Citrus Sinensis ID: 042200


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-
VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVLKAAD
cHHHcccEEEEEEccHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHcccccEEEEcccccccccccccHHcHHHHHHHHHHcccccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHcccccEEEEEcccccccHHHHccccccHHHHHHHHHHccccccccccccc
cHHHcccEEEEEEccHHHHHHHHHHHccccEEEEEEEEcccHHHHHHHHHHHHcccEEEEEEcccccccccccccHHHHHHHEEEEEEccEcEEEEEEEEHHEEcccccEHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEEEccEccHHHHHHccccHHHHHHHHHHHcccccccccccc
VFIQHRAKVIIADVQDDLCRALCkefdsdelisYVCCNvtidsdvknvfdftkfgkldimfnnagiisnmdrttldtdneKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELgqydirvnSIAHIvsatpffcnamgidKKTFKELLYASANLKGVVLKAAD
vfiqhrakviiadvqdDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFnnagiisnmdrttlDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTFKELLYASAnlkgvvlkaad
VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVLKAAD
**IQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVL****
VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGI**K****LLYASANLK*VVL****
VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVLKAAD
VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTFKELLYASANLKG*******
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiii
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhhhhiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFTKFGKLDIMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFLGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVLKAAD
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query181 2.2.26 [Sep-21-2011]
Q94K41257 Short-chain dehydrogenase yes no 0.983 0.692 0.373 2e-28
F4J2Z7298 Short-chain dehydrogenase no no 0.977 0.593 0.371 3e-23
Q7FAE1274 Momilactone A synthase OS no no 0.988 0.653 0.376 2e-22
Q9SCU0303 Short-chain dehydrogenase no no 0.983 0.587 0.321 2e-21
F1SWA0267 Zerumbone synthase OS=Zin N/A no 1.0 0.677 0.330 7e-21
O80713257 Short-chain dehydrogenase no no 0.955 0.673 0.346 2e-20
O80714258 Short-chain dehydrogenase no no 0.972 0.682 0.33 3e-20
F4J300259 Short-chain dehydrogenase no no 0.955 0.667 0.336 9e-19
Q9C826285 Xanthoxin dehydrogenase O no no 0.994 0.631 0.323 4e-16
P50160336 Sex determination protein N/A no 0.845 0.455 0.286 6e-15
>sp|Q94K41|SDR3B_ARATH Short-chain dehydrogenase reductase 3b OS=Arabidopsis thaliana GN=SDR3b PE=2 SV=1 Back     alignment and function desciption
 Score =  124 bits (312), Expect = 2e-28,   Method: Compositional matrix adjust.
 Identities = 74/198 (37%), Positives = 112/198 (56%), Gaps = 20/198 (10%)

Query: 1   VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFT--KFGKLD 58
           +F +H A+V+I DVQD+L + +      D+  SY  C+VT +++V+N   FT  K+GKLD
Sbjct: 27  LFTEHGARVVIVDVQDELGQNVAVSIGEDKA-SYYHCDVTNETEVENAVKFTVEKYGKLD 85

Query: 59  IMFNNAGII-----------SNMDRT---TLDTDNEKVK---RVMIMVVFLGVLLFTANL 101
           ++F+NAG+I           + +DRT    L      +K   R M+     G ++ T ++
Sbjct: 86  VLFSNAGVIEPFVSILDLNLNELDRTIAINLRGTAAFIKHAARAMVEKGIRGSIVCTTSV 145

Query: 102 ATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKT 161
           A E  G A + Y  SK+ +LGL+K+    LG+Y IRVN +A    ATP  CN   ++   
Sbjct: 146 AAEIAGTAPHGYTTSKHGLLGLIKSASGGLGKYGIRVNGVAPFGVATPLVCNGFKMEPNV 205

Query: 162 FKELLYASANLKGVVLKA 179
            ++   ASANLKG+VLKA
Sbjct: 206 VEQNTSASANLKGIVLKA 223





Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 1EC: .EC: 1EC: .EC: -
>sp|F4J2Z7|SDR4_ARATH Short-chain dehydrogenase reductase 4 OS=Arabidopsis thaliana GN=SDR4 PE=2 SV=1 Back     alignment and function description
>sp|Q7FAE1|MOMAS_ORYSJ Momilactone A synthase OS=Oryza sativa subsp. japonica GN=Os04g0179200 PE=2 SV=1 Back     alignment and function description
>sp|Q9SCU0|SDR2A_ARATH Short-chain dehydrogenase reductase 2a OS=Arabidopsis thaliana GN=SDR2a PE=3 SV=1 Back     alignment and function description
>sp|F1SWA0|ZERSY_ZINZE Zerumbone synthase OS=Zingiber zerumbet GN=ZSD1 PE=1 SV=1 Back     alignment and function description
>sp|O80713|SDR3A_ARATH Short-chain dehydrogenase reductase 3a OS=Arabidopsis thaliana GN=SDR3a PE=2 SV=1 Back     alignment and function description
>sp|O80714|SDR3C_ARATH Short-chain dehydrogenase reductase 3c OS=Arabidopsis thaliana GN=SDR3c PE=3 SV=1 Back     alignment and function description
>sp|F4J300|SDR5_ARATH Short-chain dehydrogenase reductase 5 OS=Arabidopsis thaliana GN=SDR5 PE=2 SV=1 Back     alignment and function description
>sp|Q9C826|ABA2_ARATH Xanthoxin dehydrogenase OS=Arabidopsis thaliana GN=ABA2 PE=1 SV=1 Back     alignment and function description
>sp|P50160|TS2_MAIZE Sex determination protein tasselseed-2 OS=Zea mays GN=TS2 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
224091933277 predicted protein [Populus trichocarpa] 1.0 0.653 0.505 1e-46
255578629 340 short chain alcohol dehydrogenase, putat 1.0 0.532 0.51 1e-46
449451285 284 PREDICTED: zerumbone synthase-like [Cucu 1.0 0.637 0.475 8e-46
449527939281 PREDICTED: zerumbone synthase-like, part 1.0 0.644 0.475 1e-45
359482034280 PREDICTED: momilactone A synthase-like [ 0.961 0.621 0.518 1e-45
224140059279 predicted protein [Populus trichocarpa] 1.0 0.648 0.475 7e-43
224091925271 predicted protein [Populus trichocarpa] 1.0 0.667 0.475 2e-41
255571939 282 short chain alcohol dehydrogenase, putat 1.0 0.641 0.460 3e-40
255578619 282 short chain alcohol dehydrogenase, putat 1.0 0.641 0.450 7e-40
359482038 422 PREDICTED: momilactone A synthase-like [ 1.0 0.428 0.437 6e-38
>gi|224091933|ref|XP_002309405.1| predicted protein [Populus trichocarpa] gi|222855381|gb|EEE92928.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  191 bits (484), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 101/200 (50%), Positives = 133/200 (66%), Gaps = 19/200 (9%)

Query: 1   VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDF--TKFGKLD 58
           +F++H A VIIADVQD + ++LCKE  ++  + YV C+VT D+DVKNV DF  +K+GKLD
Sbjct: 35  LFVEHGANVIIADVQDQVGQSLCKELGTENNVYYVHCDVTSDTDVKNVVDFAISKYGKLD 94

Query: 59  IMFNNAGIISNMDRTTLDTDNEKVKRV-----------------MIMVVFLGVLLFTANL 101
           IM+NNAGI  N+D T L T+NE  KRV                 +++ V  GV+LFT+++
Sbjct: 95  IMYNNAGITGNIDPTILGTENENFKRVFEVNVYGGFLGAKHAARVMIPVKKGVILFTSSV 154

Query: 102 ATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKT 161
           A+   GE+ + Y MSK+AV+GLMKNLCVELGQY IRVN I+    ATP   NAMG DK  
Sbjct: 155 ASMACGESPHAYTMSKHAVVGLMKNLCVELGQYGIRVNCISPCALATPLLRNAMGADKSF 214

Query: 162 FKELLYASANLKGVVLKAAD 181
            + ++  SANLKGVV    D
Sbjct: 215 VEHVVCESANLKGVVPSPKD 234




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|255578629|ref|XP_002530176.1| short chain alcohol dehydrogenase, putative [Ricinus communis] gi|223530337|gb|EEF32231.1| short chain alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|449451285|ref|XP_004143392.1| PREDICTED: zerumbone synthase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449527939|ref|XP_004170965.1| PREDICTED: zerumbone synthase-like, partial [Cucumis sativus] Back     alignment and taxonomy information
>gi|359482034|ref|XP_002275746.2| PREDICTED: momilactone A synthase-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|224140059|ref|XP_002323404.1| predicted protein [Populus trichocarpa] gi|222868034|gb|EEF05165.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|224091925|ref|XP_002309402.1| predicted protein [Populus trichocarpa] gi|222855378|gb|EEE92925.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255571939|ref|XP_002526911.1| short chain alcohol dehydrogenase, putative [Ricinus communis] gi|223533730|gb|EEF35464.1| short chain alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|255578619|ref|XP_002530171.1| short chain alcohol dehydrogenase, putative [Ricinus communis] gi|223530332|gb|EEF32226.1| short chain alcohol dehydrogenase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359482038|ref|XP_002281320.2| PREDICTED: momilactone A synthase-like [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query181
TAIR|locus:2088399306 AT3G26770 [Arabidopsis thalian 0.502 0.297 0.353 1.7e-19
UNIPROTKB|Q5C9I9265 Q5C9I9 "(-)-isopiperitenol deh 0.546 0.373 0.336 1.1e-18
TAIR|locus:2041394257 SDR5 "short-chain dehydrogenas 0.530 0.373 0.406 1.6e-13
TAIR|locus:2094807298 SDR4 "short-chain dehydrogenas 0.569 0.345 0.370 1.2e-11
TAIR|locus:2098287303 SDR2 "short-chain dehydrogenas 0.679 0.405 0.312 1.6e-11
TAIR|locus:2041449258 AT2G47120 [Arabidopsis thalian 0.751 0.527 0.292 5.2e-11
TAIR|locus:2041439257 SDR3 "short-chain dehydrogenas 0.546 0.385 0.346 9.8e-10
TAIR|locus:2094822259 AT3G29260 [Arabidopsis thalian 0.569 0.397 0.333 1e-09
TAIR|locus:2125452343 AT4G03140 [Arabidopsis thalian 0.779 0.411 0.322 3.8e-09
TAIR|locus:2018149285 ABA2 "ABA DEFICIENT 2" [Arabid 0.364 0.231 0.408 4.8e-08
TAIR|locus:2088399 AT3G26770 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 156 (60.0 bits), Expect = 1.7e-19, Sum P(2) = 1.7e-19
 Identities = 35/99 (35%), Positives = 60/99 (60%)

Query:     2 FIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFT--KFGKLDI 59
             F++H A+V+IAD+  +      KE  S+    +V C+VT+++D+    + T  ++GKLD+
Sbjct:    63 FLRHGARVVIADLDAETGTKTAKELGSEA--EFVRCDVTVEADIAGAVEMTVERYGKLDV 120

Query:    60 MFNNAGIISNMDRTT---LD-TDNEKVKRVMIMVVFLGV 94
             M+NNAGI+  M   +   LD T+ E+V R+ +  V  G+
Sbjct:   121 MYNNAGIVGPMTPASISQLDMTEFERVMRINVFGVVSGI 159


GO:0000166 "nucleotide binding" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0016491 "oxidoreductase activity" evidence=IEA;ISS
GO:0010089 "xylem development" evidence=RCA
GO:0044036 "cell wall macromolecule metabolic process" evidence=RCA
UNIPROTKB|Q5C9I9 Q5C9I9 "(-)-isopiperitenol dehydrogenase" [Mentha x piperita (taxid:34256)] Back     alignment and assigned GO terms
TAIR|locus:2041394 SDR5 "short-chain dehydrogenase reductase 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094807 SDR4 "short-chain dehydrogenase reductase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2098287 SDR2 "short-chain dehydrogenase/reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041449 AT2G47120 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2041439 SDR3 "short-chain dehydrogenase/reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2094822 AT3G29260 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2125452 AT4G03140 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018149 ABA2 "ABA DEFICIENT 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!


Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
cd05326249 cd05326, secoisolariciresinol-DH_like_SDR_c, secoi 3e-44
PLN02253280 PLN02253, PLN02253, xanthoxin dehydrogenase 8e-31
cd05233234 cd05233, SDR_c, classical (c) SDRs 6e-19
PRK05565247 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) 3e-17
PRK07231251 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) 6e-16
cd05341247 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta 2e-15
cd05345248 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl 1e-14
COG1028251 COG1028, FabG, Dehydrogenases with different speci 1e-14
PRK12829264 PRK12829, PRK12829, short chain dehydrogenase; Pro 1e-13
PRK06057255 PRK06057, PRK06057, short chain dehydrogenase; Pro 4e-13
PRK06172253 PRK06172, PRK06172, short chain dehydrogenase; Pro 4e-12
cd05364253 cd05364, SDR_c11, classical (c) SDR, subgroup 11 4e-12
PRK12826251 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-prote 5e-12
cd05330257 cd05330, cyclohexanol_reductase_SDR_c, cyclohexano 9e-12
TIGR03971265 TIGR03971, SDR_subfam_1, oxidoreductase, SDR famil 2e-11
PRK06484 520 PRK06484, PRK06484, short chain dehydrogenase; Val 6e-11
cd05347248 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogena 7e-11
cd05358253 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (Glc 8e-11
PRK05653246 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) 8e-11
cd05365242 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroi 4e-10
PRK06200263 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydropheny 5e-10
PRK12939250 PRK12939, PRK12939, short chain dehydrogenase; Pro 1e-09
cd05339243 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hy 1e-09
cd08933261 cd08933, RDH_SDR_c, retinal dehydrogenase-like, cl 2e-09
cd05323244 cd05323, ADH_SDR_c_like, insect type alcohol dehyd 2e-09
cd05369249 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reducta 3e-09
cd08943250 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate al 3e-09
PRK07063260 PRK07063, PRK07063, short chain dehydrogenase; Pro 1e-08
PRK08324681 PRK08324, PRK08324, short chain dehydrogenase; Val 1e-08
PRK06113255 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydro 2e-08
PRK06463255 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-08
PRK07774250 PRK07774, PRK07774, short chain dehydrogenase; Pro 3e-08
PRK12827249 PRK12827, PRK12827, short chain dehydrogenase; Pro 3e-08
PRK07067257 PRK07067, PRK07067, sorbitol dehydrogenase; Provis 4e-08
PRK12429258 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenas 4e-08
cd05352252 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (M 5e-08
PRK06171266 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydro 6e-08
TIGR01832248 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogena 9e-08
PRK05557248 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) 9e-08
PRK08226263 PRK08226, PRK08226, short chain dehydrogenase; Pro 1e-07
PRK08267260 PRK08267, PRK08267, short chain dehydrogenase; Pro 1e-07
cd05371252 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydr 1e-07
cd05366257 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol 1e-07
TIGR02415254 TIGR02415, 23BDH, acetoin reductases 2e-07
PRK05867253 PRK05867, PRK05867, short chain dehydrogenase; Pro 2e-07
PRK06138252 PRK06138, PRK06138, short chain dehydrogenase; Pro 2e-07
PRK06935258 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrog 3e-07
PRK07890258 PRK07890, PRK07890, short chain dehydrogenase; Pro 4e-07
PRK12481251 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrog 5e-07
PRK12937245 PRK12937, PRK12937, short chain dehydrogenase; Pro 6e-07
PRK05650270 PRK05650, PRK05650, short chain dehydrogenase; Pro 6e-07
PRK09242257 PRK09242, PRK09242, tropinone reductase; Provision 9e-07
cd05362243 cd05362, THN_reductase-like_SDR_c, tetrahydroxynap 1e-06
TIGR01830239 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier 1e-06
cd08929226 cd08929, SDR_c4, classical (c) SDR, subgroup 4 2e-06
PRK08213259 PRK08213, PRK08213, gluconate 5-dehydrogenase; Pro 2e-06
cd05348257 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydro 2e-06
cd08944246 cd08944, SDR_c12, classical (c) SDR, subgroup 12 3e-06
cd05374248 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxyster 4e-06
PRK07478254 PRK07478, PRK07478, short chain dehydrogenase; Pro 5e-06
PRK08085254 PRK08085, PRK08085, gluconate 5-dehydrogenase; Pro 6e-06
PRK06841255 PRK06841, PRK06841, short chain dehydrogenase; Pro 6e-06
COG4221246 COG4221, COG4221, Short-chain alcohol dehydrogenas 6e-06
PRK12743256 PRK12743, PRK12743, oxidoreductase; Provisional 7e-06
PRK12825249 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) 7e-06
cd05368241 cd05368, DHRS6_like_SDR_c, human DHRS6-like, class 8e-06
cd08936256 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl re 8e-06
cd05333240 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein 8e-06
PRK07060245 PRK07060, PRK07060, short chain dehydrogenase; Pro 9e-06
PRK08217253 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) 1e-05
cd05329251 cd05329, TR_SDR_c, tropinone reductase-I and II (T 1e-05
cd05355270 cd05355, SDR_c1, classical (c) SDR, subgroup 1 2e-05
PRK08993253 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrog 2e-05
PRK12384259 PRK12384, PRK12384, sorbitol-6-phosphate dehydroge 2e-05
cd05324225 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicu 2e-05
cd05353250 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)- 2e-05
cd08931227 cd08931, SDR_c9, classical (c) SDR, subgroup 9 2e-05
cd05363254 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), 3e-05
PRK12935247 PRK12935, PRK12935, acetoacetyl-CoA reductase; Pro 4e-05
PRK08589272 PRK08589, PRK08589, short chain dehydrogenase; Val 4e-05
PRK06398258 PRK06398, PRK06398, aldose dehydrogenase; Validate 5e-05
PRK05872296 PRK05872, PRK05872, short chain dehydrogenase; Pro 5e-05
PRK07825273 PRK07825, PRK07825, short chain dehydrogenase; Pro 8e-05
PRK07326237 PRK07326, PRK07326, short chain dehydrogenase; Pro 1e-04
PRK06124256 PRK06124, PRK06124, gluconate 5-dehydrogenase; Pro 1e-04
PRK05876275 PRK05876, PRK05876, short chain dehydrogenase; Pro 1e-04
COG0623259 COG0623, FabI, Enoyl-[acyl-carrier-protein] 1e-04
PRK06947248 PRK06947, PRK06947, glucose-1-dehydrogenase; Provi 2e-04
PRK06550235 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) 2e-04
PRK08936261 PRK08936, PRK08936, glucose-1-dehydrogenase; Provi 2e-04
PRK12828239 PRK12828, PRK12828, short chain dehydrogenase; Pro 3e-04
cd05322257 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehy 3e-04
cd08939239 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine 3e-04
cd05340236 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-li 4e-04
PRK07831262 PRK07831, PRK07831, short chain dehydrogenase; Pro 6e-04
PRK06114254 PRK06114, PRK06114, short chain dehydrogenase; Pro 6e-04
PRK07062265 PRK07062, PRK07062, short chain dehydrogenase; Pro 8e-04
TIGR02632676 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate 0.001
cd05338246 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogena 0.001
cd05372250 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) 0.001
PRK07035252 PRK07035, PRK07035, short chain dehydrogenase; Pro 0.001
PRK07097265 PRK07097, PRK07097, gluconate 5-dehydrogenase; Pro 0.001
PRK06484520 PRK06484, PRK06484, short chain dehydrogenase; Val 0.002
TIGR01963255 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase 0.002
TIGR02685267 TIGR02685, pter_reduc_Leis, pteridine reductase 0.002
PRK05855582 PRK05855, PRK05855, short chain dehydrogenase; Val 0.003
PRK08945247 PRK08945, PRK08945, putative oxoacyl-(acyl carrier 0.003
PRK06194287 PRK06194, PRK06194, hypothetical protein; Provisio 0.003
PRK06123248 PRK06123, PRK06123, short chain dehydrogenase; Pro 0.004
cd05349246 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl 0.004
>gnl|CDD|187587 cd05326, secoisolariciresinol-DH_like_SDR_c, secoisolariciresinol dehydrogenase (secoisolariciresinol-DH)-like, classical (c) SDRs Back     alignment and domain information
 Score =  146 bits (370), Expect = 3e-44
 Identities = 70/199 (35%), Positives = 112/199 (56%), Gaps = 20/199 (10%)

Query: 2   FIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFT--KFGKLDI 59
           F +H A+V+IAD+ DD  +A+  E    + IS+V C+VT+++DV+   D    +FG+LDI
Sbjct: 24  FAKHGARVVIADIDDDAGQAVAAELGDPD-ISFVHCDVTVEADVRAAVDTAVARFGRLDI 82

Query: 60  MFNNAGIISNMDRTTLDTDNEKVKRVMIMVV---FLGV--------------LLFTANLA 102
           MFNNAG++     + L+T  E+ +RV+ + V   FLG               ++  A++A
Sbjct: 83  MFNNAGVLGAPCYSILETSLEEFERVLDVNVYGAFLGTKHAARVMIPAKKGSIVSVASVA 142

Query: 103 TETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKTF 162
               G   + Y  SK+AVLGL ++   ELG++ IRVN ++    ATP      G++ +  
Sbjct: 143 GVVGGLGPHAYTASKHAVLGLTRSAATELGEHGIRVNCVSPYGVATPLLTAGFGVEDEAI 202

Query: 163 KELLYASANLKGVVLKAAD 181
           +E +  +ANLKG  L+  D
Sbjct: 203 EEAVRGAANLKGTALRPED 221


Podophyllum secoisolariciresinol-DH is a homo tetrameric, classical SDR that catalyzes the NAD-dependent conversion of (-)-secoisolariciresinol to (-)-matairesinol via a (-)-lactol intermediate. (-)-Matairesinol is an intermediate to various 8'-lignans, including the cancer-preventive mammalian lignan, and those involved in vascular plant defense. This subgroup also includes rice momilactone A synthase which catalyzes the conversion of 3beta-hydroxy-9betaH-pimara-7,15-dien-19,6beta-olide into momilactone A, Arabidopsis ABA2 which during abscisic acid (ABA) biosynthesis, catalyzes the conversion of xanthoxin to abscisic aldehyde and, maize Tasselseed2 which participate in the maize sex determination pathway. SDRs are a functionally diverse family of oxidoreductases that have a single domain with a structurally conserved Rossmann fold (alpha/beta folding pattern with a central beta-sheet), an NAD(P)(H)-binding region, and a structurally diverse C-terminal region. Classical SDRs are typically about 250 residues long, while extended SDRs are approximately 350 residues. Sequence identity between different SDR enzymes are typically in the 15-30% range, but the enzymes share the Rossmann fold NAD-binding motif and characteristic NAD-binding and catalytic sequence patterns. These enzymes catalyze a wide range of activities including the metabolism of steroids, cofactors, carbohydrates, lipids, aromatic compounds, and amino acids, and act in redox sensing. Classical SDRs have an TGXXX[AG]XG cofactor binding motif and a YXXXK active site motif, with the Tyr residue of the active site motif serving as a critical catalytic residue (Tyr-151, 15-hydroxyprostaglandin dehydrogenase (15-PGDH) numbering). In addition to the Tyr and Lys, there is often an upstream Ser (Ser-138, 15-PGDH numbering) and/or an Asn (Asn-107, 15-PGDH numbering) contributing to the active site; while substrate binding is in the C-terminal region, which determines specificity. The standard reaction mechanism is a 4-pro-S hydride transfer and proton relay involving the conserved Tyr and Lys, a water molecule stabilized by Asn, and nicotinamide. Extended SDRs have additional elements in the C-terminal region, and typically have a TGXXGXXG cofactor binding motif. Complex (multidomain) SDRs such as ketoreductase domains of fatty acid synthase have a GGXGXXG NAD(P)-binding motif and an altered active site motif (YXXXN). Fungal type ketoacyl reductases have a TGXXXGX(1-2)G NAD(P)-binding motif. Some atypical SDRs have lost catalytic activity and/or have an unusual NAD(P)-binding motif and missing or unusual active site residues. Reactions catalyzed within the SDR family include isomerization, decarboxylation, epimerization, C=N bond reduction, dehydratase activity, dehalogenation, Enoyl-CoA reduction, and carbonyl-alcohol oxidoreduction. Length = 249

