4x_A236 Crystal Structure Of A Lectin From Camptosema Pedic 4e-07
3sh3_A237 Crystal Structure Of A Pro-Inflammatory Lectin From 4e-07
2ovu_A237 Crystal Strucure Of A Lectin From Canavalia Gladiat 5e-07
2d3p_A236 Cratylia Floribunda Seed Lectin Crystallized At Bas 5e-07
2pel_A236 Peanut Lectin Length = 236 8e-07
2zbj_A237 Crystal Structure Of Dioclea Rostrata Lectin Length 8e-07
1bzw_A232 Peanut Lectin Complexed With C-Lactose Length = 232 8e-07
1dgl_A237 Lectin From Dioclea Grandiflora Complexed To Triman 1e-06
1cn1_A237 Crystal Structure Of Demetallized Concanavalin A. T 1e-06
2cna_A237 The Covalent And Three-Dimensional Structure Of Con 1e-06
1wuv_A237 Crystal Structure Of Native Canavalia Gladiata Lect 1e-06
1ioa_A240 Arcelin-5, A Lectin-Like Defense Protein From Phase 1e-06
2jdz_A239 Crystal Structure Of Recombinant Dioclea Guianensis 2e-06
2je7_A239 Crystal Structure Of Recombinant Dioclea Guianensis 2e-06
3a0k_A237 Crystal Structure Of An Antiflamatory Legume Lectin 2e-06
1azd_A237 Concanavalin From Canavalia Brasiliensis Length = 2 2e-06
2ow4_A237 Crystal Structure Of A Lectin From Canavalia Mariti 2e-06
2cwm_A237 Native Crystal Structure Of No Releasing Inductive 3e-06
3rrd_A237 Native Structure Of Dioclea Virgata Lectin Length = 3e-06
1h9w_A237 Native Dioclea Guianensis Seed Lectin Length = 237 4e-06
2ctv_A237 High Resolution Crystallographic Studies Of Native 4e-06
1h9p_A237 Crystal Structure Of Dioclea Guianensis Seed Lectin 4e-06
2yz4_A237 The Neutron Structure Of Concanavalin A At 2.2 Angs 4e-06
1dhk_B223 Structure Of Porcine Pancreatic Alpha-Amylase Lengt 4e-05
1viw_B205 Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Le 1e-04
>pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 Back     alignment and structure 
Iteration: 1