>gnl|CDD|177895 PLN02253, PLN02253, xanthoxin dehydrogenase Back     alignment and domain information
>gnl|CDD|212491 cd05233, SDR_c, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235506 PRK05565, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|235975 PRK07231, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187600 cd05341, 3beta-17beta-HSD_like_SDR_c, 3beta17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187603 cd05345, BKR_3_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP] reductase (BKR), subgroup 3, classical (c) SDR Back     alignment and domain information
>gnl|CDD|223959 COG1028, FabG, Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>gnl|CDD|183778 PRK12829, PRK12829, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180371 PRK06057, PRK06057, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180440 PRK06172, PRK06172, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187622 cd05364, SDR_c11, classical (c) SDR, subgroup 11 Back     alignment and domain information
>gnl|CDD|183775 PRK12826, PRK12826, 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>gnl|CDD|187591 cd05330, cyclohexanol_reductase_SDR_c, cyclohexanol reductases, including levodione reductase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|234422 TIGR03971, SDR_subfam_1, oxidoreductase, SDR family Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|187605 cd05347, Ga5DH-like_SDR_c, gluconate 5-dehydrogenase (Ga5DH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187616 cd05358, GlcDH_SDR_c, glucose 1 dehydrogenase (GlcDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235546 PRK05653, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|187623 cd05365, 7_alpha_HSDH_SDR_c, 7 alpha-hydroxysteroid dehydrogenase (7 alpha-HSDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235739 PRK06200, PRK06200, 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|183833 PRK12939, PRK12939, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187598 cd05339, 17beta-HSDXI-like_SDR_c, human 17-beta-hydroxysteroid dehydrogenase XI-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187638 cd08933, RDH_SDR_c, retinal dehydrogenase-like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187584 cd05323, ADH_SDR_c_like, insect type alcohol dehydrogenase (ADH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187627 cd05369, TER_DECR_SDR_a, Trans-2-enoyl-CoA reductase (TER) and 2,4-dienoyl-CoA reductase (DECR), atypical (a) SDR Back     alignment and domain information
>gnl|CDD|187647 cd08943, R1PA_ADH_SDR_c, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|235924 PRK07063, PRK07063, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236241 PRK08324, PRK08324, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|135765 PRK06113, PRK06113, 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|180576 PRK06463, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|236094 PRK07774, PRK07774, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237219 PRK12827, PRK12827, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235925 PRK07067, PRK07067, sorbitol dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237100 PRK12429, PRK12429, 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187610 cd05352, MDH-like_SDR_c, mannitol dehydrogenase (MDH)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180439 PRK06171, PRK06171, sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|188170 TIGR01832, kduD, 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>gnl|CDD|235500 PRK05557, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>gnl|CDD|181305 PRK08226, PRK08226, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|236210 PRK08267, PRK08267, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187629 cd05371, HSD10-like_SDR_c, 17hydroxysteroid dehydrogenase type 10 (HSD10)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187624 cd05366, meso-BDH-like_SDR_c, meso-2,3-butanediol dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|131468 TIGR02415, 23BDH, acetoin reductases Back     alignment and domain information
>gnl|CDD|135631 PRK05867, PRK05867, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235712 PRK06138, PRK06138, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180761 PRK06935, PRK06935, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181159 PRK07890, PRK07890, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171531 PRK12481, PRK12481, 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|171821 PRK12937, PRK12937, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235545 PRK05650, PRK05650, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181721 PRK09242, PRK09242, tropinone reductase; Provisional Back     alignment and domain information
>gnl|CDD|187620 cd05362, THN_reductase-like_SDR_c, tetrahydroxynaphthalene/trihydroxynaphthalene reductase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|233590 TIGR01830, 3oxo_ACP_reduc, 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>gnl|CDD|187634 cd08929, SDR_c4, classical (c) SDR, subgroup 4 Back     alignment and domain information
>gnl|CDD|181295 PRK08213, PRK08213, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187606 cd05348, BphB-like_SDR_c, cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase (BphB)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187648 cd08944, SDR_c12, classical (c) SDR, subgroup 12 Back     alignment and domain information
>gnl|CDD|187632 cd05374, 17beta-HSD-like_SDR_c, 17beta hydroxysteroid dehydrogenase-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180993 PRK07478, PRK07478, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181225 PRK08085, PRK08085, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180723 PRK06841, PRK06841, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|226674 COG4221, COG4221, Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>gnl|CDD|237187 PRK12743, PRK12743, oxidoreductase; Provisional Back     alignment and domain information
>gnl|CDD|237218 PRK12825, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187626 cd05368, DHRS6_like_SDR_c, human DHRS6-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187641 cd08936, CR_SDR_c, Porcine peroxisomal carbonyl reductase like, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187594 cd05333, BKR_SDR_c, beta-Keto acyl carrier protein reductase (BKR), involved in Type II FAS, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|180817 PRK07060, PRK07060, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181297 PRK08217, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|187590 cd05329, TR_SDR_c, tropinone reductase-I and II (TR-1, and TR-II)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187613 cd05355, SDR_c1, classical (c) SDR, subgroup 1 Back     alignment and domain information
>gnl|CDD|181605 PRK08993, PRK08993, 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|183489 PRK12384, PRK12384, sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187585 cd05324, carb_red_PTCR-like_SDR_c, Porcine testicular carbonyl reductase (PTCR)-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187611 cd05353, hydroxyacyl-CoA-like_DH_SDR_c-like, (3R)-hydroxyacyl-CoA dehydrogenase-like, classical(c)-like SDRs Back     alignment and domain information
>gnl|CDD|187636 cd08931, SDR_c9, classical (c) SDR, subgroup 9 Back     alignment and domain information
>gnl|CDD|187621 cd05363, SDH_SDR_c, Sorbitol dehydrogenase (SDH), classical (c) SDR Back     alignment and domain information
>gnl|CDD|183832 PRK12935, PRK12935, acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>gnl|CDD|181491 PRK08589, PRK08589, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235794 PRK06398, PRK06398, aldose dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|235633 PRK05872, PRK05872, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|181136 PRK07825, PRK07825, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235990 PRK07326, PRK07326, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235702 PRK06124, PRK06124, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|135637 PRK05876, PRK05876, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|223696 COG0623, FabI, Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>gnl|CDD|180771 PRK06947, PRK06947, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180617 PRK06550, fabG, 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|181585 PRK08936, PRK08936, glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|237220 PRK12828, PRK12828, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187583 cd05322, SDH_SDR_c_like, Sorbitol 6-phosphate dehydrogenase (SDH), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187643 cd08939, KDSR-like_SDR_c, 3-ketodihydrosphingosine reductase (KDSR) and related proteins, classical (c) SDR Back     alignment and domain information
>gnl|CDD|187599 cd05340, Ycik_SDR_c, Escherichia coli K-12 YCIK-like, classical (c) SDRs Back     alignment and domain information
>gnl|CDD|236110 PRK07831, PRK07831, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180408 PRK06114, PRK06114, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|180818 PRK07062, PRK07062, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|131680 TIGR02632, RhaD_aldol-ADH, rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>gnl|CDD|187597 cd05338, DHRS1_HSDL2-like_SDR_c, human dehydrogenase/reductase (SDR family) member 1 (DHRS1) and human hydroxysteroid dehydrogenase-like protein 2 (HSDL2), classical (c) SDRs Back     alignment and domain information
>gnl|CDD|187630 cd05372, ENR_SDR, Enoyl acyl carrier protein (ACP) reductase (ENR), divergent SDR Back     alignment and domain information
>gnl|CDD|180802 PRK07035, PRK07035, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|235933 PRK07097, PRK07097, gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|168574 PRK06484, PRK06484, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|211705 TIGR01963, PHB_DH, 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>gnl|CDD|131732 TIGR02685, pter_reduc_Leis, pteridine reductase Back     alignment and domain information
>gnl|CDD|235628 PRK05855, PRK05855, short chain dehydrogenase; Validated Back     alignment and domain information
>gnl|CDD|236357 PRK08945, PRK08945, putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>gnl|CDD|180458 PRK06194, PRK06194, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|180411 PRK06123, PRK06123, short chain dehydrogenase; Provisional Back     alignment and domain information
>gnl|CDD|187607 cd05349, BKR_2_SDR_c, putative beta-ketoacyl acyl carrier protein [ACP]reductase (BKR), subgroup 2, classical (c) SDR Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 181
KOG1200256 consensus Mitochondrial/plastidial beta-ketoacyl-A 100.0
PF13561241 adh_short_C2: Enoyl-(Acyl carrier protein) reducta 100.0
PRK06079252 enoyl-(acyl carrier protein) reductase; Provisiona 100.0
PRK08339263 short chain dehydrogenase; Provisional 100.0
COG4221246 Short-chain alcohol dehydrogenase of unknown speci 99.98
PRK06505271 enoyl-(acyl carrier protein) reductase; Provisiona 99.98
PRK06603260 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK08690261 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK08415274 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK07984262 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK12481251 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.97
COG0300265 DltE Short-chain dehydrogenases of various substra 99.97
PRK07370258 enoyl-(acyl carrier protein) reductase; Validated 99.97
PRK08594257 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK07533258 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK07063260 short chain dehydrogenase; Provisional 99.97
KOG0725270 consensus Reductases with broad range of substrate 99.97
PRK08340259 glucose-1-dehydrogenase; Provisional 99.97
PRK08159272 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK06997260 enoyl-(acyl carrier protein) reductase; Provisiona 99.97
PRK05867253 short chain dehydrogenase; Provisional 99.97
PRK08589272 short chain dehydrogenase; Validated 99.97
PRK07478254 short chain dehydrogenase; Provisional 99.97
PRK08085254 gluconate 5-dehydrogenase; Provisional 99.97
KOG1207245 consensus Diacetyl reductase/L-xylulose reductase 99.97
PRK08416260 7-alpha-hydroxysteroid dehydrogenase; Provisional 99.96
KOG1205282 consensus Predicted dehydrogenase [Secondary metab 99.96
PRK08265261 short chain dehydrogenase; Provisional 99.96
PRK06114254 short chain dehydrogenase; Provisional 99.96
PRK07062265 short chain dehydrogenase; Provisional 99.96
PRK06484520 short chain dehydrogenase; Validated 99.96
PRK07889256 enoyl-(acyl carrier protein) reductase; Provisiona 99.96
PRK05872296 short chain dehydrogenase; Provisional 99.96
PRK06172253 short chain dehydrogenase; Provisional 99.96
PLN02730303 enoyl-[acyl-carrier-protein] reductase 99.96
PRK08277278 D-mannonate oxidoreductase; Provisional 99.96
PRK08993253 2-deoxy-D-gluconate 3-dehydrogenase; Validated 99.96
PRK06935258 2-deoxy-D-gluconate 3-dehydrogenase; Provisional 99.96
PRK07831262 short chain dehydrogenase; Provisional 99.96
PRK06200263 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrog 99.96
PRK07035252 short chain dehydrogenase; Provisional 99.96
PRK07677252 short chain dehydrogenase; Provisional 99.96
PRK07523255 gluconate 5-dehydrogenase; Provisional 99.96
PRK08643256 acetoin reductase; Validated 99.96
PRK08303305 short chain dehydrogenase; Provisional 99.96
PRK07097265 gluconate 5-dehydrogenase; Provisional 99.96
PRK12747252 short chain dehydrogenase; Provisional 99.96
KOG1201300 consensus Hydroxysteroid 17-beta dehydrogenase 11 99.96
PRK07985294 oxidoreductase; Provisional 99.96
PRK09242257 tropinone reductase; Provisional 99.96
TIGR01500256 sepiapter_red sepiapterin reductase. This model de 99.96
PRK06125259 short chain dehydrogenase; Provisional 99.96
PRK06128300 oxidoreductase; Provisional 99.96
PRK06940275 short chain dehydrogenase; Provisional 99.95
PRK07791286 short chain dehydrogenase; Provisional 99.95
TIGR03325262 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydro 99.95
PRK08936261 glucose-1-dehydrogenase; Provisional 99.95
TIGR01832248 kduD 2-deoxy-D-gluconate 3-dehydrogenase. This mod 99.95
PRK06113255 7-alpha-hydroxysteroid dehydrogenase; Validated 99.95
PRK07067257 sorbitol dehydrogenase; Provisional 99.95
PRK12859256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.95
PRK06463255 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.95
PRK06398258 aldose dehydrogenase; Validated 99.95
TIGR01831239 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductas 99.95
PRK12743256 oxidoreductase; Provisional 99.95
PRK06124256 gluconate 5-dehydrogenase; Provisional 99.95
PRK06139 330 short chain dehydrogenase; Provisional 99.95
PRK07856252 short chain dehydrogenase; Provisional 99.95
PRK05876275 short chain dehydrogenase; Provisional 99.95
TIGR02415254 23BDH acetoin reductases. One member of this famil 99.95
PRK06484 520 short chain dehydrogenase; Validated 99.95
PRK05599246 hypothetical protein; Provisional 99.95
PRK08226263 short chain dehydrogenase; Provisional 99.95
PRK06841255 short chain dehydrogenase; Provisional 99.94
PRK08862227 short chain dehydrogenase; Provisional 99.94
PRK07890258 short chain dehydrogenase; Provisional 99.94
PRK06300299 enoyl-(acyl carrier protein) reductase; Provisiona 99.94
PRK05855582 short chain dehydrogenase; Validated 99.94
PRK06483236 dihydromonapterin reductase; Provisional 99.94
PLN02253280 xanthoxin dehydrogenase 99.94
PRK06500249 short chain dehydrogenase; Provisional 99.94
PRK12823260 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylat 99.94
PRK06949258 short chain dehydrogenase; Provisional 99.94
PRK07814263 short chain dehydrogenase; Provisional 99.94
KOG1199260 consensus Short-chain alcohol dehydrogenase/3-hydr 99.94
PRK12384259 sorbitol-6-phosphate dehydrogenase; Provisional 99.94
PRK07069251 short chain dehydrogenase; Validated 99.94
PRK05717255 oxidoreductase; Validated 99.94
PRK12938246 acetyacetyl-CoA reductase; Provisional 99.94
PRK06701290 short chain dehydrogenase; Provisional 99.94
PRK07576264 short chain dehydrogenase; Provisional 99.94
PRK08063250 enoyl-(acyl carrier protein) reductase; Provisiona 99.94
PRK06182273 short chain dehydrogenase; Validated 99.94
PRK07041230 short chain dehydrogenase; Provisional 99.94
PRK08642253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK06057255 short chain dehydrogenase; Provisional 99.93
PRK06523260 short chain dehydrogenase; Provisional 99.93
PRK08263275 short chain dehydrogenase; Provisional 99.93
PRK08213259 gluconate 5-dehydrogenase; Provisional 99.93
PRK08628258 short chain dehydrogenase; Provisional 99.93
PRK05650270 short chain dehydrogenase; Provisional 99.93
PRK07231251 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.93
PRK06171266 sorbitol-6-phosphate 2-dehydrogenase; Provisional 99.93
PRK12937245 short chain dehydrogenase; Provisional 99.93
PRK12936245 3-ketoacyl-(acyl-carrier-protein) reductase NodG; 99.93
PRK06123248 short chain dehydrogenase; Provisional 99.93
PRK06180277 short chain dehydrogenase; Provisional 99.93
PLN00015308 protochlorophyllide reductase 99.93
PRK07024257 short chain dehydrogenase; Provisional 99.93
PRK12939250 short chain dehydrogenase; Provisional 99.93
PRK07832272 short chain dehydrogenase; Provisional 99.93
PRK08278273 short chain dehydrogenase; Provisional 99.93
PRK06947248 glucose-1-dehydrogenase; Provisional 99.93
PRK07109 334 short chain dehydrogenase; Provisional 99.93
KOG1610322 consensus Corticosteroid 11-beta-dehydrogenase and 99.93
PRK05993277 short chain dehydrogenase; Provisional 99.93
TIGR03206250 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydr 99.93
PRK06138252 short chain dehydrogenase; Provisional 99.93
PRK12748256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.93
PRK12742237 oxidoreductase; Provisional 99.93
PLN02780320 ketoreductase/ oxidoreductase 99.93
PRK07825273 short chain dehydrogenase; Provisional 99.93
KOG4169261 consensus 15-hydroxyprostaglandin dehydrogenase an 99.92
PRK08220252 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated 99.92
PRK12824245 acetoacetyl-CoA reductase; Provisional 99.92
TIGR01829242 AcAcCoA_reduct acetoacetyl-CoA reductase. (R)-3-hy 99.92
TIGR02685267 pter_reduc_Leis pteridine reductase. Pteridine red 99.92
PRK12935247 acetoacetyl-CoA reductase; Provisional 99.92
PRK05875276 short chain dehydrogenase; Provisional 99.92
PRK06914280 short chain dehydrogenase; Provisional 99.92
PRK08217253 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.92
PRK05866293 short chain dehydrogenase; Provisional 99.92
PRK12428241 3-alpha-hydroxysteroid dehydrogenase; Provisional 99.92
PRK06179270 short chain dehydrogenase; Provisional 99.92
PRK07454241 short chain dehydrogenase; Provisional 99.92
PRK06198260 short chain dehydrogenase; Provisional 99.92
PRK12746254 short chain dehydrogenase; Provisional 99.92
PRK07792306 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.92
PRK06196315 oxidoreductase; Provisional 99.92
PRK07074257 short chain dehydrogenase; Provisional 99.92
PRK08267260 short chain dehydrogenase; Provisional 99.91
PRK05693274 short chain dehydrogenase; Provisional 99.91
PRK12744257 short chain dehydrogenase; Provisional 99.91
PRK06194287 hypothetical protein; Provisional 99.91
PRK07774250 short chain dehydrogenase; Provisional 99.91
PRK05854313 short chain dehydrogenase; Provisional 99.91
PRK09072263 short chain dehydrogenase; Provisional 99.91
PRK13394262 3-hydroxybutyrate dehydrogenase; Provisional 99.91
COG3967245 DltE Short-chain dehydrogenase involved in D-alani 99.91
PRK06924251 short chain dehydrogenase; Provisional 99.91
PRK12745256 3-ketoacyl-(acyl-carrier-protein) reductase; Provi 99.91
PRK12429258 3-hydroxybutyrate dehydrogenase; Provisional 99.91
KOG1209289 consensus 1-Acyl dihydroxyacetone phosphate reduct 99.91
KOG1014312 consensus 17 beta-hydroxysteroid dehydrogenase typ 99.91
PRK07060245 short chain dehydrogenase; Provisional 99.91
PRK06181263 short chain dehydrogenase; Provisional 99.91
PRK09186256 flagellin modification protein A; Provisional 99.91
PRK05884223 short chain dehydrogenase; Provisional 99.91
COG0623259 FabI Enoyl-[acyl-carrier-protein] 99.91
PRK07023243 short chain dehydrogenase; Provisional 99.91
PRK06550235 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
PRK07666239 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.91
TIGR02632676 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alc 99.91
TIGR01289314 LPOR light-dependent protochlorophyllide reductase 99.91
PRK10538248 malonic semialdehyde reductase; Provisional 99.91
PRK09730247 putative NAD(P)-binding oxidoreductase; Provisiona 99.91
PRK07904253 short chain dehydrogenase; Provisional 99.9
PRK08251248 short chain dehydrogenase; Provisional 99.9
PRK06482276 short chain dehydrogenase; Provisional 99.9
PRK07775274 short chain dehydrogenase; Provisional 99.9
PRK08261450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.9
PRK05565247 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.9
PRK09134258 short chain dehydrogenase; Provisional 99.9
PRK08703239 short chain dehydrogenase; Provisional 99.9
PRK06077252 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.9
PRK07577234 short chain dehydrogenase; Provisional 99.9
TIGR01830239 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) re 99.9
PRK06101240 short chain dehydrogenase; Provisional 99.89
PRK12827249 short chain dehydrogenase; Provisional 99.89
PRK06197306 short chain dehydrogenase; Provisional 99.89
PRK08945247 putative oxoacyl-(acyl carrier protein) reductase; 99.89
PRK07102243 short chain dehydrogenase; Provisional 99.89
PRK07201657 short chain dehydrogenase; Provisional 99.89
PRK12826251 3-ketoacyl-(acyl-carrier-protein) reductase; Revie 99.89
PRK05557248 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.89
PRK08177225 short chain dehydrogenase; Provisional 99.89
PRK08324681 short chain dehydrogenase; Validated 99.89
PRK07578199 short chain dehydrogenase; Provisional 99.89
KOG1611249 consensus Predicted short chain-type dehydrogenase 99.89
PRK05653246 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.88
PRK12829264 short chain dehydrogenase; Provisional 99.88
PRK07326237 short chain dehydrogenase; Provisional 99.88
PRK09135249 pteridine reductase; Provisional 99.88
COG1028251 FabG Dehydrogenases with different specificities ( 99.88
PRK07453322 protochlorophyllide oxidoreductase; Validated 99.88
PRK09291257 short chain dehydrogenase; Provisional 99.88
PF00106167 adh_short: short chain dehydrogenase alcohol dehyd 99.87
TIGR01963255 PHB_DH 3-hydroxybutyrate dehydrogenase. This model 99.86
PRK12828239 short chain dehydrogenase; Provisional 99.86
PRK07806248 short chain dehydrogenase; Provisional 99.86
KOG1210331 consensus Predicted 3-ketosphinganine reductase [S 99.86
KOG1208314 consensus Dehydrogenases with different specificit 99.86
PRK12825249 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.86
PRK08264238 short chain dehydrogenase; Validated 99.85
PRK09009235 C factor cell-cell signaling protein; Provisional 99.85
PRK06953222 short chain dehydrogenase; Provisional 99.83
PRK05786238 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 99.83
PRK08017256 oxidoreductase; Provisional 99.83
KOG1204253 consensus Predicted dehydrogenase [Secondary metab 99.82
PRK08219227 short chain dehydrogenase; Provisional 99.8
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 99.78
PRK12367245 short chain dehydrogenase; Provisional 99.71
smart00822180 PKS_KR This enzymatic domain is part of bacterial 99.68
PF08659181 KR: KR domain; InterPro: IPR013968 This domain is 99.64
PRK13656398 trans-2-enoyl-CoA reductase; Provisional 99.61
PRK07424406 bifunctional sterol desaturase/short chain dehydro 99.59
TIGR03589 324 PseB UDP-N-acetylglucosamine 4,6-dehydratase. This 99.57
TIGR02622 349 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase. Member 99.53
PLN03209 576 translocon at the inner envelope of chloroplast su 99.45
PLN02989325 cinnamyl-alcohol dehydrogenase family protein 99.43
KOG1478341 consensus 3-keto sterol reductase [Lipid transport 99.38
PLN02896 353 cinnamyl-alcohol dehydrogenase 99.38
KOG1502327 consensus Flavonol reductase/cinnamoyl-CoA reducta 99.36
PLN02986322 cinnamyl-alcohol dehydrogenase family protein 99.35
PLN00198 338 anthocyanidin reductase; Provisional 99.34
PLN02650 351 dihydroflavonol-4-reductase 99.3
PLN02572 442 UDP-sulfoquinovose synthase 99.27
COG1087 329 GalE UDP-glucose 4-epimerase [Cell envelope biogen 99.25
PLN02214 342 cinnamoyl-CoA reductase 99.25
PRK10217 355 dTDP-glucose 4,6-dehydratase; Provisional 99.22
PLN02583297 cinnamoyl-CoA reductase 99.21
PLN02686367 cinnamoyl-CoA reductase 99.2
PLN02662322 cinnamyl-alcohol dehydrogenase family protein 99.19
PRK06720169 hypothetical protein; Provisional 99.18
TIGR01181 317 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase. This 99.17
TIGR01179 328 galE UDP-glucose-4-epimerase. This enzyme intercon 99.15
PRK10675 338 UDP-galactose-4-epimerase; Provisional 99.15
TIGR01472 343 gmd GDP-mannose 4,6-dehydratase. Excluded from thi 99.13
PRK15181 348 Vi polysaccharide biosynthesis protein TviC; Provi 99.1
PLN02240 352 UDP-glucose 4-epimerase 99.1
PLN02653 340 GDP-mannose 4,6-dehydratase 99.08
PLN02427 386 UDP-apiose/xylose synthase 99.08
COG1088 340 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope 99.06
PF01073280 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/iso 99.05
TIGR03466 328 HpnA hopanoid-associated sugar epimerase. The sequ 99.05
PRK10084 352 dTDP-glucose 4,6 dehydratase; Provisional 99.02
PF02719293 Polysacc_synt_2: Polysaccharide biosynthesis prote 98.99
PLN00141251 Tic62-NAD(P)-related group II protein; Provisional 98.97
PF01370236 Epimerase: NAD dependent epimerase/dehydratase fam 98.96
COG1086 588 Predicted nucleoside-diphosphate sugar epimerases 98.89
PRK11908 347 NAD-dependent epimerase/dehydratase family protein 98.84
PRK08125 660 bifunctional UDP-glucuronic acid decarboxylase/UDP 98.82
TIGR01746 367 Thioester-redct thioester reductase domain. It has 98.81
KOG1371 343 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovo 98.77
PRK11150 308 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Pro 98.77
PLN02260 668 probable rhamnose biosynthetic enzyme 98.76
PLN02695 370 GDP-D-mannose-3',5'-epimerase 98.76
KOG4022236 consensus Dihydropteridine reductase DHPR/QDPR [Am 98.74
PF08643299 DUF1776: Fungal family of unknown function (DUF177 98.74
PLN02657 390 3,8-divinyl protochlorophyllide a 8-vinyl reductas 98.73
TIGR01214 287 rmlD dTDP-4-dehydrorhamnose reductase. This enzyme 98.68
PF07993249 NAD_binding_4: Male sterility protein; InterPro: I 98.67
PLN02725 306 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductas 98.66
PLN02166 436 dTDP-glucose 4,6-dehydratase 98.61
COG0451 314 WcaG Nucleoside-diphosphate-sugar epimerases [Cell 98.6
TIGR02197 314 heptose_epim ADP-L-glycero-D-manno-heptose-6-epime 98.57
CHL00194 317 ycf39 Ycf39; Provisional 98.55
PLN02206 442 UDP-glucuronate decarboxylase 98.54
PF13460183 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X 98.48
PRK09987 299 dTDP-4-dehydrorhamnose reductase; Provisional 98.47
COG3320 382 Putative dehydrogenase domain of multifunctional n 98.4
COG1091281 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelo 98.34
TIGR02114227 coaB_strep phosphopantothenate--cysteine ligase, s 98.32
KOG0747 331 consensus Putative NAD+-dependent epimerases [Carb 98.31
PRK07201 657 short chain dehydrogenase; Provisional 98.29
PRK05865 854 hypothetical protein; Provisional 98.11
COG1089 345 Gmd GDP-D-mannose dehydratase [Cell envelope bioge 98.1
PF04321286 RmlD_sub_bind: RmlD substrate binding domain; Inte 98.07
PRK08309177 short chain dehydrogenase; Provisional 98.05
KOG1429 350 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuro 97.92
KOG1430 361 consensus C-3 sterol dehydrogenase/3-beta-hydroxys 97.89
PLN02996 491 fatty acyl-CoA reductase 97.87
PLN02260668 probable rhamnose biosynthetic enzyme 97.86
PLN02778298 3,5-epimerase/4-reductase 97.76
KOG1202 2376 consensus Animal-type fatty acid synthase and rela 97.74
TIGR03443 1389 alpha_am_amid L-aminoadipate-semialdehyde dehydrog 97.73
TIGR03649 285 ergot_EASG ergot alkaloid biosynthesis protein, AF 97.63
PLN00016 378 RNA-binding protein; Provisional 97.39
TIGR01777 292 yfcH conserved hypothetical protein TIGR01777. Thi 97.15
PLN02503 605 fatty acyl-CoA reductase 2 97.09
PRK06732229 phosphopantothenate--cysteine ligase; Validated 97.07
PRK08261 450 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; 96.93
COG1748 389 LYS9 Saccharopine dehydrogenase and related protei 96.79
PF03435 386 Saccharop_dh: Saccharopine dehydrogenase ; InterPr 96.73
COG1090297 Predicted nucleoside-diphosphate sugar epimerase [ 96.72
PF05368233 NmrA: NmrA-like family; InterPro: IPR008030 NmrA i 96.59
KOG2733 423 consensus Uncharacterized membrane protein [Functi 96.33
KOG1431 315 consensus GDP-L-fucose synthetase [Carbohydrate tr 96.3
KOG2865 391 consensus NADH:ubiquinone oxidoreductase, NDUFA9/3 96.25
PRK12320 699 hypothetical protein; Provisional 96.18
PRK05579399 bifunctional phosphopantothenoylcysteine decarboxy 96.04
cd01078194 NAD_bind_H4MPT_DH NADP binding domain of methylene 95.68
PRK12548289 shikimate 5-dehydrogenase; Provisional 95.65
COG4982 866 3-oxoacyl-[acyl-carrier protein] 95.42
KOG1372 376 consensus GDP-mannose 4,6 dehydratase [Carbohydrat 95.03
COG2910211 Putative NADH-flavin reductase [General function p 94.6
COG0702275 Predicted nucleoside-diphosphate-sugar epimerases 94.45
KOG1203 411 consensus Predicted dehydrogenase [Carbohydrate tr 94.14
TIGR00521390 coaBC_dfp phosphopantothenoylcysteine decarboxylas 93.53
KOG1221 467 consensus Acyl-CoA reductase [Lipid transport and 91.44
PF01488135 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; 91.24
COG3268 382 Uncharacterized conserved protein [Function unknow 90.97
KOG4288283 consensus Predicted oxidoreductase [General functi 90.85
COG0569225 TrkA K+ transport systems, NAD-binding component [ 89.66
PRK09620229 hypothetical protein; Provisional 89.55
cd08253325 zeta_crystallin Zeta-crystallin with NADP-dependen 89.45
TIGR02813 2582 omega_3_PfaA polyketide-type polyunsaturated fatty 88.99
PF00107130 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: 88.74
PF06962140 rRNA_methylase: Putative rRNA methylase; InterPro: 88.39
TIGR00518370 alaDH alanine dehydrogenase. The family of known L 85.88
PRK14106 450 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate syn 84.17
PF02254116 TrkA_N: TrkA-N domain; InterPro: IPR003148 The reg 82.19
PLN02819 1042 lysine-ketoglutarate reductase/saccharopine dehydr 81.37
PF03848192 TehB: Tellurite resistance protein TehB; InterPro: 81.21
>KOG1200 consensus Mitochondrial/plastidial beta-ketoacyl-ACP reductase [Lipid transport and metabolism] Back     alignment and domain information
Probab=100.00  E-value=6.3e-36  Score=206.70  Aligned_cols=173  Identities=22%  Similarity=0.259  Sum_probs=158.3

Q ss_pred             cccCCCEEEEeecchHHHHHHHhHcCCCCceEEEeeecCChhHHHHHHHh--cccCCccEEEEcccccCCCCCCcccCCH
Q 042200            2 FIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDF--TKFGKLDIMFNNAGIISNMDRTTLDTDN   79 (181)
Q Consensus         2 l~~~G~~Vv~~~r~~~~~~~~~~~~~~~~~~~~~~~D~~~~~~i~~~~~~--~~~~~id~vi~~ag~~~~~~~~~~~~~~   79 (181)
                      |+++|++|++++++....+++...+.+-+....+.||+++.++++..+++  +.++.+++||||||+...  ..+..+..
T Consensus        34 la~~Garv~v~dl~~~~A~ata~~L~g~~~h~aF~~DVS~a~~v~~~l~e~~k~~g~psvlVncAGItrD--~~Llrmkq  111 (256)
T KOG1200|consen   34 LAKKGARVAVADLDSAAAEATAGDLGGYGDHSAFSCDVSKAHDVQNTLEEMEKSLGTPSVLVNCAGITRD--GLLLRMKQ  111 (256)
T ss_pred             HHhcCcEEEEeecchhhHHHHHhhcCCCCccceeeeccCcHHHHHHHHHHHHHhcCCCcEEEEcCccccc--cceeeccH
Confidence            68999999999999999999988887655788899999999999999999  788999999999999988  88889999


Q ss_pred             HHHHHhhheeec-------------------ceeEEEeccccccccCccchhhHhhHHHHHHHHHHHHHHhcCCCeEEEE
Q 042200           80 EKVKRVMIMVVF-------------------LGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNS  140 (181)
Q Consensus        80 ~~~~~~~~~n~~-------------------~~~iv~iss~~~~~~~~~~~~y~~sK~a~~~l~~~la~~~~~~~i~v~~  140 (181)
                      ++|+..+.+|+.                   ..+||++||+.+..+.-++..|+++|+.+.+|+|+.++|+++++||||.
T Consensus       112 ~qwd~vi~vNL~gvfl~tqaa~r~~~~~~~~~~sIiNvsSIVGkiGN~GQtnYAAsK~GvIgftktaArEla~knIrvN~  191 (256)
T KOG1200|consen  112 EQWDSVIAVNLTGVFLVTQAAVRAMVMNQQQGLSIINVSSIVGKIGNFGQTNYAASKGGVIGFTKTAARELARKNIRVNV  191 (256)
T ss_pred             HHHHHHHHhhchhhHHHHHHHHHHHHHhcCCCceEEeehhhhcccccccchhhhhhcCceeeeeHHHHHHHhhcCceEeE
Confidence            999999999999                   3499999999999999999999999999999999999999999999999


Q ss_pred             EecCcccCcccchhcCCChHHHHHHHHHhhcccccccccCC
Q 042200          141 IAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVLKAAD  181 (181)
Q Consensus       141 i~Pg~v~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e  181 (181)
                      +.||+|.|||+..++   +.-+++...-+  ||+|++++||
T Consensus       192 VlPGFI~tpMT~~mp---~~v~~ki~~~i--Pmgr~G~~Ee  227 (256)
T KOG1200|consen  192 VLPGFIATPMTEAMP---PKVLDKILGMI--PMGRLGEAEE  227 (256)
T ss_pred             eccccccChhhhhcC---HHHHHHHHccC--CccccCCHHH
Confidence            999999999998874   45566666666  9999999986