 Score = 87.4 bits (215), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 57/179 (31%), Positives = 91/179 (50%), Gaps = 13/179 (7%)
Query: 3   STTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALELD 62
           +T+FT++IS    +   DG+ F   P     P   +G +LG+     +  S   +A+E D
Sbjct: 68  ATSFTVKISAPSKASFADGIAFALVP-VGSEP-RRNGGYLGVFDSDVYNNSAQTVAVEFD 125
Query: 63  TFMNE-FDPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSM 121
           T  N  +DP   HIGID  ++    TV+       DL +G N ++ I Y+  T +L  S+
Sbjct: 126 TLSNSGWDPSMKHIGIDVNSIKSIATVS------WDLANGENAEILITYNAATSLLVASL 179
Query: 122 AYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATG---DFSESHQVLDWTFTTMPLPPDS 177
            +       IL + + +++ +P  V VGF+A TG    + E+H VL W+F +  LP DS
Sbjct: 180 VHPSRRTSYILSERVDITNELPEYVSVGFSATTGLSEGYIETHDVLSWSFASK-LPDDS 237
>pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 Back     alignment and structure
>pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 Back     alignment and structure
>pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 Back     alignment and structure
>pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 Back     alignment and structure
>pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 Back     alignment and structure
>pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 Back     alignment and structure
>pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 Back     alignment and structure
>pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 Back     alignment and structure
>pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 Back     alignment and structure
>pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 Back     alignment and structure
>pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 Back     alignment and structure
>pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 Back     alignment and structure
>pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 Back     alignment and structure
>pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 Back     alignment and structure
>pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 Back     alignment and structure
>pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 Back     alignment and structure
>pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 Back     alignment and structure
>pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 Back     alignment and structure
>pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 Back     alignment and structure
>pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 Back     alignment and structure
>pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 Back     alignment and structure
>pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 Back     alignment and structure
>pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 Back     alignment and structure
>pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 Back     alignment and structure
>pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 Back     alignment and structure
>pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 Back     alignment and structure
>pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 Back     alignment and structure
>pdb|1FX5|A Chain A, Crystal Structure Analysis Of Ulex Europaeus Lectin I Length = 242 Back     alignment and structure
>pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 Back     alignment and structure
>pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 Back     alignment and structure
>pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 Back     alignment and structure
>pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 Back     alignment and structure
>pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 Back     alignment and structure
>pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 Back     alignment and structure
>pdb|1LGC|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 Back     alignment and structure
>pdb|1OFS|A Chain A, Pea Lectin-sucrose Complex Length = 187 Back     alignment and structure
>pdb|2LTN|A Chain A, Design, Expression, And Crystallization Of Recombinant Lectin From The Garden Pea (Pisum Sativum) Length = 181 Back     alignment and structure
>pdb|1RIN|A Chain A, X-Ray Crystal Structure Of A Pea Lectin-Trimannoside Complex At 2.6 Angstroms Resolution Length = 180 Back     alignment and structure
>pdb|1LGB|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 Back     alignment and structure
>pdb|1LOF|C Chain C, X-Ray Structure Of A Biantennary Octasaccharide-Lectin Complex At 2.3 Angstroms Resolution Length = 181 Back     alignment and structure
>pdb|2LAL|A Chain A, Crystal Structure Determination And Refinement At 2.3 Angstroms Resolution Of The Lentil Lectin Length = 181 Back     alignment and structure
>pdb|1AVB|A Chain A, Arcelin-1 From Phaseolus Vulgaris L Length = 226 Back     alignment and structure
>pdb|1LOA|A Chain A, Three-Dimensional Structures Of Complexes Of Lathyrus Ochrus Isolectin I With Glucose And Mannose: Fine Specificity Of The Monosaccharide-Binding Site Length = 181 Back     alignment and structure
>pdb|2B7Y|A Chain A, Fava Bean Lectin-Glucose Complex Length = 182 Back     alignment and structure
>pdb|1MVQ|A Chain A, Cratylia Mollis Lectin (Isoform 1) In Complex With Methyl-Alpha-D- Mannose Length = 236 Back     alignment and structure
>pdb|1QMO|E Chain E, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 133 Back     alignment and structure