>PF13561 adh_short_C2: Enoyl-(Acyl carrier protein) reductase; PDB: 2UV8_B 3HMJ_A 2VKZ_C 1O5I_A 2P91_C 2OP0_A 2OL4_B 1NHW_A 1NNU_B 2O2Y_B Back     alignment and domain information
>PRK06079 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08339 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG4221 Short-chain alcohol dehydrogenase of unknown specificity [General function prediction only] Back     alignment and domain information
>PRK06505 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06603 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08690 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK08415 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07984 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK12481 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>COG0300 DltE Short-chain dehydrogenases of various substrate specificities [General function prediction only] Back     alignment and domain information
>PRK07370 enoyl-(acyl carrier protein) reductase; Validated Back     alignment and domain information
>PRK08594 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07533 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07063 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG0725 consensus Reductases with broad range of substrate specificities [General function prediction only] Back     alignment and domain information
>PRK08340 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK08159 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06997 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05867 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08589 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07478 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08085 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>KOG1207 consensus Diacetyl reductase/L-xylulose reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08416 7-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>KOG1205 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08265 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06114 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07062 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07889 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05872 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06172 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN02730 enoyl-[acyl-carrier-protein] reductase Back     alignment and domain information
>PRK08277 D-mannonate oxidoreductase; Provisional Back     alignment and domain information
>PRK08993 2-deoxy-D-gluconate 3-dehydrogenase; Validated Back     alignment and domain information
>PRK06935 2-deoxy-D-gluconate 3-dehydrogenase; Provisional Back     alignment and domain information
>PRK07831 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06200 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase; Provisional Back     alignment and domain information
>PRK07035 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07677 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07523 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08643 acetoin reductase; Validated Back     alignment and domain information
>PRK08303 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07097 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK12747 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1201 consensus Hydroxysteroid 17-beta dehydrogenase 11 [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK07985 oxidoreductase; Provisional Back     alignment and domain information
>PRK09242 tropinone reductase; Provisional Back     alignment and domain information
>TIGR01500 sepiapter_red sepiapterin reductase Back     alignment and domain information
>PRK06125 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06128 oxidoreductase; Provisional Back     alignment and domain information
>PRK06940 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07791 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03325 BphB_TodD cis-2,3-dihydrobiphenyl-2,3-diol dehydrogenase Back     alignment and domain information
>PRK08936 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>TIGR01832 kduD 2-deoxy-D-gluconate 3-dehydrogenase Back     alignment and domain information
>PRK06113 7-alpha-hydroxysteroid dehydrogenase; Validated Back     alignment and domain information
>PRK07067 sorbitol dehydrogenase; Provisional Back     alignment and domain information
>PRK12859 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06463 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06398 aldose dehydrogenase; Validated Back     alignment and domain information
>TIGR01831 fabG_rel 3-oxoacyl-(acyl-carrier-protein) reductase, putative Back     alignment and domain information
>PRK12743 oxidoreductase; Provisional Back     alignment and domain information
>PRK06124 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK06139 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07856 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05876 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02415 23BDH acetoin reductases Back     alignment and domain information
>PRK06484 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05599 hypothetical protein; Provisional Back     alignment and domain information
>PRK08226 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06841 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08862 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07890 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06300 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK05855 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK06483 dihydromonapterin reductase; Provisional Back     alignment and domain information
>PLN02253 xanthoxin dehydrogenase Back     alignment and domain information
>PRK06500 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12823 benD 1,6-dihydroxycyclohexa-2,4-diene-1-carboxylate dehydrogenase; Provisional Back     alignment and domain information
>PRK06949 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07814 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1199 consensus Short-chain alcohol dehydrogenase/3-hydroxyacyl-CoA dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12384 sorbitol-6-phosphate dehydrogenase; Provisional Back     alignment and domain information
>PRK07069 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK05717 oxidoreductase; Validated Back     alignment and domain information
>PRK12938 acetyacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK06701 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07576 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08063 enoyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK06182 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07041 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08642 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06057 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06523 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08263 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08213 gluconate 5-dehydrogenase; Provisional Back     alignment and domain information
>PRK08628 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05650 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07231 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06171 sorbitol-6-phosphate 2-dehydrogenase; Provisional Back     alignment and domain information
>PRK12937 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12936 3-ketoacyl-(acyl-carrier-protein) reductase NodG; Reviewed Back     alignment and domain information
>PRK06123 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06180 short chain dehydrogenase; Provisional Back     alignment and domain information
>PLN00015 protochlorophyllide reductase Back     alignment and domain information
>PRK07024 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12939 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07832 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08278 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06947 glucose-1-dehydrogenase; Provisional Back     alignment and domain information
>PRK07109 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1610 consensus Corticosteroid 11-beta-dehydrogenase and related short chain-type dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism; General function prediction only] Back     alignment and domain information
>PRK05993 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR03206 benzo_BadH 2-hydroxycyclohexanecarboxyl-CoA dehydrogenase Back     alignment and domain information
>PRK06138 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12748 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12742 oxidoreductase; Provisional Back     alignment and domain information
>PLN02780 ketoreductase/ oxidoreductase Back     alignment and domain information
>PRK07825 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG4169 consensus 15-hydroxyprostaglandin dehydrogenase and related dehydrogenases [Lipid transport and metabolism; General function prediction only] Back     alignment and domain information
>PRK08220 2,3-dihydroxybenzoate-2,3-dehydrogenase; Validated Back     alignment and domain information
>PRK12824 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>TIGR01829 AcAcCoA_reduct acetoacetyl-CoA reductase Back     alignment and domain information
>TIGR02685 pter_reduc_Leis pteridine reductase Back     alignment and domain information
>PRK12935 acetoacetyl-CoA reductase; Provisional Back     alignment and domain information
>PRK05875 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06914 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08217 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05866 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12428 3-alpha-hydroxysteroid dehydrogenase; Provisional Back     alignment and domain information
>PRK06179 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07454 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06198 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12746 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07792 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK06196 oxidoreductase; Provisional Back     alignment and domain information
>PRK07074 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08267 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05693 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12744 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06194 hypothetical protein; Provisional Back     alignment and domain information
>PRK07774 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05854 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09072 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK13394 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>COG3967 DltE Short-chain dehydrogenase involved in D-alanine esterification of lipoteichoic acid and wall teichoic acid (D-alanine transfer protein) [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PRK06924 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12745 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK12429 3-hydroxybutyrate dehydrogenase; Provisional Back     alignment and domain information
>KOG1209 consensus 1-Acyl dihydroxyacetone phosphate reductase and related dehydrogenases [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1014 consensus 17 beta-hydroxysteroid dehydrogenase type 3, HSD17B3 [Lipid transport and metabolism] Back     alignment and domain information
>PRK07060 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06181 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09186 flagellin modification protein A; Provisional Back     alignment and domain information
>PRK05884 short chain dehydrogenase; Provisional Back     alignment and domain information
>COG0623 FabI Enoyl-[acyl-carrier-protein] Back     alignment and domain information
>PRK07023 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06550 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07666 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>TIGR02632 RhaD_aldol-ADH rhamnulose-1-phosphate aldolase/alcohol dehydrogenase Back     alignment and domain information
>TIGR01289 LPOR light-dependent protochlorophyllide reductase Back     alignment and domain information
>PRK10538 malonic semialdehyde reductase; Provisional Back     alignment and domain information
>PRK09730 putative NAD(P)-binding oxidoreductase; Provisional Back     alignment and domain information
>PRK07904 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08251 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06482 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07775 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK05565 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK09134 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08703 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06077 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK07577 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR01830 3oxo_ACP_reduc 3-oxoacyl-(acyl-carrier-protein) reductase Back     alignment and domain information
>PRK06101 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12827 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK06197 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08945 putative oxoacyl-(acyl carrier protein) reductase; Provisional Back     alignment and domain information
>PRK07102 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK12826 3-ketoacyl-(acyl-carrier-protein) reductase; Reviewed Back     alignment and domain information
>PRK05557 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK08177 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK08324 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK07578 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1611 consensus Predicted short chain-type dehydrogenase [General function prediction only] Back     alignment and domain information
>PRK05653 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Validated Back     alignment and domain information
>PRK12829 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07326 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK09135 pteridine reductase; Provisional Back     alignment and domain information
>COG1028 FabG Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport, and catabolism / General function prediction only] Back     alignment and domain information
>PRK07453 protochlorophyllide oxidoreductase; Validated Back     alignment and domain information
>PRK09291 short chain dehydrogenase; Provisional Back     alignment and domain information
>PF00106 adh_short: short chain dehydrogenase alcohol dehydrogenase superfamily signature glucose/ribitol dehydrogenase family signature; InterPro: IPR002198 The short-chain dehydrogenases/reductases family (SDR) [] is a very large family of enzymes, most of which are known to be NAD- or NADP-dependent oxidoreductases Back     alignment and domain information
>TIGR01963 PHB_DH 3-hydroxybutyrate dehydrogenase Back     alignment and domain information
>PRK12828 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK07806 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1210 consensus Predicted 3-ketosphinganine reductase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>KOG1208 consensus Dehydrogenases with different specificities (related to short-chain alcohol dehydrogenases) [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK12825 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08264 short chain dehydrogenase; Validated Back     alignment and domain information
>PRK09009 C factor cell-cell signaling protein; Provisional Back     alignment and domain information
>PRK06953 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05786 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>PRK08017 oxidoreductase; Provisional Back     alignment and domain information
>KOG1204 consensus Predicted dehydrogenase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>PRK08219 short chain dehydrogenase; Provisional Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PRK12367 short chain dehydrogenase; Provisional Back     alignment and domain information
>smart00822 PKS_KR This enzymatic domain is part of bacterial polyketide synthases and catalyses the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PF08659 KR: KR domain; InterPro: IPR013968 This domain is found in bacterial polyketide synthases that catalyse the first step in the reductive modification of the beta-carbonyl centres in the growing polyketide chain Back     alignment and domain information
>PRK13656 trans-2-enoyl-CoA reductase; Provisional Back     alignment and domain information
>PRK07424 bifunctional sterol desaturase/short chain dehydrogenase; Validated Back     alignment and domain information
>TIGR03589 PseB UDP-N-acetylglucosamine 4,6-dehydratase Back     alignment and domain information
>TIGR02622 CDP_4_6_dhtase CDP-glucose 4,6-dehydratase Back     alignment and domain information
>PLN03209 translocon at the inner envelope of chloroplast subunit 62; Provisional Back     alignment and domain information
>PLN02989 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>KOG1478 consensus 3-keto sterol reductase [Lipid transport and metabolism] Back     alignment and domain information
>PLN02896 cinnamyl-alcohol dehydrogenase Back     alignment and domain information
>KOG1502 consensus Flavonol reductase/cinnamoyl-CoA reductase [Defense mechanisms] Back     alignment and domain information
>PLN02986 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PLN00198 anthocyanidin reductase; Provisional Back     alignment and domain information
>PLN02650 dihydroflavonol-4-reductase Back     alignment and domain information
>PLN02572 UDP-sulfoquinovose synthase Back     alignment and domain information
>COG1087 GalE UDP-glucose 4-epimerase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PLN02214 cinnamoyl-CoA reductase Back     alignment and domain information
>PRK10217 dTDP-glucose 4,6-dehydratase; Provisional Back     alignment and domain information
>PLN02583 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02686 cinnamoyl-CoA reductase Back     alignment and domain information
>PLN02662 cinnamyl-alcohol dehydrogenase family protein Back     alignment and domain information
>PRK06720 hypothetical protein; Provisional Back     alignment and domain information
>TIGR01181 dTDP_gluc_dehyt dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>TIGR01179 galE UDP-glucose-4-epimerase Back     alignment and domain information
>PRK10675 UDP-galactose-4-epimerase; Provisional Back     alignment and domain information
>TIGR01472 gmd GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PRK15181 Vi polysaccharide biosynthesis protein TviC; Provisional Back     alignment and domain information
>PLN02240 UDP-glucose 4-epimerase Back     alignment and domain information
>PLN02653 GDP-mannose 4,6-dehydratase Back     alignment and domain information
>PLN02427 UDP-apiose/xylose synthase Back     alignment and domain information
>COG1088 RfbB dTDP-D-glucose 4,6-dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF01073 3Beta_HSD: 3-beta hydroxysteroid dehydrogenase/isomerase family; InterPro: IPR002225 The enzyme 3 beta-hydroxysteroid dehydrogenase/5-ene-4-ene isomerase (3 beta-HSD) catalyses the oxidation and isomerisation of 5-ene-3 beta-hydroxypregnene and 5-ene-hydroxyandrostene steroid precursors into the corresponding 4-ene-ketosteroids necessary for the formation of all classes of steroid hormones Back     alignment and domain information
>TIGR03466 HpnA hopanoid-associated sugar epimerase Back     alignment and domain information
>PRK10084 dTDP-glucose 4,6 dehydratase; Provisional Back     alignment and domain information
>PF02719 Polysacc_synt_2: Polysaccharide biosynthesis protein; InterPro: IPR003869 This domain is found in diverse bacterial polysaccharide biosynthesis proteins including the CapD protein from Staphylococcus aureus [], the WalL protein, mannosyl-transferase [], and several putative epimerases Back     alignment and domain information
>PLN00141 Tic62-NAD(P)-related group II protein; Provisional Back     alignment and domain information
>PF01370 Epimerase: NAD dependent epimerase/dehydratase family; InterPro: IPR001509 This family of proteins utilise NAD as a cofactor Back     alignment and domain information
>COG1086 Predicted nucleoside-diphosphate sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK11908 NAD-dependent epimerase/dehydratase family protein; Provisional Back     alignment and domain information
>PRK08125 bifunctional UDP-glucuronic acid decarboxylase/UDP-4-amino-4-deoxy-L-arabinose formyltransferase; Validated Back     alignment and domain information
>TIGR01746 Thioester-redct thioester reductase domain Back     alignment and domain information
>KOG1371 consensus UDP-glucose 4-epimerase/UDP-sulfoquinovose synthase [Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>PRK11150 rfaD ADP-L-glycero-D-mannoheptose-6-epimerase; Provisional Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02695 GDP-D-mannose-3',5'-epimerase Back     alignment and domain information
>KOG4022 consensus Dihydropteridine reductase DHPR/QDPR [Amino acid transport and metabolism] Back     alignment and domain information
>PF08643 DUF1776: Fungal family of unknown function (DUF1776); InterPro: IPR013952 This is a fungal protein of unknown function Back     alignment and domain information
>PLN02657 3,8-divinyl protochlorophyllide a 8-vinyl reductase Back     alignment and domain information
>TIGR01214 rmlD dTDP-4-dehydrorhamnose reductase Back     alignment and domain information
>PF07993 NAD_binding_4: Male sterility protein; InterPro: IPR013120 This family represents the C-terminal NAD-binding region of the male sterility protein from Arabidopsis and Drosophila Back     alignment and domain information
>PLN02725 GDP-4-keto-6-deoxymannose-3,5-epimerase-4-reductase Back     alignment and domain information
>PLN02166 dTDP-glucose 4,6-dehydratase Back     alignment and domain information
>COG0451 WcaG Nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR02197 heptose_epim ADP-L-glycero-D-manno-heptose-6-epimerase Back     alignment and domain information
>CHL00194 ycf39 Ycf39; Provisional Back     alignment and domain information
>PLN02206 UDP-glucuronate decarboxylase Back     alignment and domain information
>PF13460 NAD_binding_10: NADH(P)-binding ; PDB: 3OH8_A 3E8X_A 3GPI_A 3QVO_A 2Q46_B 1YBM_B 1XQ6_B 2Q4B_B 3EW7_A 3IUS_B Back     alignment and domain information
>PRK09987 dTDP-4-dehydrorhamnose reductase; Provisional Back     alignment and domain information
>COG3320 Putative dehydrogenase domain of multifunctional non-ribosomal peptide synthetases and related enzymes [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>COG1091 RfbD dTDP-4-dehydrorhamnose reductase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR02114 coaB_strep phosphopantothenate--cysteine ligase, streptococcal Back     alignment and domain information
>KOG0747 consensus Putative NAD+-dependent epimerases [Carbohydrate transport and metabolism] Back     alignment and domain information
>PRK07201 short chain dehydrogenase; Provisional Back     alignment and domain information
>PRK05865 hypothetical protein; Provisional Back     alignment and domain information
>COG1089 Gmd GDP-D-mannose dehydratase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>PF04321 RmlD_sub_bind: RmlD substrate binding domain; InterPro: IPR005913 dTDP-4-dehydrorhamnose reductase (1 Back     alignment and domain information
>PRK08309 short chain dehydrogenase; Provisional Back     alignment and domain information
>KOG1429 consensus dTDP-glucose 4-6-dehydratase/UDP-glucuronic acid decarboxylase [Carbohydrate transport and metabolism; Cell wall/membrane/envelope biogenesis] Back     alignment and domain information
>KOG1430 consensus C-3 sterol dehydrogenase/3-beta-hydroxysteroid dehydrogenase and related dehydrogenases [Lipid transport and metabolism; Amino acid transport and metabolism] Back     alignment and domain information
>PLN02996 fatty acyl-CoA reductase Back     alignment and domain information
>PLN02260 probable rhamnose biosynthetic enzyme Back     alignment and domain information
>PLN02778 3,5-epimerase/4-reductase Back     alignment and domain information
>KOG1202 consensus Animal-type fatty acid synthase and related proteins [Lipid transport and metabolism] Back     alignment and domain information
>TIGR03443 alpha_am_amid L-aminoadipate-semialdehyde dehydrogenase Back     alignment and domain information
>TIGR03649 ergot_EASG ergot alkaloid biosynthesis protein, AFUA_2G17970 family Back     alignment and domain information
>PLN00016 RNA-binding protein; Provisional Back     alignment and domain information
>TIGR01777 yfcH conserved hypothetical protein TIGR01777 Back     alignment and domain information
>PLN02503 fatty acyl-CoA reductase 2 Back     alignment and domain information
>PRK06732 phosphopantothenate--cysteine ligase; Validated Back     alignment and domain information
>PRK08261 fabG 3-ketoacyl-(acyl-carrier-protein) reductase; Provisional Back     alignment and domain information
>COG1748 LYS9 Saccharopine dehydrogenase and related proteins [Amino acid transport and metabolism] Back     alignment and domain information
>PF03435 Saccharop_dh: Saccharopine dehydrogenase ; InterPro: IPR005097 This entry represents saccharopine dehydrogenase and homospermidine synthase Back     alignment and domain information
>COG1090 Predicted nucleoside-diphosphate sugar epimerase [General function prediction only] Back     alignment and domain information
>PF05368 NmrA: NmrA-like family; InterPro: IPR008030 NmrA is a negative transcriptional regulator involved in the post-translational modification of the transcription factor AreA Back     alignment and domain information
>KOG2733 consensus Uncharacterized membrane protein [Function unknown] Back     alignment and domain information
>KOG1431 consensus GDP-L-fucose synthetase [Carbohydrate transport and metabolism; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2865 consensus NADH:ubiquinone oxidoreductase, NDUFA9/39kDa subunit [Energy production and conversion] Back     alignment and domain information
>PRK12320 hypothetical protein; Provisional Back     alignment and domain information
>PRK05579 bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate synthase; Validated Back     alignment and domain information
>cd01078 NAD_bind_H4MPT_DH NADP binding domain of methylene tetrahydromethanopterin dehydrogenase Back     alignment and domain information
>PRK12548 shikimate 5-dehydrogenase; Provisional Back     alignment and domain information
>COG4982 3-oxoacyl-[acyl-carrier protein] Back     alignment and domain information
>KOG1372 consensus GDP-mannose 4,6 dehydratase [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2910 Putative NADH-flavin reductase [General function prediction only] Back     alignment and domain information
>COG0702 Predicted nucleoside-diphosphate-sugar epimerases [Cell envelope biogenesis, outer membrane / Carbohydrate transport and metabolism] Back     alignment and domain information
>KOG1203 consensus Predicted dehydrogenase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR00521 coaBC_dfp phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase, prokaryotic Back     alignment and domain information
>KOG1221 consensus Acyl-CoA reductase [Lipid transport and metabolism] Back     alignment and domain information
>PF01488 Shikimate_DH: Shikimate / quinate 5-dehydrogenase; InterPro: IPR006151 This entry represents a domain found in shikimate and quinate dehydrogenases, as well as glutamyl-tRNA reductases Back     alignment and domain information
>COG3268 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>KOG4288 consensus Predicted oxidoreductase [General function prediction only] Back     alignment and domain information
>COG0569 TrkA K+ transport systems, NAD-binding component [Inorganic ion transport and metabolism] Back     alignment and domain information
>PRK09620 hypothetical protein; Provisional Back     alignment and domain information
>cd08253 zeta_crystallin Zeta-crystallin with NADP-dependent quinone reductase activity (QOR) Back     alignment and domain information
>TIGR02813 omega_3_PfaA polyketide-type polyunsaturated fatty acid synthase PfaA Back     alignment and domain information
>PF00107 ADH_zinc_N: Zinc-binding dehydrogenase; InterPro: IPR013149 Alcohol dehydrogenase (1 Back     alignment and domain information
>PF06962 rRNA_methylase: Putative rRNA methylase; InterPro: IPR010719 This family contains a number of putative rRNA methylases Back     alignment and domain information
>TIGR00518 alaDH alanine dehydrogenase Back     alignment and domain information
>PRK14106 murD UDP-N-acetylmuramoyl-L-alanyl-D-glutamate synthetase; Provisional Back     alignment and domain information
>PF02254 TrkA_N: TrkA-N domain; InterPro: IPR003148 The regulator of K+ conductance (RCK) domain is found in many ligand-gated K+ channels, most often attached to the intracellular carboxy terminus Back     alignment and domain information
>PLN02819 lysine-ketoglutarate reductase/saccharopine dehydrogenase Back     alignment and domain information
>PF03848 TehB: Tellurite resistance protein TehB; InterPro: IPR015985 Tellurite resistance protein TehB is part of a tellurite-reducing operon tehA and tehB Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
2bgk_A278 X-Ray Structure Of Apo-Secoisolariciresinol Dehydro 2e-37
3tox_A280 Crystal Structure Of A Short Chain Dehydrogenase In 2e-10
2hsd_A253 The Refined Three-Dimensional Structure Of 3alpha,2 8e-10
1hdc_A254 Mechanism Of Inhibition Of 3alpha,20beta-Hydroxyste 8e-10
1iy8_A267 Crystal Structure Of Levodione Reductase Length = 2 1e-09
1nff_A260 Crystal Structure Of Rv2002 Gene Product From Mycob 1e-08
1nfr_A260 Rv2002 Gene Product From Mycobacterium Tuberculosis 3e-08
1yde_A270 Crystal Structure Of Human Retinal Short-Chain Dehy 4e-08
3uve_A286 Crystal Structure Of Carveol Dehydrogenase ((+)-Tra 4e-08
3t7c_A299 Crystal Structure Of Carveol Dehydrogenase From Myc 8e-08
1spx_A278 Crystal Structure Of Glucose Dehydrogenase Of Caeno 6e-07
3r1i_A276 Crystal Structure Of A Short-Chain Type Dehydrogena 1e-06
1zjy_A251 Structure Of R-Specific Alcohol Dehydrogenase (Muta 4e-06
4dqx_A277 Crystal Structure Of A Short Chain Dehydrogenase Fr 5e-06
3n74_A261 Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Prote 9e-06
1ahi_A255 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With 1e-05
3qiv_A253 Crystal Structure Of A Putative Short-Chain Dehydro 1e-05
4e4y_A244 The Crystal Structure Of A Short Chain Dehydrogenas 2e-05
1rwb_A261 Cooperative Effect Of Two Surface Amino Acid Mutati 2e-05
1uls_A245 Crystal Structure Of Tt0140 From Thermus Thermophil 2e-05
1nxq_A251 Crystal Structure Of R-Alcohol Dehydrogenase (Radh) 2e-05
2wd7_A268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 3e-05
1g6k_A261 Crystal Structure Of Glucose Dehydrogenase Mutant E 3e-05
2wd7_B268 Pteridine Reductase 1 (Ptr1) From Trypanosoma Bruce 3e-05
3bmc_B288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 4e-05
3jq7_B288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 4e-05
3bmc_A288 Structure Of Pteridine Reductase 1 (Ptr1) From Tryp 4e-05
2c7v_A268 Structure Of Trypanosoma Brucei Pteridine Reductase 4e-05
3ucx_A264 The Structure Of A Short Chain Dehydrogenase From M 5e-05
3jq7_A288 Crystal Structure Of Pteridine Reductase 1 (Ptr1) F 5e-05
1gco_A261 Crystal Structure Of Glucose Dehydrogenase Complexe 5e-05
1gee_A261 Crystal Structure Of Glucose Dehydrogenase Mutant Q 6e-05
2cfc_A250 Structural Basis For Stereo Selectivity In The (R)- 6e-05
2et6_A604 (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candid 1e-04
3o4r_A261 Crystal Structure Of Human DehydrogenaseREDUCTASE ( 1e-04
1xhl_A297 Crystal Structure Of Putative Tropinone Reductase-I 1e-04
3uwr_A286 Crystal Structure Of Carveol Dehydrogenase From Myc 2e-04
3oec_A317 Crystal Structure Of Carveol Dehydrogenase From Myc 2e-04
3pgx_A280 Crystal Structure Of A Putative Carveol Dehydrogena 2e-04
1zem_A262 Crystal Structure Of Nad+-Bound Xylitol Dehydrogena 3e-04
4fc6_A277 Studies On Dcr Shed New Light On Peroxisomal Beta-O 3e-04
2zat_A260 Crystal Structure Of A Mammalian Reductase Length = 3e-04
1k2w_A256 Crystal Structure Of Sorbitol Dehydrogenase From R. 4e-04
3tsc_A277 Crystal Structure Of Short Chain Dehydrogenase Map_ 5e-04
3ay7_A269 Crystal Structure Of Bacillus Megaterium Glucose De 5e-04
3aus_A269 Crystal Structure Of Bacillus Megaterium Glucose De 5e-04
3gaf_A256 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid De 5e-04
3ay6_A269 Crystal Structure Of Bacillus Megaterium Glucose De 5e-04
>pdb|2BGK|A Chain A, X-Ray Structure Of Apo-Secoisolariciresinol Dehydrogenase Length = 278 Back     alignment and structure

Iteration: 1

Score = 151 bits (381), Expect = 2e-37, Method: Compositional matrix adjust. Identities = 80/201 (39%), Positives = 123/201 (61%), Gaps = 20/201 (9%) Query: 1 VFIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFT--KFGKLD 58 +F+++ AKV+IAD+ DD + +C S ++IS+V C+VT D DV+N+ D T K GKLD Sbjct: 35 LFVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLD 94 Query: 59 IMFNNAGIISNMDRTTLDTDNEKVKRVMIMVVF-----------------LGVLLFTANL 101 IMF N G++S + L+ NE KRVM + V+ G ++FTA++ Sbjct: 95 IMFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASI 154 Query: 102 ATETIGEAL-YDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKK 160 ++ T GE + + Y +K+AVLGL +LC ELG+Y IRVN ++ + A+P + G+D Sbjct: 155 SSFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSS 214 Query: 161 TFKELLYASANLKGVVLKAAD 181 +EL + +ANLKG +L+A D Sbjct: 215 RVEELAHQAANLKGTLLRAED 235
>pdb|3TOX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase In Complex With Nad(P) From Sinorhizobium Meliloti 1021 Length = 280 Back     alignment and structure
>pdb|2HSD|A Chain A, The Refined Three-Dimensional Structure Of 3alpha,20beta- Hydroxysteroid Dehydrogenase And Possible Roles Of The Residues Conserved In Short-Chain Dehydrogenases Length = 253 Back     alignment and structure
>pdb|1HDC|A Chain A, Mechanism Of Inhibition Of 3alpha,20beta-Hydroxysteroid Dehydrogenase By A Licorice-Derived Steroidal Inhibitor Length = 254 Back     alignment and structure
>pdb|1IY8|A Chain A, Crystal Structure Of Levodione Reductase Length = 267 Back     alignment and structure
>pdb|1NFF|A Chain A, Crystal Structure Of Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|1NFR|A Chain A, Rv2002 Gene Product From Mycobacterium Tuberculosis Length = 260 Back     alignment and structure
>pdb|1YDE|A Chain A, Crystal Structure Of Human Retinal Short-Chain DehydrogenaseREDUCTASE 3 Length = 270 Back     alignment and structure
>pdb|3UVE|A Chain A, Crystal Structure Of Carveol Dehydrogenase ((+)-Trans-Carveol Dehydrogenase) From Mycobacterium Avium Length = 286 Back     alignment and structure
>pdb|3T7C|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Bound To Nad Length = 299 Back     alignment and structure
>pdb|1SPX|A Chain A, Crystal Structure Of Glucose Dehydrogenase Of Caenorhabditis Elegans In The Apo-Form Length = 278 Back     alignment and structure
>pdb|3R1I|A Chain A, Crystal Structure Of A Short-Chain Type DehydrogenaseREDUCTASE FROM Mycobacterium Marinum Length = 276 Back     alignment and structure
>pdb|1ZJY|A Chain A, Structure Of R-Specific Alcohol Dehydrogenase (Mutant G37d) From Lactobacillus Brevis In Complex With Phenylethanol And Nadh Length = 251 Back     alignment and structure
>pdb|4DQX|A Chain A, Crystal Structure Of A Short Chain Dehydrogenase From Rhizobium Etli Cfn 42 Length = 277 Back     alignment and structure
>pdb|3N74|A Chain A, Crystal Structure Of 3-Ketoacyl-(Acyl-Carrier-Protein) Reduc Brucella Melitensis Length = 261 Back     alignment and structure
>pdb|1AHI|A Chain A, 7 Alpha-Hydroxysteroid Dehydrogenase Complexed With Nadh And 7-Oxo Glycochenodeoxycholic Acid Length = 255 Back     alignment and structure
>pdb|3QIV|A Chain A, Crystal Structure Of A Putative Short-Chain Dehydrogenase Or 3- Oxoacyl-[acyl-Carrier-Protein] Reductase From Mycobacterium Paratuberculosis Atcc Baa-968 K-10 Length = 253 Back     alignment and structure
>pdb|4E4Y|A Chain A, The Crystal Structure Of A Short Chain Dehydrogenase Family Protein From Francisella Tularensis Subsp. Tularensis Schu S4 Length = 244 Back     alignment and structure
>pdb|1RWB|A Chain A, Cooperative Effect Of Two Surface Amino Acid Mutations (Q252l And E170k) Of Glucose Dehydrogenase From Bacillus Megaterium Iwg3 For The Stabilization Of Oligomeric State Length = 261 Back     alignment and structure
>pdb|1ULS|A Chain A, Crystal Structure Of Tt0140 From Thermus Thermophilus Hb8 Length = 245 Back     alignment and structure
>pdb|1NXQ|A Chain A, Crystal Structure Of R-Alcohol Dehydrogenase (Radh) (Apoenyzme) From Lactobacillus Brevis Length = 251 Back     alignment and structure
>pdb|2WD7|A Chain A, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|1G6K|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant E96a Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|2WD7|B Chain B, Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Complex With Nadp And Ddd00066750 Length = 268 Back     alignment and structure
>pdb|3BMC|B Chain B, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|3JQ7|B Chain B, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|3BMC|A Chain A, Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Substrate (Folate) Length = 288 Back     alignment and structure
>pdb|2C7V|A Chain A, Structure Of Trypanosoma Brucei Pteridine Reductase (Ptr1) In Ternary Complex With Cofactor And The Antifolate Methotrexate Length = 268 Back     alignment and structure
>pdb|3UCX|A Chain A, The Structure Of A Short Chain Dehydrogenase From Mycobacterium Smegmatis Length = 264 Back     alignment and structure
>pdb|3JQ7|A Chain A, Crystal Structure Of Pteridine Reductase 1 (Ptr1) From Trypanosoma Brucei In Ternary Complex With Cofactor (Nadp+) And Inhibitor 6- Phenylpteridine-2,4,7-Triamine (Dx2) Length = 288 Back     alignment and structure
>pdb|1GCO|A Chain A, Crystal Structure Of Glucose Dehydrogenase Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|1GEE|A Chain A, Crystal Structure Of Glucose Dehydrogenase Mutant Q252l Complexed With Nad+ Length = 261 Back     alignment and structure
>pdb|2CFC|A Chain A, Structural Basis For Stereo Selectivity In The (R)- And (S)- Hydroxypropylethane Thiosulfonate Dehydrogenases Length = 250 Back     alignment and structure
>pdb|2ET6|A Chain A, (3r)-Hydroxyacyl-Coa Dehydrogenase Domain Of Candida Tropicalis Peroxisomal Multifunctional Enzyme Type 2 Length = 604 Back     alignment and structure
>pdb|3O4R|A Chain A, Crystal Structure Of Human DehydrogenaseREDUCTASE (SDR FAMILY) MEMBER 4 (Dhrs4) Length = 261 Back     alignment and structure
>pdb|1XHL|A Chain A, Crystal Structure Of Putative Tropinone Reductase-Ii From Caenorhabditis Elegans With Cofactor And Substrate Length = 297 Back     alignment and structure
>pdb|3UWR|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Avium Strain 104 Length = 286 Back     alignment and structure
>pdb|3OEC|A Chain A, Crystal Structure Of Carveol Dehydrogenase From Mycobacterium Thermoresistibile Length = 317 Back     alignment and structure
>pdb|3PGX|A Chain A, Crystal Structure Of A Putative Carveol Dehydrogenase From Mycobacterium Paratuberculosis Bound To Nicotinamide Adenine Dinucleotide Length = 280 Back     alignment and structure
>pdb|1ZEM|A Chain A, Crystal Structure Of Nad+-Bound Xylitol Dehydrogenase Length = 262 Back     alignment and structure
>pdb|4FC6|A Chain A, Studies On Dcr Shed New Light On Peroxisomal Beta-Oxidation: Crystal Structure Of The Ternary Complex Of Pdcr Length = 277 Back     alignment and structure
>pdb|2ZAT|A Chain A, Crystal Structure Of A Mammalian Reductase Length = 260 Back     alignment and structure
>pdb|1K2W|A Chain A, Crystal Structure Of Sorbitol Dehydrogenase From R. Sphaeroides Length = 256 Back     alignment and structure
>pdb|3TSC|A Chain A, Crystal Structure Of Short Chain Dehydrogenase Map_2410 From Mycobacterium Paratuberculosis Bound To Nad Length = 277 Back     alignment and structure
>pdb|3AY7|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 G259a Mutant Length = 269 Back     alignment and structure
>pdb|3AUS|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 In Ligand-Free Form Length = 269 Back     alignment and structure
>pdb|3GAF|A Chain A, 2.2a Crystal Structure Of 7-Alpha-Hydroxysteroid Dehydrogenase From Brucella Melitensis Length = 256 Back     alignment and structure
>pdb|3AY6|A Chain A, Crystal Structure Of Bacillus Megaterium Glucose Dehydrogenase 4 A258f Mutant In Complex With Nadh And D-Glucose Length = 269 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query181
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 3e-49
1nff_A260 Putative oxidoreductase RV2002; directed evolution 5e-30
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 1e-24
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 2e-24
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 6e-24
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 6e-24
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 1e-23
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 3e-23
3tox_A280 Short chain dehydrogenase; structural genomics, PS 5e-23
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 5e-23
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 7e-23
4dqx_A277 Probable oxidoreductase protein; structural genomi 5e-22
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 8e-21
4e4y_A244 Short chain dehydrogenase family protein; structur 8e-21
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 1e-20
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 1e-20
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 3e-20
1spx_A278 Short-chain reductase family member (5L265); paral 9e-20
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 1e-19
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 4e-19
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 6e-19
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 1e-18
1xhl_A297 Short-chain dehydrogenase/reductase family member 1e-18
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 1e-18
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 2e-18
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 3e-18
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 4e-18
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 8e-18
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 9e-18
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 1e-17
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 1e-17
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 1e-17
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 2e-17
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 2e-17
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 2e-17
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 5e-17
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 6e-17
3tjr_A301 Short chain dehydrogenase; structural genomics, se 6e-17
3tsc_A277 Putative oxidoreductase; structural genomics, seat 6e-17
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 7e-17
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 7e-17
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 8e-17
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 9e-17
1xkq_A280 Short-chain reductase family member (5D234); parra 9e-17
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 1e-16
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 2e-16
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 2e-16
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 2e-16
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 2e-16
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 3e-16
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 4e-16
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 6e-16
3imf_A257 Short chain dehydrogenase; structural genomics, in 9e-16
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 1e-15
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 1e-15
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 3e-15
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 5e-15
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 6e-15
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 8e-15
4eso_A255 Putative oxidoreductase; NADP, structural genomics 9e-15
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 1e-14
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 1e-14
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 2e-14
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 2e-14
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 2e-14
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 2e-14
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 2e-14
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 2e-14
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 3e-14
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 3e-14
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 3e-14
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 4e-14
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 5e-14
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 7e-14
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 1e-13
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 2e-13
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 2e-13
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 2e-13
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 2e-13
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 2e-13
3e03_A274 Short chain dehydrogenase; structural genomics, PS 3e-13
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 3e-13
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 3e-13
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 4e-13
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 5e-13
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 6e-13
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 8e-13
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 1e-12
1ooe_A236 Dihydropteridine reductase; structural genomics, P 1e-12
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 1e-12
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 1e-12
3cxt_A291 Dehydrogenase with different specificities; rossma 2e-12
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 2e-12
1xq1_A266 Putative tropinone reducatse; structural genomics, 2e-12
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 2e-12
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 4e-12
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 4e-12
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 5e-12
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 1e-11
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 1e-11
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 2e-11
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 2e-11
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 2e-11
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 2e-11
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 3e-11
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 3e-11
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 3e-11
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 4e-11
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 7e-11
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 8e-11
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 1e-10
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 1e-10
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 1e-10
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 1e-10
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 2e-10
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 2e-10
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 2e-10
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 3e-10
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 4e-10
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 4e-10
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 5e-10
3edm_A259 Short chain dehydrogenase; structural genomics, ox 6e-10
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 7e-10
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 9e-10
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 1e-09
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 1e-09
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 1e-09
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 2e-09
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 2e-09
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 3e-09
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 4e-09
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 5e-09
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 8e-09
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 1e-08
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 1e-08
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 2e-08
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 2e-08
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 3e-08
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 2e-08
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 3e-08
3gem_A260 Short chain dehydrogenase; structural genomics, AP 3e-08
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 4e-08
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 4e-08
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 6e-08
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 6e-08
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 6e-08
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 6e-08
3qlj_A322 Short chain dehydrogenase; structural genomics, se 7e-08
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 1e-07
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 2e-07
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 2e-07
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 3e-07
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 3e-07
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 1e-06
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 2e-06
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 3e-06
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 3e-06
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 3e-06
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 5e-06
3rih_A293 Short chain dehydrogenase or reductase; structural 7e-06
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 1e-05
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 7e-05
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 7e-05
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 1e-04
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 2e-04
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 2e-04
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 2e-04
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 2e-04
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 3e-04
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 3e-04
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 4e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 7e-04
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Length = 278 Back     alignment and structure
 Score =  159 bits (405), Expect = 3e-49
 Identities = 83/200 (41%), Positives = 123/200 (61%), Gaps = 20/200 (10%)

Query: 2   FIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFT--KFGKLDI 59
           F+++ AKV+IAD+ DD  + +C    S ++IS+V C+VT D DV+N+ D T  K GKLDI
Sbjct: 36  FVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDI 95

Query: 60  MFNNAGIISNMDRTTLDTDNEKVKRVM-IMV--VFL--------------GVLLFTANLA 102
           MF N G++S    + L+  NE  KRVM I V   FL              G ++FTA+++
Sbjct: 96  MFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASIS 155

Query: 103 TETIGEAL-YDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKT 161
           + T GE + + Y  +K+AVLGL  +LC ELG+Y IRVN ++  + A+P   +  G+D   
Sbjct: 156 SFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSR 215

Query: 162 FKELLYASANLKGVVLKAAD 181
            +EL + +ANLKG +L+A D
Sbjct: 216 VEELAHQAANLKGTLLRAED 235


>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Length = 260 Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Length = 253 Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Length = 254 Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Length = 270 Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} Length = 271 Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Length = 251 Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Length = 277 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Length = 261 Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Length = 277 Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Length = 250 Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Length = 244 Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Length = 281 Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Length = 281 Back     alignment and structure
>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Length = 254 Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 278 Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Length = 273 Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Length = 269 Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Length = 262 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Length = 260 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 297 Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Length = 246 Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} PDB: 3uwr_A* Length = 286 Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Length = 281 Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Length = 264 Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Length = 273 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Length = 283 Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Length = 251 Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} Length = 264 Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Length = 255 Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} Length = 287 Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Length = 259 Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Length = 244 Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Length = 257 Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Length = 301 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} Length = 277 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Length = 265 Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Length = 260 Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Length = 254 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 280 Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Length = 272 Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Length = 276 Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Length = 299 Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Length = 260 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Length = 278 Back     alignment and structure
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Length = 255 Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Length = 257 Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Length = 279 Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} Length = 280 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Length = 252 Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Length = 302 Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Length = 257 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Length = 255 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Length = 263 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Length = 277 Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} Length = 235 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Length = 234 Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 242 Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Length = 253 Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Length = 303 Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Length = 319 Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Length = 250 Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Length = 261 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Length = 256 Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Length = 285 Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} Length = 247 Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Length = 266 Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Length = 276 Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Length = 252 Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Length = 266 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Length = 262 Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Length = 258 Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} Length = 273 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Length = 274 Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Length = 244 Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Length = 265 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Length = 254 Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Length = 241 Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Length = 272 Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Length = 256 Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 236 Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Length = 263 Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Length = 317 Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Length = 260 Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Length = 266 Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Length = 260 Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Length = 346 Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Length = 294 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Length = 262 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Length = 263 Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Length = 265 Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Length = 258 Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Length = 281 Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Length = 270 Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Length = 254 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Length = 286 Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Length = 245 Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Length = 271 Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Length = 272 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Length = 283 Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} PDB: 3gdf_A Length = 267 Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Length = 267 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Length = 274 Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Length = 254 Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} Length = 235 Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Length = 258 Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Length = 260 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Length = 239 Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} Length = 281 Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Length = 255 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Length = 244 Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Length = 255 Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Length = 259 Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Length = 291 Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Length = 267 Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Length = 249 Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Length = 257 Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Length = 247 Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Length = 250 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Length = 260 Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Length = 202 Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Length = 272 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Length = 279 Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Length = 328 Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Length = 259 Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Length = 288 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Length = 604 Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Length = 280 Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Length = 207 Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Length = 260 Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} Length = 262 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Length = 291 Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Length = 247 Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Length = 319 Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Length = 287 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Length = 613 Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Length = 322 Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Length = 266 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Length = 264 Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Length = 276 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Length = 248 Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Length = 245 Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Length = 255 Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Length = 279 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Length = 267 Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Length = 230 Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Length = 277 Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Length = 250 Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Length = 293 Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} Length = 264 Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} Length = 249 Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Length = 285 Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Length = 266 Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Length = 276 Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} Length = 247 Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Length = 270 Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} PDB: 3rsh_A* 3rro_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Length = 248 Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Length = 264 Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Length = 247 Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Length = 253 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
4g81_D255 Putative hexonate dehydrogenase; enzyme function i 100.0
4fn4_A254 Short chain dehydrogenase; NADH-binding, rossmann 100.0
4fgs_A273 Probable dehydrogenase protein; PSI-biology, nysgr 100.0
4b79_A242 PA4098, probable short-chain dehydrogenase; oxidor 100.0
4hp8_A247 2-deoxy-D-gluconate 3-dehydrogenase; enzyme functi 100.0
3ged_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 100.0
4fs3_A256 Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; 100.0
4gkb_A258 3-oxoacyl-[acyl-carrier protein] reductase; putati 100.0
4h15_A261 Short chain alcohol dehydrogenase-related dehydro; 100.0
4ibo_A271 Gluconate dehydrogenase; enzyme function initiativ 100.0
3op4_A248 3-oxoacyl-[acyl-carrier protein] reductase; 3-keto 100.0
3oid_A258 Enoyl-[acyl-carrier-protein] reductase [NADPH]; fa 100.0
4egf_A266 L-xylulose reductase; structural genomics, ssgcid, 100.0
3lf2_A265 Short chain oxidoreductase Q9HYA2; SDR, SCOR, ross 100.0
3gaf_A256 7-alpha-hydroxysteroid dehydrogenase; seattle stru 100.0
3pk0_A262 Short-chain dehydrogenase/reductase SDR; ssgcid, s 100.0
4fc7_A277 Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossman 100.0
3sju_A279 Keto reductase; short-chain dehydrogenase, oxidore 100.0
4e6p_A259 Probable sorbitol dehydrogenase (L-iditol 2-dehyd; 100.0
4eso_A255 Putative oxidoreductase; NADP, structural genomics 100.0
3imf_A257 Short chain dehydrogenase; structural genomics, in 100.0
3ucx_A264 Short chain dehydrogenase; ssgcid, seattle structu 100.0
3tox_A280 Short chain dehydrogenase; structural genomics, PS 100.0
3svt_A281 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3grp_A266 3-oxoacyl-(acyl carrierprotein) reductase; structu 100.0
4dqx_A277 Probable oxidoreductase protein; structural genomi 100.0
3ftp_A270 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid 100.0
3rwb_A247 TPLDH, pyridoxal 4-dehydrogenase; short chain dehy 100.0
3rih_A293 Short chain dehydrogenase or reductase; structural 100.0
3osu_A246 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3uf0_A273 Short-chain dehydrogenase/reductase SDR; gluconate 100.0
3gvc_A277 Oxidoreductase, probable short-chain type dehydrog 100.0
4imr_A275 3-oxoacyl-(acyl-carrier-protein) reductase; oxidor 100.0
1zem_A262 Xylitol dehydrogenase; rossmann fold, dinucleotide 100.0
3v8b_A283 Putative dehydrogenase, possibly 3-oxoacyl-[acyl- 100.0
3tzq_B271 Short-chain type dehydrogenase/reductase; ssgcid, 100.0
3r1i_A276 Short-chain type dehydrogenase/reductase; structur 100.0
3u5t_A267 3-oxoacyl-[acyl-carrier-protein] reductase; struct 100.0
3grk_A293 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 100.0
4dmm_A269 3-oxoacyl-[acyl-carrier-protein] reductase; rossma 100.0
3is3_A270 17BETA-hydroxysteroid dehydrogenase; short chain d 99.98
3o38_A266 Short chain dehydrogenase; tuberculosis, ortholog 99.98
3k31_A296 Enoyl-(acyl-carrier-protein) reductase; ssgcid, NI 99.98
3lyl_A247 3-oxoacyl-(acyl-carrier-protein) reductase; alpha 99.98
3h7a_A252 Short chain dehydrogenase; oxidoreductase, PSI-2, 99.98
1ae1_A273 Tropinone reductase-I; oxidoreductase, tropane alk 99.98
3ksu_A262 3-oxoacyl-acyl carrier protein reductase; structur 99.98
3v2h_A281 D-beta-hydroxybutyrate dehydrogenase; structural g 99.98
4da9_A280 Short-chain dehydrogenase/reductase; structural ge 99.98
3a28_C258 L-2.3-butanediol dehydrogenase; chiral substrate r 99.98
1vl8_A267 Gluconate 5-dehydrogenase; TM0441, structural geno 99.98
3n74_A261 3-ketoacyl-(acyl-carrier-protein) reductase; seatt 99.97
3dii_A247 Short-chain dehydrogenase/reductase SDR; SCOR, ros 99.97
3edm_A259 Short chain dehydrogenase; structural genomics, ox 99.97
2uvd_A246 3-oxoacyl-(acyl-carrier-protein) reductase; beta-k 99.97
3tpc_A257 Short chain alcohol dehydrogenase-related dehydro; 99.97
3l6e_A235 Oxidoreductase, short-chain dehydrogenase/reducta; 99.97
3kzv_A254 Uncharacterized oxidoreductase YIR035C; cytoplasmi 99.97
4dyv_A272 Short-chain dehydrogenase/reductase SDR; structura 99.97
3p19_A266 BFPVVD8, putative blue fluorescent protein; rossma 99.97
3ijr_A291 Oxidoreductase, short chain dehydrogenase/reducta; 99.97
2jah_A247 Clavulanic acid dehydrogenase; short-chain dehydro 99.97
3v2g_A271 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.97
2ae2_A260 Protein (tropinone reductase-II); oxidoreductase, 99.97
3t4x_A267 Oxidoreductase, short chain dehydrogenase/reducta; 99.97
3s55_A281 Putative short-chain dehydrogenase/reductase; stru 99.97
3tsc_A277 Putative oxidoreductase; structural genomics, seat 99.97
1geg_A256 Acetoin reductase; SDR family, oxidoreductase; HET 99.97
3cxt_A291 Dehydrogenase with different specificities; rossma 99.97
3ezl_A256 Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA 99.97
2zat_A260 Dehydrogenase/reductase SDR family member 4; alpha 99.97
3uve_A286 Carveol dehydrogenase ((+)-trans-carveol dehydrog; 99.97
2b4q_A276 Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier 99.97
3t7c_A299 Carveol dehydrogenase; structural genomics, seattl 99.97
1x1t_A260 D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, S 99.97
3pgx_A280 Carveol dehydrogenase; structural genomics, seattl 99.97
3oig_A266 Enoyl-[acyl-carrier-protein] reductase [NADH]; fat 99.97
3zv4_A281 CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; ox 99.97
1uls_A245 Putative 3-oxoacyl-acyl carrier protein reductase; 99.97
3ai3_A263 NADPH-sorbose reductase; rossmann-fold, NADPH-depe 99.97
3r3s_A294 Oxidoreductase; structural genomics, csgid, center 99.97
3nyw_A250 Putative oxidoreductase; fatty acid synthesis,3-ox 99.97
2ew8_A249 (S)-1-phenylethanol dehydrogenase; transferase; 2. 99.97
1iy8_A267 Levodione reductase; oxidoreductase; HET: NAD; 1.6 99.97
3tfo_A264 Putative 3-oxoacyl-(acyl-carrier-protein) reducta; 99.97
1spx_A278 Short-chain reductase family member (5L265); paral 99.97
2a4k_A263 3-oxoacyl-[acyl carrier protein] reductase; reduct 99.97
4dry_A281 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.97
3gk3_A269 Acetoacetyl-COA reductase; acetoacetyl-CO reductas 99.97
1yde_A270 Retinal dehydrogenase/reductase 3; oxidoreductase, 99.97
1xkq_A280 Short-chain reductase family member (5D234); parra 99.97
3ek2_A271 Enoyl-(acyl-carrier-protein) reductase (NADH); ssg 99.97
1e7w_A291 Pteridine reductase; dihydrofolate reductase, shor 99.97
4iin_A271 3-ketoacyl-acyl carrier protein reductase (FABG); 99.97
2pd4_A275 Enoyl-[acyl-carrier-protein] reductase [NADH]; ant 99.97
1hdc_A254 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxi 99.97
2rhc_B277 Actinorhodin polyketide ketoreductase; oxidoreduct 99.97
3vtz_A269 Glucose 1-dehydrogenase; rossmann fold, oxidoreduc 99.97
3f9i_A249 3-oxoacyl-[acyl-carrier-protein] reductase; 3-keto 99.97
1xhl_A297 Short-chain dehydrogenase/reductase family member 99.97
1g0o_A283 Trihydroxynaphthalene reductase; protein-NADPH-act 99.97
3f1l_A252 Uncharacterized oxidoreductase YCIK; E. coli, NADP 99.97
4iiu_A267 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.97
3rku_A287 Oxidoreductase YMR226C; substrate fingerprint, sho 99.97
2h7i_A269 Enoyl-[acyl-carrier-protein] reductase [NADH]; oxi 99.97
3sc4_A285 Short chain dehydrogenase (A0QTM2 homolog); ssgcid 99.97
3qiv_A253 Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR 99.97
1qsg_A265 Enoyl-[acyl-carrier-protein] reductase; enoyl redu 99.97
3ak4_A263 NADH-dependent quinuclidinone reductase; SDR, (R)- 99.97
2wyu_A261 Enoyl-[acyl carrier protein] reductase; oxidoreduc 99.97
3gem_A260 Short chain dehydrogenase; structural genomics, AP 99.97
3nrc_A280 Enoyl-[acyl-carrier-protein] reductase (NADH); ros 99.97
1hxh_A253 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-b 99.97
2z1n_A260 Dehydrogenase; reductase, SDR, oxidoreductase; 1.8 99.97
3ppi_A281 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, de 99.97
3icc_A255 Putative 3-oxoacyl-(acyl carrier protein) reducta; 99.97
2q2v_A255 Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidore 99.97
3oec_A317 Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; 99.97
2d1y_A256 Hypothetical protein TT0321; strucrtural genomics, 99.97
3rkr_A262 Short chain oxidoreductase; rossmann fold; HET: NA 99.97
2p91_A285 Enoyl-[acyl-carrier-protein] reductase [NADH]; NAD 99.97
3gdg_A267 Probable NADP-dependent mannitol dehydrogenase; ro 99.97
1mxh_A276 Pteridine reductase 2; SDR topology, protein-subst 99.97
3tl3_A257 Short-chain type dehydrogenase/reductase; ssgcid, 99.97