>pdb|2JEC|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Mutant E123a-H131n-K132q Complexed With 5-Bromo-4-Chloro-3- Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JE9|A Chain A, Crystal Structure Of Recombinant Dioclea Grandiflora Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2GDF|A Chain A, Crystal Structure Of Dioclea Violacea Seed Lectin Length = 237 Back     alignment and structure
>pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 Back     alignment and structure
>pdb|3SH3|A Chain A, Crystal Structure Of A Pro-Inflammatory Lectin From The Seeds Of Dioclea Wilsonii Standl Length = 237 Back     alignment and structure
>pdb|2OVU|A Chain A, Crystal Strucure Of A Lectin From Canavalia Gladiata (Cgl) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 Back     alignment and structure
>pdb|2PEL|A Chain A, Peanut Lectin Length = 236 Back     alignment and structure
>pdb|2ZBJ|A Chain A, Crystal Structure Of Dioclea Rostrata Lectin Length = 237 Back     alignment and structure
>pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 Back     alignment and structure
>pdb|1DGL|A Chain A, Lectin From Dioclea Grandiflora Complexed To Trimannoside Length = 237 Back     alignment and structure
>pdb|1CN1|A Chain A, Crystal Structure Of Demetallized Concanavalin A. The Metal- Binding Region Length = 237 Back     alignment and structure
>pdb|2CNA|A Chain A, The Covalent And Three-Dimensional Structure Of Concanavalin A, Iv.Atomic Coordinates,Hydrogen Bonding,And Quaternary Structure Length = 237 Back     alignment and structure
>pdb|1WUV|A Chain A, Crystal Structure Of Native Canavalia Gladiata Lectin (Cgl): A Tetrameric Cona-Like Lectin Length = 237 Back     alignment and structure
>pdb|1IOA|A Chain A, Arcelin-5, A Lectin-Like Defense Protein From Phaseolus Vulgaris Length = 240 Back     alignment and structure
>pdb|2JDZ|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|2JE7|A Chain A, Crystal Structure Of Recombinant Dioclea Guianensis Lectin S131h Complexed With 5-Bromo-4-Chloro-3-Indolyl-A-D-Mannose Length = 239 Back     alignment and structure
>pdb|3A0K|A Chain A, Crystal Structure Of An Antiflamatory Legume Lectin From Cymbosema Roseum Seeds Length = 237 Back     alignment and structure
>pdb|1AZD|A Chain A, Concanavalin From Canavalia Brasiliensis Length = 237 Back     alignment and structure
>pdb|2OW4|A Chain A, Crystal Structure Of A Lectin From Canavalia Maritima Seeds (Conm) In Complex With Man1-2man-Ome Length = 237 Back     alignment and structure
>pdb|2CWM|A Chain A, Native Crystal Structure Of No Releasing Inductive Lectin From Seeds Of The Canavalia Maritima (Conm) Length = 237 Back     alignment and structure
>pdb|3RRD|A Chain A, Native Structure Of Dioclea Virgata Lectin Length = 237 Back     alignment and structure
>pdb|1H9W|A Chain A, Native Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|2CTV|A Chain A, High Resolution Crystallographic Studies Of Native Concanavalin A Using Rapid Laue Data Collection Methods And The Introduction Of A Monochromatic Large-Angle Oscillation Technique (Lot) Length = 237 Back     alignment and structure
>pdb|1H9P|A Chain A, Crystal Structure Of Dioclea Guianensis Seed Lectin Length = 237 Back     alignment and structure
>pdb|2YZ4|A Chain A, The Neutron Structure Of Concanavalin A At 2.2 Angstroms Length = 237 Back     alignment and structure
>pdb|1DHK|B Chain B, Structure Of Porcine Pancreatic Alpha-Amylase Length = 223 Back     alignment and structure
>pdb|1VIW|B Chain B, Tenebrio Molitor Alpha-Amylase-Inhibitor Complex Length = 205 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query215
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 5e-32
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 7e-32
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 2e-31
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 3e-30
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 5e-30
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 2e-29
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 3e-29
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 4e-29
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 4e-29
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 8e-29
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 1e-28
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 7e-28
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 9e-28
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 9e-28
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 2e-27
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 2e-27
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 3e-27
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 3e-27
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 4e-27
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 2e-26
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 3e-26
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 5e-23
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 3e-22
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 1e-20
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 2e-04
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 1e-17
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 4e-13
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 9e-10
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 1e-07
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 7e-05
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 Back     alignment and structure
 Score =  116 bits (290), Expect = 5e-32
 Identities = 57/189 (30%), Positives = 82/189 (43%), Gaps = 14/189 (7%)