3i4f_A264 3-oxoacyl-[acyl-carrier protein] reductase; struct 99.97
3asu_A248 Short-chain dehydrogenase/reductase SDR; SDR famil 99.96
1nff_A260 Putative oxidoreductase RV2002; directed evolution 99.96
1oaa_A259 Sepiapterin reductase; tetrahydrobiopterin, oxidor 99.96
2nwq_A272 Probable short-chain dehydrogenase; oxidoreductase 99.96
2cfc_A250 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidor 99.96
2qhx_A328 Pteridine reductase 1; oxidoreductase, short-chain 99.96
3e03_A274 Short chain dehydrogenase; structural genomics, PS 99.96
3zu3_A405 Putative reductase YPO4104/Y4119/YP_4011; oxidored 99.96
3s8m_A422 Enoyl-ACP reductase; rossmann fold, oxidoreductase 99.96
4e3z_A272 Putative oxidoreductase protein; PSI-biology, stru 99.96
3un1_A260 Probable oxidoreductase; structural genomics, PSI- 99.96
3uxy_A266 Short-chain dehydrogenase/reductase SDR; structura 99.96
3tjr_A301 Short chain dehydrogenase; structural genomics, se 99.96
3guy_A230 Short-chain dehydrogenase/reductase SDR; structura 99.96
3lt0_A329 Enoyl-ACP reductase; triclosan, triclosan variant, 99.96
3i1j_A247 Oxidoreductase, short chain dehydrogenase/reducta; 99.96
2ekp_A239 2-deoxy-D-gluconate 3-dehydrogenase; structural ge 99.96
2x9g_A288 PTR1, pteridine reductase; short chain dehydrogena 99.96
2ag5_A246 DHRS6, dehydrogenase/reductase (SDR family) member 99.96
3m1a_A281 Putative dehydrogenase; short, PSI, MCSG, structur 99.96
4e4y_A244 Short chain dehydrogenase family protein; structur 99.96
2bgk_A278 Rhizome secoisolariciresinol dehydrogenase; oxidor 99.96
1gee_A261 Glucose 1-dehydrogenase; short-chain dehydrogenase 99.96
2qq5_A260 DHRS1, dehydrogenase/reductase SDR family member 1 99.96
2c07_A285 3-oxoacyl-(acyl-carrier protein) reductase; oxidor 99.96
3sx2_A278 Putative 3-ketoacyl-(acyl-carrier-protein) reduct; 99.96
3kvo_A346 Hydroxysteroid dehydrogenase-like protein 2; HSDL2 99.96
2wsb_A254 Galactitol dehydrogenase; oxidoreductase, SDR, ros 99.96
3pxx_A287 Carveol dehydrogenase; structural genomics, seattl 99.96
3awd_A260 GOX2181, putative polyol dehydrogenase; oxidoreduc 99.96
1xq1_A266 Putative tropinone reducatse; structural genomics, 99.96
2fwm_X250 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; e 99.96
3qlj_A322 Short chain dehydrogenase; structural genomics, se 99.96
1edo_A244 Beta-keto acyl carrier protein reductase; nucleoti 99.96
1zk4_A251 R-specific alcohol dehydrogenase; short chain redu 99.96
1fmc_A255 7 alpha-hydroxysteroid dehydrogenase; short-chain 99.96
2nm0_A253 Probable 3-oxacyl-(acyl-carrier-protein) reductas; 99.96
3l77_A235 Short-chain alcohol dehydrogenase; oxidoreductase; 99.96
1uzm_A247 3-oxoacyl-[acyl-carrier protein] reductase; beta-k 99.96
2dtx_A264 Glucose 1-dehydrogenase related protein; rossmann 99.96
1h5q_A265 NADP-dependent mannitol dehydrogenase; oxidoreduct 99.96
2o23_A265 HADH2 protein; HSD17B10, schad, ERAB, type II HADH 99.96
2pnf_A248 3-oxoacyl-[acyl-carrier-protein] reductase; short 99.96
3d3w_A244 L-xylulose reductase; uronate cycle, short-chain d 99.96
3afn_B258 Carbonyl reductase; alpha/beta/alpha, rossmann-fol 99.96
3ioy_A319 Short-chain dehydrogenase/reductase SDR; structura 99.96
2ph3_A245 3-oxoacyl-[acyl carrier protein] reductase; TTHA04 99.96
3uce_A223 Dehydrogenase; rossmann fold, oxidoreductase; HET: 99.95
2hq1_A247 Glucose/ribitol dehydrogenase; CTH-1438, structura 99.95
3u9l_A324 3-oxoacyl-[acyl-carrier-protein] reductase; struct 99.95
2pd6_A264 Estradiol 17-beta-dehydrogenase 8; short-chain deh 99.95
3u0b_A454 Oxidoreductase, short chain dehydrogenase/reducta 99.95
1w6u_A302 2,4-dienoyl-COA reductase, mitochondrial precursor 99.95
1cyd_A244 Carbonyl reductase; short-chain dehydrogenase, oxi 99.95
1zmo_A244 Halohydrin dehalogenase; haloalcohol dehalogenase, 99.95
1zmt_A254 Haloalcohol dehalogenase HHEC; halohydrin dehaloge 99.95
1yxm_A303 Pecra, peroxisomal trans 2-enoyl COA reductase; pe 99.95
4eue_A418 Putative reductase CA_C0462; TER, biofuel, synthet 99.95
3ctm_A279 Carbonyl reductase; alcohol dehydrogenase, short-c 99.95
2bd0_A244 Sepiapterin reductase; oxidoreductase; HET: NAP BI 99.95
1xg5_A279 ARPG836; short chain dehydrogenase, human, SGC, st 99.95
1ja9_A274 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; p 99.95
3rd5_A291 Mypaa.01249.C; ssgcid, structural genomics, seattl 99.95
1yb1_A272 17-beta-hydroxysteroid dehydrogenase type XI; shor 99.94
2ehd_A234 Oxidoreductase, oxidoreductase, short-chain dehydr 99.94
3o26_A311 Salutaridine reductase; short chain dehydrogenase/ 99.94
2o2s_A315 Enoyl-acyl carrier reductase; enoyl reductase, tri 99.94
3orf_A251 Dihydropteridine reductase; alpha-beta-alpha sandw 99.94
1o5i_A249 3-oxoacyl-(acyl carrier protein) reductase; TM1169 99.94
1jtv_A 327 17 beta-hydroxysteroid dehydrogenase type 1; stero 99.94
3e9n_A245 Putative short-chain dehydrogenase/reductase; stru 99.94
1d7o_A297 Enoyl-[acyl-carrier protein] reductase (NADH) PRE; 99.94
1dhr_A241 Dihydropteridine reductase; oxidoreductase(acting 99.93
2ptg_A319 Enoyl-acyl carrier reductase; apicomplexa, enoyl ( 99.93
2gdz_A267 NAD+-dependent 15-hydroxyprostaglandin dehydrogen; 99.93
2et6_A 604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.93
1ooe_A236 Dihydropteridine reductase; structural genomics, P 99.93
1xu9_A286 Corticosteroid 11-beta-dehydrogenase, isozyme 1; h 99.93
1uay_A242 Type II 3-hydroxyacyl-COA dehydrogenase; beta oxid 99.93
2et6_A604 (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-ox 99.93
1gz6_A319 Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MF 99.93
1yo6_A250 Putative carbonyl reductase sniffer; tyrosine-depe 99.92
1sny_A267 Sniffer CG10964-PA; alpha and beta protein, rossma 99.92
3oml_A 613 GH14720P, peroxisomal multifunctional enzyme type 99.92
2yut_A207 Putative short-chain oxidoreductase; alpha and bet 99.92
1sby_A254 Alcohol dehydrogenase; ternary complex, NAD, trifl 99.91
1wma_A276 Carbonyl reductase [NADPH] 1; oxidoreductase; HET: 99.91
1fjh_A257 3alpha-hydroxysteroid dehydrogenase/carbonyl reduc 99.89
3d7l_A202 LIN1944 protein; APC89317, structural genomics, PS 99.88
2uv8_A 1887 Fatty acid synthase subunit alpha (FAS2); fatty ac 99.88
3qp9_A525 Type I polyketide synthase pikaii; rossmann fold, 99.87
3slk_A795 Polyketide synthase extender module 2; rossmann fo 99.87
2uv9_A 1878 Fatty acid synthase alpha subunits; fungal, dehydr 99.87
2pff_A 1688 Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl 99.86
3mje_A496 AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1. 99.85
2fr1_A486 Erythromycin synthase, eryai; short chain dehydrog 99.8
2z5l_A511 Tylkr1, tylactone synthase starter module and modu 99.79
2dkn_A255 3-alpha-hydroxysteroid dehydrogenase; oxidoreducta 99.78
3zen_D 3089 Fatty acid synthase; transferase, mycolic acid bio 99.77
3rft_A267 Uronate dehydrogenase; apoenzyme, rossmann fold, N 99.7
2gn4_A 344 FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann 99.63
1orr_A 347 CDP-tyvelose-2-epimerase; rossmann fold, short-cha 99.62
2vz8_A 2512 Fatty acid synthase; transferase, phosphopantethei 99.62
3enk_A 341 UDP-glucose 4-epimerase; seattle structural genomi 99.61
1rkx_A 357 CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 99.59
1y1p_A342 ARII, aldehyde reductase II; rossmann fold, short 99.58
4ggo_A401 Trans-2-enoyl-COA reductase; rossmann fold, oxidor 99.58
2bka_A242 CC3, TAT-interacting protein TIP30; NADPH, PEG600, 99.58
3e8x_A236 Putative NAD-dependent epimerase/dehydratase; stru 99.57
2pk3_A 321 GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, shor 99.56
1i24_A 404 Sulfolipid biosynthesis protein SQD1; SDR, short-c 99.56
1gy8_A 397 UDP-galactose 4-epimerase; oxidoreductase; HET: NA 99.55
1sb8_A 352 WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCN 99.53
3dqp_A219 Oxidoreductase YLBE; alpha-beta protein., structur 99.53
2z1m_A 345 GDP-D-mannose dehydratase; short-chain dehydrogena 99.52
2hun_A 336 336AA long hypothetical DTDP-glucose 4,6-dehydrat; 99.52
1kew_A 361 RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fo 99.51
2p5y_A 311 UDP-glucose 4-epimerase; TTHA0591, structural geno 99.5
1xq6_A253 Unknown protein; structural genomics, protein stru 99.5
3r6d_A221 NAD-dependent epimerase/dehydratase; structural ge 99.49
3nzo_A 399 UDP-N-acetylglucosamine 4,6-dehydratase; structura 99.49
3ay3_A267 NAD-dependent epimerase/dehydratase; glucuronic ac 99.49
2c29_D 337 Dihydroflavonol 4-reductase; flavonoids, short deh 99.48
3dhn_A227 NAD-dependent epimerase/dehydratase; reductase, PF 99.48
3ruf_A 351 WBGU; rossmann fold, UDP-hexose 4-epimerase, isome 99.47
2x4g_A 342 Nucleoside-diphosphate-sugar epimerase; isomerase; 99.47
3ko8_A 312 NAD-dependent epimerase/dehydratase; isomerase, UD 99.47
2c20_A 330 UDP-glucose 4-epimerase; carbohydrate metabolism, 99.47
1ek6_A 348 UDP-galactose 4-epimerase; short-chain dehydrogena 99.46
1oc2_A 348 DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnos 99.46
3h2s_A224 Putative NADH-flavin reductase; Q03B84, NESG, LCR1 99.45
2pzm_A 330 Putative nucleotide sugar epimerase/ dehydratase; 99.44
1r6d_A 337 TDP-glucose-4,6-dehydratase; rossmann fold, short- 99.44
2c5a_A 379 GDP-mannose-3', 5'-epimerase; short chain dehydrat 99.44
3ehe_A 313 UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, 99.42
4egb_A 346 DTDP-glucose 4,6-dehydratase; rhamnose pathway, ce 99.42
1db3_A 372 GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lya 99.4
1udb_A 338 Epimerase, UDP-galactose-4-epimerase; isomerase; H 99.4
2p4h_X322 Vestitone reductase; NADPH-dependent reductase, is 99.4
1hdo_A206 Biliverdin IX beta reductase; foetal metabolism, H 99.4
1rpn_A 335 GDP-mannose 4,6-dehydratase; short-chain dehydroge 99.38
1t2a_A 375 GDP-mannose 4,6 dehydratase; structural genomics c 99.38
2bll_A 345 Protein YFBG; decarboxylase, short chain dehydroge 99.38
4id9_A 347 Short-chain dehydrogenase/reductase; putative dehy 99.37
2q1w_A 333 Putative nucleotide sugar epimerase/ dehydratase; 99.35
3slg_A 372 PBGP3 protein; structural genomics, seattle struct 99.34
2rh8_A 338 Anthocyanidin reductase; flavonoids, rossmann fold 99.34
4f6c_A 427 AUSA reductase domain protein; thioester reductase 99.34
2yy7_A 312 L-threonine dehydrogenase; thermolabIle, flavobact 99.34
2q1s_A 377 Putative nucleotide sugar epimerase/ dehydratase; 99.32
2hrz_A 342 AGR_C_4963P, nucleoside-diphosphate-sugar epimeras 99.32
1n7h_A 381 GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, 99.31
3ew7_A221 LMO0794 protein; Q8Y8U8_lismo, putative NAD-depend 99.3
2x6t_A 357 ADP-L-glycero-D-manno-heptose-6-epimerase; isomera 99.3
3ajr_A 317 NDP-sugar epimerase; L-threonine dehydrogenase, L- 99.29
3m2p_A 311 UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J 99.28
3sxp_A 362 ADP-L-glycero-D-mannoheptose-6-epimerase; rossman 99.28
2b69_A 343 UDP-glucuronate decarboxylase 1; UDP-glucoronic ac 99.26
2ydy_A 315 Methionine adenosyltransferase 2 subunit beta; oxi 99.26
1z45_A 699 GAL10 bifunctional protein; epimerase, mutarotase, 99.24
1z7e_A 660 Protein aRNA; rossmann fold, OB-like fold, hydrola 99.23
3qvo_A236 NMRA family protein; structural genomics, PSI-biol 99.23
1eq2_A 310 ADP-L-glycero-D-mannoheptose 6-epimerase; N-termin 99.22
1e6u_A 321 GDP-fucose synthetase; epimerase/reductase, SDR, R 99.19
1vl0_A292 DTDP-4-dehydrorhamnose reductase, RFBD ortholog; s 99.18
2a35_A215 Hypothetical protein PA4017; alpha-beta-alpha sand 99.16
3gpi_A286 NAD-dependent epimerase/dehydratase; structural ge 99.14
4dqv_A 478 Probable peptide synthetase NRP (peptide synthase; 99.12
1n2s_A 299 DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold 99.12
3sc6_A287 DTDP-4-dehydrorhamnose reductase; RFBD, structural 99.11
2zcu_A 286 Uncharacterized oxidoreductase YTFG; alpha-beta sa 99.09
2jl1_A 287 Triphenylmethane reductase; oxidoreductase, biorem 99.07
4b8w_A 319 GDP-L-fucose synthase; oxidoreductase; HET: NAP GD 99.07
4f6l_B 508 AUSA reductase domain protein; thioester reductase 99.06
2ggs_A273 273AA long hypothetical DTDP-4-dehydrorhamnose red 99.03
2wm3_A 299 NMRA-like family domain containing protein 1; unkn 99.01
1xgk_A 352 Nitrogen metabolite repression regulator NMRA; ros 98.98
3ius_A286 Uncharacterized conserved protein; APC63810, silic 98.97
3vps_A 321 TUNA, NAD-dependent epimerase/dehydratase; tunicam 98.95
3st7_A 369 Capsular polysaccharide synthesis enzyme CAP5F; ro 98.83
1qyd_A 313 Pinoresinol-lariciresinol reductase; NADPH-depende 98.79
2gas_A 307 Isoflavone reductase; NADPH-dependent reductase, o 98.76
3i6i_A 346 Putative leucoanthocyanidin reductase 1; rossmann 98.74
3e48_A 289 Putative nucleoside-diphosphate-sugar epimerase; a 98.66
3c1o_A 321 Eugenol synthase; phenylpropene, PIP reductase, sh 98.58
1qyc_A 308 Phenylcoumaran benzylic ether reductase PT1; NADPH 98.55
3gxh_A157 Putative phosphatase (DUF442); YP_001181608.1, str 98.53
2r6j_A 318 Eugenol synthase 1; phenylpropene, PIP reductase, 98.47
2v6g_A 364 Progesterone 5-beta-reductase; tyrosine-dependent 98.43
3oh8_A 516 Nucleoside-diphosphate sugar epimerase (SULA FAMI; 98.24
1lu9_A287 Methylene tetrahydromethanopterin dehydrogenase; a 98.12
1y7t_A 327 Malate dehydrogenase; NAD-dependent-MDH-NADPH comp 97.68
4b4o_A 298 Epimerase family protein SDR39U1; isomerase; HET: 97.37
3ic5_A118 Putative saccharopine dehydrogenase; structural ge 97.28
4ina_A 405 Saccharopine dehydrogenase; structural genomics, P 97.11
1ff9_A 450 Saccharopine reductase; lysine biosynthesis, alpha 97.0
1u7z_A226 Coenzyme A biosynthesis bifunctional protein coabc 96.05
2axq_A 467 Saccharopine dehydrogenase; rossmann fold variant, 96.04
1v3u_A333 Leukotriene B4 12- hydroxydehydrogenase/prostaglan 95.73
3llv_A141 Exopolyphosphatase-related protein; NAD(P)-binding 95.52
3abi_A 365 Putative uncharacterized protein PH1688; L-lysine 94.98
2o7s_A523 DHQ-SDH PR, bifunctional 3-dehydroquinate dehydrat 94.86
1qor_A327 Quinone oxidoreductase; HET: NAP; 2.20A {Escherich 94.77
1pqw_A198 Polyketide synthase; rossmann fold, dimer, structu 94.77
2gk4_A232 Conserved hypothetical protein; alpha-beta-alpha s 94.65
3ond_A488 Adenosylhomocysteinase; plant protein, enzyme-subs 94.56
2eez_A369 Alanine dehydrogenase; TTHA0216, structural genomi 94.18
1id1_A153 Putative potassium channel protein; RCK domain, E. 94.07
1lss_A140 TRK system potassium uptake protein TRKA homolog; 94.03
2j3h_A345 NADP-dependent oxidoreductase P1; double bond redu 93.8
3tnl_A315 Shikimate dehydrogenase; structural genomics, cent 93.42
1nvt_A287 Shikimate 5'-dehydrogenase; structural genomics, P 93.41
1wly_A333 CAAR, 2-haloacrylate reductase; NADPH-dependent ox 93.38
2hmt_A144 YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane 93.35
2hcy_A347 Alcohol dehydrogenase 1; tetramer of asymmetric di 93.19
2zb4_A357 Prostaglandin reductase 2; rossmann fold, alternat 93.15
2j8z_A354 Quinone oxidoreductase; medium-chain dehydrogenase 93.08
3fwz_A140 Inner membrane protein YBAL; TRKA-N domain, E.coli 92.7
4b7c_A336 Probable oxidoreductase; NADP cofactor, rossmann f 92.69
1yb5_A351 Quinone oxidoreductase; medium-chain dehydrogenase 92.46
2z2v_A 365 Hypothetical protein PH1688; L-lysine dehydrogenas 92.38
2eih_A343 Alcohol dehydrogenase; zinc ION binding protein, s 92.03
3l4b_C218 TRKA K+ channel protien TM1088B; potassium channel 91.9
1nyt_A271 Shikimate 5-dehydrogenase; alpha/beta domains, WID 90.46
3qwb_A334 Probable quinone oxidoreductase; rossmann fold, qu 89.83
4dup_A353 Quinone oxidoreductase; PSI-biology, structural ge 89.09
1jvb_A347 NAD(H)-dependent alcohol dehydrogenase; archaeon, 88.84
3c85_A183 Putative glutathione-regulated potassium-efflux S 88.68
1b8p_A 329 Protein (malate dehydrogenase); oxidoreductase; 1. 88.66
3jyn_A325 Quinone oxidoreductase; rossmann fold, protein-NAD 88.57
3t4e_A312 Quinate/shikimate dehydrogenase; structural genomi 88.31
1yqd_A366 Sinapyl alcohol dehydrogenase; lignin, monolignol, 87.97
3oj0_A144 Glutr, glutamyl-tRNA reductase; structural genomic 87.21
2egg_A297 AROE, shikimate 5-dehydrogenase; dimer, X-RAY diff 87.14
2gb4_A252 Thiopurine S-methyltransferase; 18204406, thiopuri 86.85
3gms_A340 Putative NADPH:quinone reductase; structural genom 86.84
1p77_A272 Shikimate 5-dehydrogenase; NADPH, oxidoreductase; 86.74
1wg8_A285 Predicted S-adenosylmethionine-dependent methyltra 86.44
3m6i_A363 L-arabinitol 4-dehydrogenase; medium chain dehydro 86.17
4g65_A 461 TRK system potassium uptake protein TRKA; structur 85.82
3jyo_A283 Quinate/shikimate dehydrogenase; enzyme-cofactor c 85.57
2aef_A234 Calcium-gated potassium channel MTHK; rossmann fol 85.43
4eye_A342 Probable oxidoreductase; structural genomics, niai 84.63
1pjc_A361 Protein (L-alanine dehydrogenase); oxidoreductase, 84.19
2g1u_A155 Hypothetical protein TM1088A; structural genomics, 83.62
2cdc_A366 Glucose dehydrogenase glucose 1-dehydrogenase, DHG 82.58
3uog_A363 Alcohol dehydrogenase; structural genomics, protei 82.17
2vhw_A377 Alanine dehydrogenase; NAD, secreted, oxidoreducta 81.28
>4g81_D Putative hexonate dehydrogenase; enzyme function initiative, EFI, structural genomics, dehydr oxidoreductase; 1.90A {Salmonella enterica subsp} Back     alignment and structure
Probab=100.00  E-value=1.2e-41  Score=251.79  Aligned_cols=176  Identities=18%  Similarity=0.173  Sum_probs=162.1

Q ss_pred             CcccCCCEEEEeecchHHHHHHHhHcCCC-CceEEEeeecCChhHHHHHHHh--cccCCccEEEEcccccCCCCCCcccC
Q 042200            1 VFIQHRAKVIIADVQDDLCRALCKEFDSD-ELISYVCCNVTIDSDVKNVFDF--TKFGKLDIMFNNAGIISNMDRTTLDT   77 (181)
Q Consensus         1 ~l~~~G~~Vv~~~r~~~~~~~~~~~~~~~-~~~~~~~~D~~~~~~i~~~~~~--~~~~~id~vi~~ag~~~~~~~~~~~~   77 (181)
                      +|+++|++|++++|+++.+++..+++... .++.++.||++|++++++++++  .+||+||++|||||+...  .++.++
T Consensus        28 ~la~~Ga~Vvi~~~~~~~~~~~~~~l~~~g~~~~~~~~Dv~~~~~v~~~~~~~~~~~G~iDiLVNNAG~~~~--~~~~~~  105 (255)
T 4g81_D           28 GLAAAGARVILNDIRATLLAESVDTLTRKGYDAHGVAFDVTDELAIEAAFSKLDAEGIHVDILINNAGIQYR--KPMVEL  105 (255)
T ss_dssp             HHHHTTCEEEECCSCHHHHHHHHHHHHHTTCCEEECCCCTTCHHHHHHHHHHHHHTTCCCCEEEECCCCCCC--CCGGGC
T ss_pred             HHHHCCCEEEEEECCHHHHHHHHHHHHhcCCcEEEEEeeCCCHHHHHHHHHHHHHHCCCCcEEEECCCCCCC--CChhhC
Confidence            37899999999999999999888887654 6899999999999999999999  889999999999999877  899999


Q ss_pred             CHHHHHHhhheeec------------------ceeEEEeccccccccCccchhhHhhHHHHHHHHHHHHHHhcCCCeEEE
Q 042200           78 DNEKVKRVMIMVVF------------------LGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVN  139 (181)
Q Consensus        78 ~~~~~~~~~~~n~~------------------~~~iv~iss~~~~~~~~~~~~y~~sK~a~~~l~~~la~~~~~~~i~v~  139 (181)
                      +.++|++++++|+.                  +|+||++||.++..+.+....|++||+++.+|+|+|+.|++++|||||
T Consensus       106 ~~e~~~~~~~vNl~g~~~~~~~~~p~m~~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal~~ltr~lA~ela~~gIrVN  185 (255)
T 4g81_D          106 ELENWQKVIDTNLTSAFLVSRSAAKRMIARNSGGKIINIGSLTSQAARPTVAPYTAAKGGIKMLTCSMAAEWAQFNIQTN  185 (255)
T ss_dssp             CHHHHHHHHHHHTHHHHHHHHHHHHHHHHHTCCEEEEEECCGGGTSBCTTCHHHHHHHHHHHHHHHHHHHHHGGGTEEEE
T ss_pred             CHHHHHHHHHHHhHHHHHHHHHHHHHHHHccCCCEEEEEeehhhcCCCCCchhHHHHHHHHHHHHHHHHHHhcccCeEEE
Confidence            99999999999998                  589999999999999999999999999999999999999999999999


Q ss_pred             EEecCcccCcccchhcCCChHHHHHHHHHhhcccccccccCC
Q 042200          140 SIAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVLKAAD  181 (181)
Q Consensus       140 ~i~Pg~v~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e  181 (181)
                      +|+||+|+|++.....+ +++..+.+.+..  |++|+++|||
T Consensus       186 ~V~PG~i~T~~~~~~~~-~~~~~~~~~~~~--Pl~R~g~ped  224 (255)
T 4g81_D          186 AIGPGYILTDMNTALIE-DKQFDSWVKSST--PSQRWGRPEE  224 (255)
T ss_dssp             EEEECSBCCGGGHHHHT-CHHHHHHHHHHS--TTCSCBCGGG
T ss_pred             EEeeCCCCCchhhcccC-CHHHHHHHHhCC--CCCCCcCHHH
Confidence            99999999999888765 566666677777  9999999987



>4fn4_A Short chain dehydrogenase; NADH-binding, rossmann fold, oxidoreductase; HET: NAD; 1.75A {Sulfolobus acidocaldarius} Back     alignment and structure
>4fgs_A Probable dehydrogenase protein; PSI-biology, nysgrc, structural genomics, NEW YORK structura genomics research consortium, three layer; 1.76A {Rhizobium etli} Back     alignment and structure
>4b79_A PA4098, probable short-chain dehydrogenase; oxidoreductase, infectious disease, structure-based inhibito; HET: NAD; 1.98A {Pseudomonas aeruginosa PAO1} Back     alignment and structure
>4hp8_A 2-deoxy-D-gluconate 3-dehydrogenase; enzyme function initiative, EFI, structural genomics, oxidor; HET: NAP; 1.35A {Agrobacterium tumefaciens} Back     alignment and structure
>3ged_A Short-chain dehydrogenase/reductase SDR; SCOR, rossmann fold, oxidoreductase; 1.70A {Clostridium thermocellum atcc 27405} PDB: 3geg_A* Back     alignment and structure
>4fs3_A Enoyl-[acyl-carrier-protein] reductase [NADPH] FA; rossmann fold, short chain dehydrogenase, NADPH binding, oxidoreductase; HET: 0WD 0WE; 1.80A {Staphylococcus aureus subsp} PDB: 3gr6_A* 3gns_A* 4all_A* 3gnt_A 4alk_A* 4alj_A* 4ali_A* 4alm_A 4aln_A Back     alignment and structure
>4gkb_A 3-oxoacyl-[acyl-carrier protein] reductase; putative sugar dehydrogenase, enzyme function initiative, EF structural genomics; 1.50A {Burkholderia multivorans} PDB: 4glo_A* Back     alignment and structure
>4h15_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, nysgrc; HET: MSE; 1.45A {Sinorhizobium meliloti} PDB: 4h16_A* Back     alignment and structure
>4ibo_A Gluconate dehydrogenase; enzyme function initiative structural genomics, oxidoreductase; 2.10A {Agrobacterium fabrum} Back     alignment and structure
>3op4_A 3-oxoacyl-[acyl-carrier protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase; HET: MSE NAP; 1.60A {Vibrio cholerae o1 biovar el tor} SCOP: c.2.1.2 PDB: 3rsh_A* 3rro_A* 4i08_A* 3tzk_A 3tzc_A* 3u09_A 3tzh_A 1q7b_A* 1i01_A* 1q7c_A* 2cf2_E Back     alignment and structure
>3oid_A Enoyl-[acyl-carrier-protein] reductase [NADPH]; fatty acid synthesis, enoyl-ACP reductases, FABL, rossmann-L NADPH binding, oxidoreductase; HET: TCL NDP; 1.80A {Bacillus subtilis} PDB: 3oic_A* Back     alignment and structure
>4egf_A L-xylulose reductase; structural genomics, ssgcid, seattle structural genomics CEN infectious disease, oxidoreductase; 2.30A {Mycobacterium smegmatis} Back     alignment and structure
>3lf2_A Short chain oxidoreductase Q9HYA2; SDR, SCOR, rossmann fold; HET: NAP; 2.30A {Pseudomonas aeruginosa} PDB: 3lf1_A* Back     alignment and structure
>3gaf_A 7-alpha-hydroxysteroid dehydrogenase; seattle structural genomics center for infectious disease, ssgcid, oxidoreductase, structural genomics; 2.20A {Brucella melitensis} Back     alignment and structure
>3pk0_A Short-chain dehydrogenase/reductase SDR; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; 1.75A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>4fc7_A Peroxisomal 2,4-dienoyl-COA reductase; SDR/rossmann fold, peroxisomal beta-oxidation, oxidoreductas; HET: NAP COA; 1.84A {Homo sapiens} PDB: 4fc6_A* Back     alignment and structure
>3sju_A Keto reductase; short-chain dehydrogenase, oxidoreductase; HET: NDP; 2.40A {Streptomyces griseoruber} Back     alignment and structure
>4e6p_A Probable sorbitol dehydrogenase (L-iditol 2-dehyd; NAD(P)-binding, structural genomics, PSI-biology; HET: MSE; 2.10A {Sinorhizobium meliloti} PDB: 1k2w_A Back     alignment and structure
>4eso_A Putative oxidoreductase; NADP, structural genomics, PSI-biology, NEW structural genomics research consortium, nysgrc; HET: MSE NAP; 1.91A {Sinorhizobium meliloti} PDB: 3vc7_A Back     alignment and structure
>3imf_A Short chain dehydrogenase; structural genomics, infectious D center for structural genomics of infectious diseases, oxidoreductase, csgid; HET: MSE; 1.99A {Bacillus anthracis str} Back     alignment and structure
>3ucx_A Short chain dehydrogenase; ssgcid, seattle structural genomics center for infectious DI dehydrogenase, oxidoreductase; HET: 1PE; 1.85A {Mycobacterium smegmatis} SCOP: c.2.1.0 Back     alignment and structure
>3tox_A Short chain dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, oxidoreductase; HET: NAP; 1.93A {Sinorhizobium meliloti} Back     alignment and structure
>3svt_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 2.00A {Mycobacterium ulcerans} Back     alignment and structure
>3grp_A 3-oxoacyl-(acyl carrierprotein) reductase; structural genomics, oxidoreductase, S structural genomics center for infectious disease, ssgcid; 2.09A {Bartonella henselae} PDB: 3enn_A 3emk_A Back     alignment and structure
>4dqx_A Probable oxidoreductase protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.00A {Rhizobium etli} Back     alignment and structure
>3ftp_A 3-oxoacyl-[acyl-carrier protein] reductase; ssgcid, 3-ketoacyl-(acyl-carrier- protein) reductase, oxidoreductase, structural genomics; 2.05A {Burkholderia pseudomallei} Back     alignment and structure
>3rwb_A TPLDH, pyridoxal 4-dehydrogenase; short chain dehydrogenase/reductase, 4-pyridoxola NAD+, oxidoreductase; HET: NAD 4PL; 1.70A {Mesorhizobium loti} PDB: 3ndr_A* 3nug_A* Back     alignment and structure
>3rih_A Short chain dehydrogenase or reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: PG5; 2.15A {Mycobacterium abscessus} Back     alignment and structure
>3osu_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, csgid, center for structural genomics O infectious diseases; 1.90A {Staphylococcus aureus subsp} SCOP: c.2.1.0 PDB: 3sj7_A* Back     alignment and structure
>3uf0_A Short-chain dehydrogenase/reductase SDR; gluconate, gluconate 5-dehydratase, NAD(P) dependent, enzyme initiative, EFI, oxidoreductase; HET: NAP; 2.00A {Beutenbergia cavernae} SCOP: c.2.1.0 Back     alignment and structure
>3gvc_A Oxidoreductase, probable short-chain type dehydrogenase/reductase; ssgcid, decode, niaid, UWPPG, SBRI, structural genomics; 2.45A {Mycobacterium tuberculosis} Back     alignment and structure
>4imr_A 3-oxoacyl-(acyl-carrier-protein) reductase; oxidoreductase, nicotinamide adenine dinucleotide phosphate, structural genomics; HET: NAP; 1.96A {Agrobacterium fabrum} Back     alignment and structure
>1zem_A Xylitol dehydrogenase; rossmann fold, dinucleotide-binding domain, oxidoreductase; HET: NAD; 1.90A {Gluconobacter oxydans} SCOP: c.2.1.2 Back     alignment and structure
>3v8b_A Putative dehydrogenase, possibly 3-oxoacyl-[acyl- protein] reductase; PSI-biology, structural genomics, protein structure initiati nysgrc; 2.70A {Sinorhizobium meliloti} Back     alignment and structure
>3tzq_B Short-chain type dehydrogenase/reductase; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; 2.50A {Mycobacterium marinum} SCOP: c.2.1.0 Back     alignment and structure
>3r1i_A Short-chain type dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; 1.95A {Mycobacterium marinum} Back     alignment and structure
>3u5t_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.40A {Sinorhizobium meliloti} Back     alignment and structure
>3grk_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, niaid, structural genomics, seattle structural genomics center for infectious disease; 2.35A {Brucella melitensis} PDB: 4eit_A* Back     alignment and structure
>4dmm_A 3-oxoacyl-[acyl-carrier-protein] reductase; rossmann fold, oxoacyl-ACP reductase, NADP binding, fatty AC biosynthsis, oxidoreductase; HET: NAP; 2.38A {Synechococcus elongatus} PDB: 4dml_A* Back     alignment and structure
>3is3_A 17BETA-hydroxysteroid dehydrogenase; short chain dehydrogenase/REDU SDR, fungi, oxidoreductase; HET: GOL; 1.48A {Cochliobolus lunatus} PDB: 3qwf_A* 3qwh_A* 3qwi_A* 3itd_A Back     alignment and structure
>3o38_A Short chain dehydrogenase; tuberculosis, ortholog from A non-pathogenic dehydrogenase, structural genomics; 1.95A {Mycobacterium smegmatis} Back     alignment and structure
>3k31_A Enoyl-(acyl-carrier-protein) reductase; ssgcid, NIH, niaid, SBRI, UW, decode, eonyl-(acyl-carrier-PR reductase, NAD, oxidoreductase; HET: NAD; 1.80A {Anaplasma phagocytophilum} PDB: 3k2e_A* Back     alignment and structure
>3lyl_A 3-oxoacyl-(acyl-carrier-protein) reductase; alpha and beta protein, NAD(P)-binding rossmann fold, csgid, oxidoreductase; 1.95A {Francisella tularensis subsp} SCOP: c.2.1.2 Back     alignment and structure
>3h7a_A Short chain dehydrogenase; oxidoreductase, PSI-2, NYSGXRC, structural genomics, protein structure initiative; 1.87A {Rhodopseudomonas palustris} Back     alignment and structure
>1ae1_A Tropinone reductase-I; oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to tropine, short-chain dehydrogenase; HET: NAP; 2.40A {Datura stramonium} SCOP: c.2.1.2 Back     alignment and structure
>3ksu_A 3-oxoacyl-acyl carrier protein reductase; structural genomics, PSI-2, dehydrogenase, protein structure initiative; 2.30A {Oenococcus oeni psu-1} Back     alignment and structure
>3v2h_A D-beta-hydroxybutyrate dehydrogenase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 3.00A {Sinorhizobium meliloti} Back     alignment and structure
>4da9_A Short-chain dehydrogenase/reductase; structural genomics, protein structure initiative, PSI-biology; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3a28_C L-2.3-butanediol dehydrogenase; chiral substrate recognition, oxidoreductase; HET: NAD; 2.00A {Brevibacterium saccharolyticum} Back     alignment and structure
>1vl8_A Gluconate 5-dehydrogenase; TM0441, structural genomics, JCSG structure initiative, PSI, joint center for structural GENO oxidoreductase; HET: NAP; 2.07A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>3n74_A 3-ketoacyl-(acyl-carrier-protein) reductase; seattle structural genomics center for infectious disease, S brucellosis; 2.20A {Brucella melitensis biovar abortus} Back     alignment and structure
>3edm_A Short chain dehydrogenase; structural genomics, oxidoreductase, PSI-2, P structure initiative; 2.30A {Agrobacterium tumefaciens str} Back     alignment and structure
>2uvd_A 3-oxoacyl-(acyl-carrier-protein) reductase; beta-ketoacyl- (acyl carrier protein) reductase, short-chain dehydrogenase/reductase (SDR); 2.4A {Bacillus anthracis} Back     alignment and structure
>3tpc_A Short chain alcohol dehydrogenase-related dehydro; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.34A {Sinorhizobium meliloti} Back     alignment and structure
>3l6e_A Oxidoreductase, short-chain dehydrogenase/reducta; structural genomics, PSI-2, protein structure initiative; 2.30A {Aeromonas hydrophila subsp} SCOP: c.2.1.0 Back     alignment and structure
>3kzv_A Uncharacterized oxidoreductase YIR035C; cytoplasmic protein, unknown function, structural genomics, MCSG, protein structure initiative; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>4dyv_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 1.80A {Xanthobacter autotrophicus} Back     alignment and structure
>3p19_A BFPVVD8, putative blue fluorescent protein; rossmann-fold, oxidoreductase; HET: NAP; 2.05A {Vibrio vulnificus} Back     alignment and structure
>3ijr_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, infectious D center for structural genomics of infectious diseases; HET: NAD; 2.05A {Bacillus anthracis str} PDB: 3i3o_A* Back     alignment and structure
>2jah_A Clavulanic acid dehydrogenase; short-chain dehydrogenase/reductase, lactamase inhibitor, AN biosynthesis, NADPH, oxidoreductase; HET: MSE NDP; 1.80A {Streptomyces clavuligerus} PDB: 2jap_A* Back     alignment and structure
>3v2g_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, protein structure initiati nysgrc; 2.30A {Sinorhizobium meliloti} Back     alignment and structure
>2ae2_A Protein (tropinone reductase-II); oxidoreductase, tropane alkaloid biosynthesis, reduction of tropinone to pseudotropine; HET: NAP PTO; 1.90A {Datura stramonium} SCOP: c.2.1.2 PDB: 2ae1_A* 1ipe_A* 1ipf_A* Back     alignment and structure
>3t4x_A Oxidoreductase, short chain dehydrogenase/reducta; structural genomics, center for structural genomics of infec diseases, csgid; 2.80A {Bacillus anthracis} Back     alignment and structure
>3s55_A Putative short-chain dehydrogenase/reductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 2.10A {Mycobacterium abscessus} SCOP: c.2.1.0 Back     alignment and structure
>3tsc_A Putative oxidoreductase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, nucleotide; HET: NAD; 2.05A {Mycobacterium avium subsp} SCOP: c.2.1.0 Back     alignment and structure
>1geg_A Acetoin reductase; SDR family, oxidoreductase; HET: GLC NAD; 1.70A {Klebsiella pneumoniae} SCOP: c.2.1.2 Back     alignment and structure
>3ezl_A Acetoacetyl-COA reductase; ssgcid, acetyacetyl-COA reductase, oxidoreductase, structural genomics; HET: P4C; 2.25A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>2zat_A Dehydrogenase/reductase SDR family member 4; alpha/beta, oxidoreductase; HET: NAP; 1.50A {Sus scrofa} PDB: 3o4r_A* Back     alignment and structure
>3uve_A Carveol dehydrogenase ((+)-trans-carveol dehydrog; ssgcid, structural genomics, seattle structural genomics CEN infectious disease; HET: NAD PG4; 1.55A {Mycobacterium avium} SCOP: c.2.1.0 PDB: 3uwr_A* Back     alignment and structure
>2b4q_A Rhamnolipids biosynthesis 3-oxoacyl-[acyl- carrier-protein] reductase; RHLG-NADP complex, oxidoreductase; HET: NAP; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>3t7c_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.95A {Mycobacterium avium} Back     alignment and structure
>1x1t_A D(-)-3-hydroxybutyrate dehydrogenase; NAD, NADH, SDR, short chain dehydrogenase, ketone BODY, beta hydroxybutyrate, oxidoreductase; HET: NAD; 1.52A {Pseudomonas fragi} SCOP: c.2.1.2 PDB: 1wmb_A* 2ztl_A* 2ztv_A* 2ztm_A* 2ztu_A* 2yz7_A 2zea_A* 3eew_A* 3vdq_A* 3vdr_A* Back     alignment and structure
>3pgx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid; HET: NAD; 1.85A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3oig_A Enoyl-[acyl-carrier-protein] reductase [NADH]; fatty acid synthesis, rossmann-like fold, enoyl-ACP reductas binding; HET: NAD IMJ; 1.25A {Bacillus subtilis} SCOP: c.2.1.2 PDB: 3oif_A* 2qio_A* 3oje_A 3ojf_A* Back     alignment and structure
>3zv4_A CIS-2,3-dihydrobiphenyl-2,3-DIOL dehydrogenase; oxidoreductase, short chain dehydrogenase/oxidoreductase, SD comamonas testosteroni; 1.80A {Pandoraea pnomenusa} SCOP: c.2.1.2 PDB: 2y99_A* 3zv3_A 2y93_A 3zv5_A* 3zv6_A* 1bdb_A* Back     alignment and structure
>1uls_A Putative 3-oxoacyl-acyl carrier protein reductase; structural genomics, riken structural genomics/proteomics initiative, RSGI; 2.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3ai3_A NADPH-sorbose reductase; rossmann-fold, NADPH-dependent reductase, short chain dehydrogenase/reductase, oxidoreductase; HET: NAP SOL SOE; 1.80A {Gluconobacter frateurii} PDB: 3ai2_A* 3ai1_A* Back     alignment and structure
>3r3s_A Oxidoreductase; structural genomics, csgid, center for structural genomics O infectious diseases, 3-layer(ABA) sandwich, rossmann fold; HET: NAD; 1.25A {Salmonella enterica subsp} Back     alignment and structure
>3nyw_A Putative oxidoreductase; fatty acid synthesis,3-oxoacyl-[ACP] reductase, NADP+ bindin rossman fold, PSI-II, nysgxrc; 2.16A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2ew8_A (S)-1-phenylethanol dehydrogenase; transferase; 2.10A {Azoarcus SP} SCOP: c.2.1.2 PDB: 2ewm_A* Back     alignment and structure
>1iy8_A Levodione reductase; oxidoreductase; HET: NAD; 1.60A {Leifsonia aquatica} SCOP: c.2.1.2 Back     alignment and structure
>3tfo_A Putative 3-oxoacyl-(acyl-carrier-protein) reducta; structural genomics, PSI-biology, NEW YORK structural genomi research consortium; 2.08A {Sinorhizobium meliloti} Back     alignment and structure
>1spx_A Short-chain reductase family member (5L265); parallel beta-sheet of seven strands in the order 3214567; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>2a4k_A 3-oxoacyl-[acyl carrier protein] reductase; reductase,hyperthermophIle, structural genomics, PSI, protei structure initiative; 2.30A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>4dry_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.50A {Sinorhizobium meliloti} Back     alignment and structure
>3gk3_A Acetoacetyl-COA reductase; acetoacetyl-CO reductase, oxidoreductase, structural genomics; 2.10A {Burkholderia pseudomallei 1710B} Back     alignment and structure
>1yde_A Retinal dehydrogenase/reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC; 2.40A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1xkq_A Short-chain reductase family member (5D234); parrallel beta-sheet of seven strands in the order 3214567; HET: NDP; 2.10A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>3ek2_A Enoyl-(acyl-carrier-protein) reductase (NADH); ssgcid, oxidoreductase, structural genomics; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.2 Back     alignment and structure
>1e7w_A Pteridine reductase; dihydrofolate reductase, shortchain dehydrogenase, methotrexate resistance, oxidoreductase; HET: NDP MTX; 1.75A {Leishmania major} SCOP: c.2.1.2 PDB: 1w0c_A* 1e92_A* 2bf7_A* 2bfa_A* 2bfm_A* 2bfo_A* 2bfp_A* 2p8k_A* 3h4v_A* 2xox_A 1p33_A* Back     alignment and structure
>4iin_A 3-ketoacyl-acyl carrier protein reductase (FABG); structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 2.40A {Helicobacter pylori} PDB: 4ijk_A Back     alignment and structure
>2pd4_A Enoyl-[acyl-carrier-protein] reductase [NADH]; antibacterial target, type II fatty acid biosynthesis, enoyl-ACP-reductase, FABI; HET: NAD DCN; 2.30A {Helicobacter pylori} SCOP: c.2.1.2 PDB: 2pd3_A* Back     alignment and structure
>1hdc_A 3-alpha, 20 beta-hydroxysteroid dehydrogenase; oxidoreductase; HET: CBO; 2.20A {Streptomyces exfoliatus} SCOP: c.2.1.2 PDB: 2hsd_A* Back     alignment and structure
>2rhc_B Actinorhodin polyketide ketoreductase; oxidoreductase, combinatorial biosynthesis, short chain dehydrogenase/reductase; HET: NAP EMO; 2.10A {Streptomyces coelicolor} SCOP: c.2.1.2 PDB: 2rh4_A* 1w4z_A* 3csd_B* 3qrw_A* 3ri3_B* 2rhr_B* 1x7g_A* 1x7h_A* 1xr3_A* Back     alignment and structure
>3vtz_A Glucose 1-dehydrogenase; rossmann fold, oxidoreductase, NAD binding; 2.30A {Thermoplasma volcanium} Back     alignment and structure
>3f9i_A 3-oxoacyl-[acyl-carrier-protein] reductase; 3-ketoacyl-(acyl-carrier-protein) reductase, FAT biosynthesis, lipid synthesis, NADP; 2.25A {Rickettsia prowazekii} SCOP: c.2.1.0 Back     alignment and structure
>1xhl_A Short-chain dehydrogenase/reductase family member putative tropinone reductase-II...; parallel beta-sheet of seven strands in the order 3214567; HET: NDP TNE; 2.40A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1g0o_A Trihydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, dinucleotide binding fold, oxidoreductase; HET: NDP PYQ; 1.70A {Magnaporthe grisea} SCOP: c.2.1.2 PDB: 1doh_A* 1g0n_A* 1ybv_A* Back     alignment and structure
>3f1l_A Uncharacterized oxidoreductase YCIK; E. coli, NADP+,; 0.95A {Escherichia coli K12} SCOP: c.2.1.0 PDB: 3f1k_A 3e9q_A* 3f5q_A 3gz4_A* 3f5s_A 3gy0_A* 3iah_A* 3g1t_A Back     alignment and structure
>4iiu_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAP; 2.10A {Escherichia coli} PDB: 4iiv_A* Back     alignment and structure
>3rku_A Oxidoreductase YMR226C; substrate fingerprint, short chain oxidoreductase, rossmann oxidoreductase; HET: NAP; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>2h7i_A Enoyl-[acyl-carrier-protein] reductase [NADH]; oxidoreductase, INHA, enoyl acyl carrier reductase, pyrrolid carboxamide; HET: NAD 566; 1.62A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1p44_A* 1p45_A* 2b35_A* 2b36_A* 2b37_A* 2aq8_A* 2h7l_A* 2h7m_A* 2h7n_A* 2h7p_A* 2nsd_A* 2pr2_A* 2x22_A* 2x23_A* 3fne_A* 3fnf_A* 3fng_A* 3fnh_A* 3oew_A* 2aqh_A* ... Back     alignment and structure