Query: 2   ISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALEL 61
            +T+F   I     +   DG+ F  AP  +     S G FLG+   +    +   +A+E 
Sbjct: 70  FATSFRFTIYAPNIATIADGLAFFLAPVASAPD--SGGGFLGLFDSAVSGSTYQTVAVEF 127

Query: 62  DTFMNEF--DPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYV 119
           DT+ N    DP   HIG D  ++S   TV         L +G   KV I Y+   K+L  
Sbjct: 128 DTYENTVFTDPPYTHIGFDVNSISSIKTVK------WSLANGEAAKVLITYNSAVKLLVA 181

Query: 120 SMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATG---DFSESHQVLDWTFTTMPLPPD 176
           S+ Y       IL   + +S V+P  V VGF+AATG      E+H V  W+F    L   
Sbjct: 182 SLVYPSSKTSFILADIVDLSSVLPEWVRVGFSAATGASGGKIETHDVFSWSF-ASKLAGX 240

Query: 177 SLKSRKLIN 185
             K    ++
Sbjct: 241 XTKDSSFLD 249
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 Back     alignment and structure
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 Back     alignment and structure
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 113 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
3zyr_A261 Lectin; sugar binding protein, N-glycan; HET: NAG 100.0
3ipv_A251 Lectin alpha chain; galactose binding, SEED lectin 100.0
3ujo_A281 Legume lectin; carbohydrate-binding, galactose, ad 100.0
1dbn_A239 MAL, protein (leukoagglutinin); plant lectin, carb 100.0
1fny_A237 BARK lectin, BARK agglutinin I,polypeptide A; legu 100.0
1qnw_A242 Chitin binding lectin, UEA-II; carbohydrate bindin 100.0
2eig_A234 Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin 100.0
1fx5_A242 UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO 100.0
1g7y_A253 Stem/LEAF lectin DB58; jelly roll fold, sugar bind 100.0
1gzc_A239 Erythrina crista-galli lectin; carbohydrate, sugar 100.0
1n47_A233 Isolectin B4; cancer antigen, vicia villosa lectin 100.0
1sbf_A253 Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G 100.0
1fat_A252 Phytohemagglutinin-L; glycoprotein, plant defense 100.0
1v6i_A232 Agglutinin, PNA, galactose-binding lectin; open qu 100.0
1f9k_A238 Acidic lectin; legume lectin, glycosylated protein 100.0
2bqp_A234 Protein (PEA lectin); D-glucopyranose complex, sug 100.0
1wbf_A242 Protein (agglutinin); lectin (agglutinin), legume 100.0
1gsl_A243 Griffonia simplicifolia lectin 4; glycoprotein, ma 100.0
1hql_A257 Lectin; xenograft antigen, sugar BI protein; HET: 100.0
2fmd_A240 Lectin, agglutinin, BMA; legume lectin, beta sandw 100.0
1avb_A226 Arcelin-1; lectin-like glycoprotein, plant defense 100.0
1ioa_A240 Arcelin-5A, ARC5A; lectin-like proteins, plant def 100.0
1dhk_B223 Bean lectin-like inhibitor, porcine pancreatic alp 100.0
1qmo_E133 Mannose binding lectin, FRIL; crosslink, hematopoi 100.0
1nls_A237 Concanavalin A; lectin, agglutinin; 0.94A {Canaval 100.0
2ltn_A181 PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO 100.0
2dur_A253 VIP36;, vesicular integral-membrane protein VIP36; 99.96
1gv9_A260 P58/ergic-53; lectin, carbohydrate binding; 1.46A 99.96
2a6y_A256 EMP47P (FORM1); beta sandwich, carbohydrate bindin 99.88
2a6z_A222 EMP47P (FORM2); beta sandwich, carbohydrate bindin 99.65
2ltn_B52 PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP 99.54
2a6v_A226 EMP46P; beta sandwich, carbohydrate binding protei 99.21
1qmo_A113 Mannose binding lectin, FRIL; crosslink, hematopoi 99.16
>3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Back     alignment and structure
Probab=100.00  E-value=3e-49  Score=342.92  Aligned_cols=166  Identities=29%  Similarity=0.529  Sum_probs=150.2

Q ss_pred             CcEEEEEEEEeeCCCCCCCCeeEEEEccCCCCCCCCCCCccccccCCCCCCCc--cceEEEEEccc---cc-ccCCCCCe
Q 042179            1 MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGS--VSQLALELDTF---MN-EFDPDANH   74 (215)
Q Consensus         1 ~FsT~FtF~I~~~~~~~~gDGlAFvl~~~~~~~~~~~~G~~LGl~~~~~~g~~--~~~vAVEFDT~---~N-~~Dp~~nH   74 (215)
                      +|+|+|+|.|.++ ...+||||||||+|.+..+|.+.+|+||||++..++++.  .+.|||||||+   +| +|||++||
T Consensus        77 SFsT~F~F~I~~~-~~~~gdGlAF~lap~~~~~p~~~~g~~LGL~n~~~~g~~~~n~~vAVEFDT~~~~~n~~~Dp~~nH  155 (261)
T 3zyr_A           77 NLQTQFSFFLSSP-LSNPADGIAFFIAPPDTTIPSGSAGGLLGLFNPRTALNESANQVLAVEFDTFFAQNSNTWDPNYQH  155 (261)
T ss_dssp             EEEEEEEEEEECS-SSSCCCEEEEEEECTTCCCCTTCCGGGTTTCCTTTTTCGGGCCCEEEEEECCCCTTTCTTSCSSCE
T ss_pred             eEEEEEEEEEecC-CCCCCccEEEEEccCCCCCCCCCCCceeeeecccccCCCccCcEEEEEEeccccccCcCCCCCCCe
Confidence            5999999999976 577999999999998765677888999999998776543  35999999999   98 89999999