>3sc4_A Short chain dehydrogenase (A0QTM2 homolog); ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, structu genomics; 2.50A {Mycobacterium thermoresistibile} Back     alignment and structure
>3qiv_A Short-chain dehydrogenase or 3-oxoacyl-[acyl-CARR protein] reductase; structural genomics; 2.25A {Mycobacterium avium subsp} Back     alignment and structure
>1qsg_A Enoyl-[acyl-carrier-protein] reductase; enoyl reductase, oxidoreductase; HET: GLC NAD TCL; 1.75A {Escherichia coli} SCOP: c.2.1.2 PDB: 1c14_A* 1i2z_A* 1i30_A* 1lx6_A* 1lxc_A* 1mfp_A* 2fhs_A 1qg6_A* 1dfg_A* 1dfh_A* 1d8a_A* 1dfi_A* 3pje_A* 3pjd_A* 3pjf_A* Back     alignment and structure
>3ak4_A NADH-dependent quinuclidinone reductase; SDR, (R)-3-quinuclidinol, chiral alcohol, oxidoreductase; HET: NAD; 2.00A {Agrobacterium tumefaciens} Back     alignment and structure
>2wyu_A Enoyl-[acyl carrier protein] reductase; oxidoreductase, fatty acid biosynthesis, oxidation reduction; 1.50A {Thermus thermophilus} PDB: 1ulu_A 2wyv_A* 2wyw_A* 2yw9_A* Back     alignment and structure
>3gem_A Short chain dehydrogenase; structural genomics, APC65077, oxidoreductase, PSI-2, protein structure initiative; 1.83A {Pseudomonas syringae PV} Back     alignment and structure
>3nrc_A Enoyl-[acyl-carrier-protein] reductase (NADH); rossmann fold, NADH BI oxidoreductase; HET: NAD TCL; 2.10A {Francisella tularensis subsp} PDB: 3uic_A* 2jjy_A* Back     alignment and structure
>1hxh_A 3BETA/17BETA-hydroxysteroid dehydrogenase; alpha-beta, rossmann fold, short-chain dehydrogenase, oxidoreductase; 1.22A {Comamonas testosteroni} SCOP: c.2.1.2 Back     alignment and structure
>2z1n_A Dehydrogenase; reductase, SDR, oxidoreductase; 1.80A {Aeropyrum pernix} Back     alignment and structure
>3ppi_A 3-hydroxyacyl-COA dehydrogenase type-2; ssgcid, dehydrogenas mycobacterium avium, structural genomics; 2.00A {Mycobacterium avium} Back     alignment and structure
>3icc_A Putative 3-oxoacyl-(acyl carrier protein) reducta; structural genomics, putative 3-oxoacyl-(acyl carrier protei reductase, oxidoreductase; HET: NAP MES; 1.87A {Bacillus anthracis str} Back     alignment and structure
>2q2v_A Beta-D-hydroxybutyrate dehydrogenase; SDR, oxidoreductase; HET: NAD; 1.90A {Pseudomonas putida} PDB: 2q2q_A* 2q2w_A Back     alignment and structure
>3oec_A Carveol dehydrogenase (mytha.01326.C, A0R518 HOMO; ssgcid, structural genomics; 1.95A {Mycobacterium thermoresistibile} Back     alignment and structure
>2d1y_A Hypothetical protein TT0321; strucrtural genomics, thermus thermophilus HB8, structural genomics, NPPSFA; HET: NAD; 1.65A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>3rkr_A Short chain oxidoreductase; rossmann fold; HET: NAP; 2.42A {Uncultured bacterium BIO5} Back     alignment and structure
>2p91_A Enoyl-[acyl-carrier-protein] reductase [NADH]; NADH-dependent enoyl-ACP reductase, FABI, aquifex A VF5, structural genomics, PSI; 2.00A {Aquifex aeolicus} Back     alignment and structure
>3gdg_A Probable NADP-dependent mannitol dehydrogenase; rossmann fold, beta-alpha-beta motifs, open twisted sheet, A NADP, oxidoreductase; 2.30A {Cladosporium herbarum} SCOP: c.2.1.0 PDB: 3gdf_A Back     alignment and structure
>1mxh_A Pteridine reductase 2; SDR topology, protein-substrate complex, oxidoreductase; HET: NAP DHF; 2.20A {Trypanosoma cruzi} SCOP: c.2.1.2 PDB: 1mxf_A* Back     alignment and structure
>3tl3_A Short-chain type dehydrogenase/reductase; ssgcid, seattle structural genomics center for infectious DI oxidoreductase; 1.85A {Mycobacterium ulcerans} Back     alignment and structure
>3i4f_A 3-oxoacyl-[acyl-carrier protein] reductase; structural genomics, 3-oxoacyl-reductase, PSI-2; 2.39A {Bacillus thuringiensis serovar kurstakorganism_taxid} SCOP: c.2.1.0 Back     alignment and structure
>3asu_A Short-chain dehydrogenase/reductase SDR; SDR family, rossmann-fold, short-chain dehydrogenase/reducta ALLO-threonine dehydrogenase; 1.90A {Escherichia coli} PDB: 3asv_A* Back     alignment and structure
>1nff_A Putative oxidoreductase RV2002; directed evolution, GFP, SDR, hydroxysteroid dehydrogenase, structural genomics, PSI; HET: NAD; 1.80A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1nfq_A* 1nfr_A* Back     alignment and structure
>1oaa_A Sepiapterin reductase; tetrahydrobiopterin, oxidoreductase; HET: NAP; 1.25A {Mus musculus} SCOP: c.2.1.2 PDB: 1nas_A* 1sep_A* 1z6z_A* Back     alignment and structure
>2nwq_A Probable short-chain dehydrogenase; oxidoreductase; 2.30A {Pseudomonas aeruginosa} Back     alignment and structure
>2cfc_A 2-(R)-hydroxypropyl-COM dehydrogenase; NAD, oxidoreductase; HET: NAD KPC; 1.8A {Xanthobacter autotrophicus} Back     alignment and structure
>2qhx_A Pteridine reductase 1; oxidoreductase, short-chain dehydrogenase/reductase, trypanosomatid, pterin salvage, drug resistance; HET: NAP FE1; 2.61A {Leishmania major} SCOP: c.2.1.2 Back     alignment and structure
>3e03_A Short chain dehydrogenase; structural genomics, PSI-2, protein structure initiative, NEW YORK structural genomix research consortium; 1.69A {Xanthomonas campestris PV} Back     alignment and structure
>3zu3_A Putative reductase YPO4104/Y4119/YP_4011; oxidoreductase, fatty acid biosynthesis II, short-chain dehydrogenase reductase superfamily; HET: NAI; 1.80A {Yersinia pestis} PDB: 3zu4_A* 3zu5_A* 3zu2_A* Back     alignment and structure
>3s8m_A Enoyl-ACP reductase; rossmann fold, oxidoreductase, NADH binding, fatty acid SYNT enoyl-ACP; 1.60A {Xanthomonas oryzae PV} Back     alignment and structure
>4e3z_A Putative oxidoreductase protein; PSI-biology, structural genomics, protein structure initiati nysgrc,oxidoreductase; 2.00A {Rhizobium etli} Back     alignment and structure
>3un1_A Probable oxidoreductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.45A {Sinorhizobium meliloti} Back     alignment and structure
>3uxy_A Short-chain dehydrogenase/reductase SDR; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; HET: NAD; 2.10A {Rhodobacter sphaeroides} Back     alignment and structure
>3tjr_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, SCD, NAD; HET: UNL; 1.60A {Mycobacterium avium subsp} Back     alignment and structure
>3guy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structur initiative; 1.90A {Vibrio parahaemolyticus} Back     alignment and structure
>3lt0_A Enoyl-ACP reductase; triclosan, triclosan variant, oxidoredu P.falciparum; HET: NAD FT1; 1.96A {Plasmodium falciparum} SCOP: c.2.1.2 PDB: 1v35_A* 3lsy_A* 1uh5_A* 3lt1_A* 3lt2_A* 3lt4_A* 3am4_A* 3am3_A* 3am5_A* 2o2y_A* 2oos_A* 2ol4_A* 2op0_A* 2op1_A* 1vrw_A* 1zsn_A* 1zw1_A* 1zxb_A* 1zxl_A* 2foi_A* ... Back     alignment and structure
>3i1j_A Oxidoreductase, short chain dehydrogenase/reducta; dimer, MIXE beta, structural genomics, PSI-2; 1.90A {Pseudomonas syringae PV} SCOP: c.2.1.0 Back     alignment and structure
>2ekp_A 2-deoxy-D-gluconate 3-dehydrogenase; structural genomics, NPPSFA, nation project on protein structural and functional analyses; HET: NAD; 1.15A {Thermus thermophilus} PDB: 1x1e_A* 2ekq_A Back     alignment and structure
>2x9g_A PTR1, pteridine reductase; short chain dehydrogenase, oxidoreductase; HET: NAP LYA; 1.10A {Trypanosoma brucei brucei} PDB: 2x9n_A* 2x9v_A* 3bmc_A* 3bmd_A* 3bme_A* 3bmf_A* 3bmg_A* 3bmh_A* 3bmi_A* 3bmj_A* 3bmk_A* 3bml_A* 3bmm_A* 3bmn_A* 3bmo_A* 3bmq_A* 3bmr_A* 3gn1_A* 3gn2_A* 3jq6_A* ... Back     alignment and structure
>2ag5_A DHRS6, dehydrogenase/reductase (SDR family) member 6; protein-CO-factor complex, structural genomics, structural G consortium, SGC, oxidoreductase; HET: NAD; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>3m1a_A Putative dehydrogenase; short, PSI, MCSG, structural genomics, midwest center for structural genomics, protein structure initiative; 2.00A {Streptomyces avermitilis} Back     alignment and structure
>4e4y_A Short chain dehydrogenase family protein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; 1.80A {Francisella tularensis subsp} Back     alignment and structure
>2bgk_A Rhizome secoisolariciresinol dehydrogenase; oxidoreductase; 1.6A {Podophyllum peltatum} SCOP: c.2.1.2 PDB: 2bgl_A* 2bgm_A* Back     alignment and structure
>1gee_A Glucose 1-dehydrogenase; short-chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 1.60A {Bacillus megaterium} SCOP: c.2.1.2 PDB: 1rwb_A* 1gco_A* 1g6k_A* 3aus_A 3aut_A* 3auu_A* Back     alignment and structure
>2qq5_A DHRS1, dehydrogenase/reductase SDR family member 1; short-chain, structura genomics consortium, SGC, oxidoreductase; 1.80A {Homo sapiens} Back     alignment and structure
>2c07_A 3-oxoacyl-(acyl-carrier protein) reductase; oxidoreductase, FABG, short-chain alcohol reductase, fatty acid biosynthesis, apicoplast; 1.5A {Plasmodium falciparum} SCOP: c.2.1.2 Back     alignment and structure
>3sx2_A Putative 3-ketoacyl-(acyl-carrier-protein) reduct; ssgcid, 3-ketoacyl-(acyl-carrier-protein) reductase, mycobac paratuberculosis; HET: NAD; 1.50A {Mycobacterium avium subsp} Back     alignment and structure
>3kvo_A Hydroxysteroid dehydrogenase-like protein 2; HSDL2, human hydroxysteroid dehydrogenase like 2, SDHL2, STR genomics, structural genomics consortium; HET: NAP; 2.25A {Homo sapiens} Back     alignment and structure
>2wsb_A Galactitol dehydrogenase; oxidoreductase, SDR, rossmann fold, tagatose; HET: NAD; 1.25A {Rhodobacter sphaeroides} PDB: 2wdz_A* 3lqf_A* Back     alignment and structure
>3pxx_A Carveol dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, NAD, tuberculosis; HET: NAD; 2.00A {Mycobacterium avium} SCOP: c.2.1.0 Back     alignment and structure
>3awd_A GOX2181, putative polyol dehydrogenase; oxidoreductase; 1.80A {Gluconobacter oxydans} Back     alignment and structure
>1xq1_A Putative tropinone reducatse; structural genomics, protein structure initiative, CESG, AT1 reductively methylated protein; 2.10A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2q45_A Back     alignment and structure
>2fwm_X 2,3-dihydro-2,3-dihydroxybenzoate dehydrogenase; enterobactin, rossman fold, chorismate metabolism, short-CHA oxidoreductase, tetramer; 2.00A {Escherichia coli} Back     alignment and structure
>3qlj_A Short chain dehydrogenase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, tuberculosis; 1.80A {Mycobacterium avium} Back     alignment and structure
>1edo_A Beta-keto acyl carrier protein reductase; nucleotide fold, rossmann fold, oxidoreductase; HET: NAP; 2.30A {Brassica napus} SCOP: c.2.1.2 PDB: 2cdh_G Back     alignment and structure
>1zk4_A R-specific alcohol dehydrogenase; short chain reductases/dehydrogenases, magnesium dependence, oxidoreductase; HET: NAP; 1.00A {Lactobacillus brevis} SCOP: c.2.1.2 PDB: 1nxq_A* 1zjy_A* 1zjz_A* 1zk0_A* 1zk1_A* 1zk2_A 1zk3_A Back     alignment and structure
>1fmc_A 7 alpha-hydroxysteroid dehydrogenase; short-chain dehydrogenase/reductase, bIle acid catabolism, oxidoreductase; HET: CHO NAD; 1.80A {Escherichia coli} SCOP: c.2.1.2 PDB: 1ahi_A* 1ahh_A* Back     alignment and structure
>2nm0_A Probable 3-oxacyl-(acyl-carrier-protein) reductas; oxidoreductase; 1.99A {Streptomyces coelicolor} Back     alignment and structure
>3l77_A Short-chain alcohol dehydrogenase; oxidoreductase; HET: NJP PG4; 1.60A {Thermococcus sibiricus} SCOP: c.2.1.0 PDB: 3tn7_A* Back     alignment and structure
>1uzm_A 3-oxoacyl-[acyl-carrier protein] reductase; beta-ketoacyl reductase, oxidoreductase; 1.49A {Mycobacterium tuberculosis} SCOP: c.2.1.2 PDB: 1uzn_A* 2ntn_A 1uzl_A Back     alignment and structure
>2dtx_A Glucose 1-dehydrogenase related protein; rossmann fold, oxidoreductase; HET: BMA; 1.60A {Thermoplasma acidophilum} PDB: 2dtd_A* 2dte_A* 2zk7_A Back     alignment and structure
>1h5q_A NADP-dependent mannitol dehydrogenase; oxidoreductase, mannitol metabolism; HET: NAP; 1.50A {Agaricus bisporus} SCOP: c.2.1.2 Back     alignment and structure
>2o23_A HADH2 protein; HSD17B10, schad, ERAB, type II HADH, 2-methyl-3-hydroxybuTyr dehydrogenase, MHBD, structural genomics, structural genomi consortium; HET: NAD GOL; 1.20A {Homo sapiens} SCOP: c.2.1.2 PDB: 1so8_A 1u7t_A* 1e3s_A* 1e3w_B* 1e3w_A* 1e6w_A* Back     alignment and structure
>2pnf_A 3-oxoacyl-[acyl-carrier-protein] reductase; short chain oxidoreductase, rossmann fold, oxidoreductase; HET: 1PE MES; 1.80A {Aquifex aeolicus} PDB: 2p68_A* Back     alignment and structure
>3d3w_A L-xylulose reductase; uronate cycle, short-chain dehydrogenase/reductase(SDR) superfamily, glucose metabolism, acetylation, carbohydrate metabolism; HET: NAP; 1.87A {Homo sapiens} PDB: 1wnt_A* 1pr9_A* Back     alignment and structure
>3afn_B Carbonyl reductase; alpha/beta/alpha, rossmann-fold, oxidoreductase; HET: NAP; 1.63A {Sphingomonas SP} PDB: 3afm_A* Back     alignment and structure
>3ioy_A Short-chain dehydrogenase/reductase SDR; structural genomics, oxidoreductase, PSI-2, protein structure initiative; 1.90A {Novosphingobium aromaticivorans DSM12444} Back     alignment and structure
>2ph3_A 3-oxoacyl-[acyl carrier protein] reductase; TTHA0415, structural genomics, southea collaboratory for structural genomics, secsg; 1.91A {Thermus thermophilus HB8} Back     alignment and structure
>3uce_A Dehydrogenase; rossmann fold, oxidoreductase; HET: NDP; 1.80A {Vibrio vulnificus} Back     alignment and structure
>2hq1_A Glucose/ribitol dehydrogenase; CTH-1438, structural genomics, southeast collaboratory for structural genomics, secsg, PSI; 1.90A {Clostridium thermocellum} Back     alignment and structure
>3u9l_A 3-oxoacyl-[acyl-carrier-protein] reductase; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc; 2.10A {Sinorhizobium meliloti} Back     alignment and structure
>2pd6_A Estradiol 17-beta-dehydrogenase 8; short-chain dehydrogenase/reductase, steroid metabolism, LIP metabolism, structural genomics; HET: NAD; 2.00A {Homo sapiens} Back     alignment and structure
>3u0b_A Oxidoreductase, short chain dehydrogenase/reducta protein; structural genomics, ssgcid; 1.70A {Mycobacterium smegmatis} PDB: 3lls_A 3v1t_C 3v1u_A* 4fw8_A* 3q6i_A* 3m1l_A Back     alignment and structure
>1w6u_A 2,4-dienoyl-COA reductase, mitochondrial precursor; short chain dehydrogenase, beta- oxidation, NADP, oxidoreductase; HET: HXC NAP; 1.75A {Homo sapiens} SCOP: c.2.1.2 PDB: 1w73_A* 1w8d_A* Back     alignment and structure
>1cyd_A Carbonyl reductase; short-chain dehydrogenase, oxidoreductase; HET: NAP; 1.80A {Mus musculus} SCOP: c.2.1.2 Back     alignment and structure
>1zmo_A Halohydrin dehalogenase; haloalcohol dehalogenase, short- chain dehydrogenase/reductase family, lyase; 2.00A {Arthrobacter SP} Back     alignment and structure
>1zmt_A Haloalcohol dehalogenase HHEC; halohydrin dehalogenase, epoxide catalysis, enantioselectivity, lyase; HET: RNO; 1.70A {Agrobacterium tumefaciens} SCOP: c.2.1.2 PDB: 1pwz_A 1px0_A* 1pwx_A* 1zo8_A* Back     alignment and structure
>1yxm_A Pecra, peroxisomal trans 2-enoyl COA reductase; perioxisomes, fatty acid synthesis, short-chain dehydrogenases/reductases, structural genomics; HET: ADE; 1.90A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>4eue_A Putative reductase CA_C0462; TER, biofuel, synthetic biology, catalytic mechan substrate specificity, oxidoreductase; HET: NAI; 2.00A {Clostridium acetobutylicum} PDB: 4euf_A* 4euh_A* Back     alignment and structure
>3ctm_A Carbonyl reductase; alcohol dehydrogenase, short-chain dehydrogenases/reductases (SDR), X-RAY crystallography, oxidoreductase; 2.69A {Candida parapsilosis} Back     alignment and structure
>2bd0_A Sepiapterin reductase; oxidoreductase; HET: NAP BIO; 1.70A {Chlorobium tepidum} SCOP: c.2.1.2 Back     alignment and structure
>1xg5_A ARPG836; short chain dehydrogenase, human, SGC, structural genomics, structural genomics consortium, oxidoreductase; HET: NAP; 1.53A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>1ja9_A 4HNR, 1,3,6,8-tetrahydroxynaphthalene reductase; protein-NADPH-active site inhibitor complex, oxidoreductase, chain dehydrogenase; HET: NDP PYQ; 1.50A {Magnaporthe grisea} SCOP: c.2.1.2 Back     alignment and structure
>3rd5_A Mypaa.01249.C; ssgcid, structural genomics, seattle structural genomics CEN infectious disease, oxidoreductase; HET: EPE; 1.50A {Mycobacterium paratuberculosis} Back     alignment and structure
>1yb1_A 17-beta-hydroxysteroid dehydrogenase type XI; short chain dehydrogenase, HUM structural genomics, structural genomics consortium, SGC; HET: AE2; 1.95A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2ehd_A Oxidoreductase, oxidoreductase, short-chain dehydrogenase/reducta; rossman fold, structural genomics, NPPSFA; 2.40A {Thermus thermophilus} Back     alignment and structure
>3o26_A Salutaridine reductase; short chain dehydrogenase/reductases, oxidoreductase; HET: NDP; 1.91A {Papaver somniferum} SCOP: c.2.1.0 Back     alignment and structure
>2o2s_A Enoyl-acyl carrier reductase; enoyl reductase, triclosan, rossmann fold, oxidoreductase; HET: NAD TCL; 2.60A {Toxoplasma gondii} PDB: 2o50_A 3nj8_A* Back     alignment and structure
>3orf_A Dihydropteridine reductase; alpha-beta-alpha sandwich, rossmann fold, oxidoreductase (AC NADH), NADH binding, oxidoreductase; HET: NAD; 2.16A {Dictyostelium discoideum} Back     alignment and structure
>1o5i_A 3-oxoacyl-(acyl carrier protein) reductase; TM1169, structur genomics, JCSG, PSI, protein structure initiative, joint CE structural genomics; HET: NAD; 2.50A {Thermotoga maritima} SCOP: c.2.1.2 Back     alignment and structure
>1jtv_A 17 beta-hydroxysteroid dehydrogenase type 1; steroid hormones, alternative binding mode, oxidoreductase; HET: TES; 1.54A {Homo sapiens} SCOP: c.2.1.2 PDB: 1dht_A* 1equ_A* 1bhs_A* 1i5r_A* 1qyv_A* 1qyw_A* 1qyx_A* 3dey_X* 3dhe_A* 3hb4_X* 3hb5_X* 3klp_X* 3km0_A* 1iol_A* 1fds_A* 1fdt_A* 3klm_X* 1fdw_A* 1fdu_A* 1fdv_A* ... Back     alignment and structure
>3e9n_A Putative short-chain dehydrogenase/reductase; structural genomics, unknown function, oxidoreductase, PSI- 2; 2.40A {Corynebacterium glutamicum} Back     alignment and structure
>1d7o_A Enoyl-[acyl-carrier protein] reductase (NADH) PRE; triclosan, enoyl reductase, oxidoreductase; HET: NAD TCL; 1.90A {Brassica napus} SCOP: c.2.1.2 PDB: 1eno_A* 1enp_A* 1cwu_A* Back     alignment and structure
>1dhr_A Dihydropteridine reductase; oxidoreductase(acting on NADH or NADPH); HET: NAD; 2.30A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1dir_A* 1hdr_A* Back     alignment and structure
>2ptg_A Enoyl-acyl carrier reductase; apicomplexa, enoyl (acyl-carrier-P reductase, oxidoreductase; 2.60A {Eimeria tenella} Back     alignment and structure
>2gdz_A NAD+-dependent 15-hydroxyprostaglandin dehydrogen; dehydrogenase, structural genomics, SH dehydrogenase/reductase, inflammation; HET: NAD; 1.65A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1ooe_A Dihydropteridine reductase; structural genomics, PSI, protein structure initiative, southeast collaboratory for structural genomics; HET: MES; 1.65A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1xu9_A Corticosteroid 11-beta-dehydrogenase, isozyme 1; hydroxysteroid, SDR, oxidoreductase; HET: NDP CPS MES; 1.55A {Homo sapiens} SCOP: c.2.1.2 PDB: 1xu7_A* 3bzu_A* 3czr_A* 3d3e_A* 3d4n_A* 3fco_A* 3frj_A* 3h6k_A* 3hfg_A* 3oq1_A* 3qqp_A* 3pdj_A* 3d5q_A* 2rbe_A* 3byz_A* 3ey4_A* 3tfq_A* 3ch6_A* 2irw_A* 2ilt_A* ... Back     alignment and structure
>1uay_A Type II 3-hydroxyacyl-COA dehydrogenase; beta oxidation, fatty acid, structural genomi structural genomics/proteomics initiative, RSGI; HET: ADN; 1.40A {Thermus thermophilus} SCOP: c.2.1.2 Back     alignment and structure
>2et6_A (3R)-hydroxyacyl-COA dehydrogenase; MFE-2, beta-oxidation, peroxisome, SDR, oxido; 2.22A {Candida tropicalis} Back     alignment and structure
>1gz6_A Estradiol 17 beta-dehydrogenase 4; 17BETA-HSD4, MFE-2, beta-oxidation, peroxisome, SDR, steroid biosynthesis, oxidoreductase, NADP; HET: NAI; 2.38