Q ss_pred             eEEecCCCCCceeeeecCCcCcccCCCCeEEEEEEEcCCccEEEEEEEecCCCceeeeeeeeecCCCCCCeEEEEEEeec
Q 042179           75 IGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAAT  154 (215)
Q Consensus        75 VgIdvns~~~S~~t~~~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~~p~~plls~~vdL~~~l~~~v~VGFSAsT  154 (215)
                      ||||+|++. |.++++|     .+.+|+.++|||+||+.+++|+|+|.+... +.|+|+..+||+++|+++|||||||+|
T Consensus       156 VGIdvNsi~-S~~s~~~-----~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~~-~~~~ls~~vdL~~~l~e~v~VGFSAsT  228 (261)
T 3zyr_A          156 IGIDVNSIR-SSKVVRW-----ERREGKTLNVLVTYNPSTRTIDVVATYPDG-QRYQLSHVVDLTTILPEWVRVGFSAAS  228 (261)
T ss_dssp             EEEEESSSS-CSEEEEC-----CCCTTCCEEEEEEEETTTTEEEEEEECTTC-CEEEEEEECCGGGTSCSEEEEEEEEEE
T ss_pred             EEEEcCCCC-ccccccc-----cccCCceEEEEEEEcCCCCEEEEEEEcCCC-CCeEEEEEechHHhCcCcEEEEEEecC
Confidence            999999999 9999887     467999999999999999999999998543 389999999999999999999999999


Q ss_pred             CCcccceEEEEEEEEeecCC
Q 042179          155 GDFSESHQVLDWTFTTMPLP  174 (215)
Q Consensus       155 G~~~e~h~I~sWsF~s~~~p  174 (215)
                      |...|.|+|++|+|++.+.+
T Consensus       229 G~~~e~h~IlsWsF~s~l~~  248 (261)
T 3zyr_A          229 GEQFQTHNLESWSFTSTLLY  248 (261)
T ss_dssp             SSSCCEEEEEEEEEEEEECC
T ss_pred             CCccceEEEEEEEEEEEcCC
Confidence            99999999999999998765
>3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Back     alignment and structure
>3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* Back     alignment and structure
>1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Back     alignment and structure
>1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Back     alignment and structure
>1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Back     alignment and structure
>2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Back     alignment and structure
>1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Back     alignment and structure
>1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Back     alignment and structure
>1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Back     alignment and structure
>1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Back     alignment and structure
>1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Back     alignment and structure
>1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Back     alignment and structure
>1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Back     alignment and structure
>1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Back     alignment and structure
>2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Back     alignment and structure
>1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Back     alignment and structure
>1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Back     alignment and structure
>1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Back     alignment and structure
>2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Back     alignment and structure
>1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Back     alignment and structure
>1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Back     alignment and structure
>1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure
>1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Back     alignment and structure
>2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Back     alignment and structure
>2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Back     alignment and structure
>1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Back     alignment and structure
>2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 Back     alignment and structure
>2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A Back     alignment and structure
>2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Back     alignment and structure
>2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A Back     alignment and structure
>1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 215
d1gzca_239 b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( 1e-33
d1f9ka_234 b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca 4e-32
d1g7ya_253 b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos 1e-31
d1qnwa_237 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 2e-31
d1n47a_233 b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi 4e-31
d2d3sa1237 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso 1e-30
d1g9fa_251 b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) 2e-30
d1g8wa_233 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-30
d1dbna_239 b.29.1.1 (A:) Legume lectin {Maackia amurensis, le 5e-29
d1fnya_237 b.29.1.1 (A:) Legume lectin {Black locust (Robinia 8e-29
d1hqla_236 b.29.1.1 (A:) Legume lectin {Griffonia simplicifol 3e-28
d1fx5a_240 b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus 5e-28
g1qmo.1230 b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich 6e-28
d1ioaa_228 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 3e-27
d1leda_243 b.29.1.1 (A:) Legume lectin {West-central african 5e-27
d1ukga_241 b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero 1e-26
d1v6ia_232 b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog 1e-26
g2ltn.1229 b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum 1e-25
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 2e-25
d1nlsa_237 b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia 1e-06
d1avba_226 b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar 2e-25
d1dhkb_204 b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar 4e-21
d1gv9a_228 b.29.1.13 (A:) Carbohydrate-recognition domain of 3e-19
d2a6va1218 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake 5e-09
d2a6za1221 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake 4e-06
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 Back     information, alignment and structure

class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]

 Score =  118 bits (297), Expect = 1e-33
 Identities = 50/173 (28%), Positives = 76/173 (43%), Gaps = 13/173 (7%)

Query: 3   STTFTIRI-SQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVGSVSQLALEL 61
            T F+  I   Y      DG+ F   P  +         +LG+ + S    S   LA+E 
Sbjct: 71  ETRFSFSIEQPYTRPLPADGLVFFMGPTKSKPA--QGYGYLGVFNNSKQDNSYQTLAVEF 128

Query: 62  DTFMNEF-DPDANHIGIDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVS 120
           DTF N +  P   HIGID        ++ S+      L +G+   V I YD  +K+L+V 
Sbjct: 129 DTFSNPWDPPQVPHIGIDVN------SIRSIKTQPFQLDNGQVANVVIKYDAPSKILHVV 182

Query: 121 MAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATG---DFSESHQVLDWTFTT 170
           + Y        + + + +  V+P  V VG + ATG   D +E+H V  W+F  
Sbjct: 183 LVYPSSGAIYTIAEIVDVKQVLPDWVDVGLSGATGAQRDAAETHDVYSWSFQA 235
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 Back     information, alignment and structure
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 Back     information, alignment and structure
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query215
d1hqla_236 Legume lectin {Griffonia simplicifolia, lectin I-b 100.0
d1leda_243 Legume lectin {West-central african legume (Griffo 100.0
d1fx5a_240 Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI 100.0
d1gzca_239 Legume lectin {Cockspur coral tree (Erythrina cris 100.0
d1qnwa_237 Legume lectin {Furze (Ulex europaeus), UEA-II [Tax 100.0
d2d3sa1237 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1g9fa_251 Legume lectin {Soybean (Glycine max) [TaxId: 3847] 100.0
d1g7ya_253 Legume lectin {Horse gram (Dolichos biflorus), dif 100.0
d1f9ka_234 Legume lectin {Winged bean (Psophocarpus tetragono 100.0
d1n47a_233 Legume lectin {Hairy vetch (Vicia villosa), isolec 100.0
d1g8wa_233 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1dbna_239 Legume lectin {Maackia amurensis, leukoagglutinin 100.0
d1fnya_237 Legume lectin {Black locust (Robinia pseudoacacia) 100.0
g1qmo.1230 Legume lectin {Field bean (Dolichos lablab), Fril 100.0
d1v6ia_232 Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 100.0
g2ltn.1229 Legume lectin {Garden pea (Pisum sativum) [TaxId: 100.0
d1ukga_241 Legume lectin {Bloodwood tree (Pterocarpus angolen 100.0
d1ioaa_228 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1avba_226 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1nlsa_237 Concanavalin A {Jack bean (Canavalia ensiformis) [ 100.0
d1dhkb_204 Phytohemagglutinin-L, PHA-L, also arcelin {Kidney 100.0
d1gv9a_228 Carbohydrate-recognition domain of P58/ERGIC-53 {R 99.9
d2a6va1218 Emp46p N-terminal domain {Baker's yeast (Saccharom 99.76
d2a6za1221 Emp47p N-terminal domain {Baker's yeast (Saccharom 99.73
>d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Back     information, alignment and structure
class: All beta proteins
fold: Concanavalin A-like lectins/glucanases
superfamily: Concanavalin A-like lectins/glucanases
family: Legume lectins
domain: Legume lectin
species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]

Probab=100.00  E-value=3.8e-46  Score=317.45  Aligned_cols=165  Identities=30%  Similarity=0.546  Sum_probs=145.0

Q ss_pred             CcEEEEEEEEeeCCCCCCCCeeEEEEccCCCCCCCCCCCccccccCCCCCCC--ccceEEEEEccccc-cc-CCCCCeeE
Q 042179            1 MISTTFTIRISQYPNSGAGDGMTFIFAPDTNPSPLHSDGSFLGIMSRSPHVG--SVSQLALELDTFMN-EF-DPDANHIG   76 (215)
Q Consensus         1 ~FsT~FtF~I~~~~~~~~gDGlAFvl~~~~~~~~~~~~G~~LGl~~~~~~g~--~~~~vAVEFDT~~N-~~-Dp~~nHVg   76 (215)
                      +|+|+|+|.|... ...+||||||||+|..  .+++..|++||+++..+.+.  ..+.+||||||++| ++ ||+++|||
T Consensus        67 sFsT~F~F~i~~~-~~~~gDGlAFvl~p~~--~~~~~~G~~lGl~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHIg  143 (236)
T d1hqla_          67 SFYTEFTFFLKIT-GNGPADGLAFFLAPPD--SDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIG  143 (236)
T ss_dssp             EEEEEEEEEEEEC-SSCCCCEEEEEEECTT--CCCCCCGGGTTTSCTTTTTCGGGCCCEEEEEECSCCSSSCCCSSCEEE
T ss_pred             EEEEEEEEEEeCC-CCCCCceEEEEEeCCC--CCCCCCccccccccccccCCcccCceEEEEeeCccCCCCCCCCCCEEE
Confidence            5999999999874 3678999999999976  35677899999998765443  34589999999999 55 99999999


Q ss_pred             EecCCCCCceeeeecCCcCcccCCCCeEEEEEEEcCCccEEEEEEEecCCCceeeeeeeeecCCCCCCeEEEEEEeecCC
Q 042179           77 IDATNMSKPITVTSLNGTGIDLKSGRNIKVQIDYDGRTKMLYVSMAYSEYPLGRILEKPIIMSDVVPSSVYVGFTAATGD  156 (215)
Q Consensus        77 Idvns~~~S~~t~~~~~~~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~~~p~~plls~~vdL~~~l~~~v~VGFSAsTG~  156 (215)
                      ||+|++. |.++.++.  ..+|++|+.++|||+||+.+++|+|+|++. +|..|+|++.|||+++|+++|||||||+||.
T Consensus       144 Idvns~~-s~~~~~~~--~~~l~~G~~~~v~I~Yd~~~~~L~V~l~~~-~~~~~~ls~~vdL~~~l~~~v~vGFSasTG~  219 (236)
T d1hqla_         144 INVNSIV-SVATKRWE--DSDIFSGKIATARISYDGSAEILTVVLSYP-DGSDYILSHSVDMRQNLPESVRVGISASTGN  219 (236)
T ss_dssp             EEESSSS-CSEEEECC--HHHHTSCSCEEEEEEEETTTTEEEEEEEET-TTEEEEEEEECCGGGTSCSEEEEEEEEECCS
T ss_pred             EEcCCcc-cccccccc--cccccCCCEEEEEEEEeCCCcEEEEEEecC-CCCCeeEEEEeCHHHhCCCcEEEEEEeECCC
Confidence            9999999 88887774  568999999999999999999999999874 5778999999999999999999999999997


Q ss_pred             c-ccceEEEEEEEEeec
Q 042179          157 F-SESHQVLDWTFTTMP  172 (215)
Q Consensus       157 ~-~e~h~I~sWsF~s~~  172 (215)
                      . .+.|+|++|+|++.+
T Consensus       220 ~~~~~h~I~sWsF~s~l  236 (236)
T d1hqla_         220 NQFLTVYILSWRFSSNL  236 (236)
T ss_dssp             CCCEEEEEEEEEEEEEC
T ss_pred             CCceEEEEEEeEeEecC
Confidence            5 677999999999863
>d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Back     information, alignment and structure
>d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Back     information, alignment and structure
>d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Back     information, alignment and structure
>d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Back     information, alignment and structure
>d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Back     information, alignment and structure
>d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Back     information, alignment and structure
>d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Back     information, alignment and structure
>d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Back     information, alignment and structure
>d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Back     information, alignment and structure
>d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Back     information, alignment and structure
>d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Back     information, alignment and structure
>d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Back     information, alignment and structure
>d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Back     information, alignment and structure
>d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Back     information, alignment and structure
>d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Back     information, alignment and structure
>d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Back     information, alignment and structure
>d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure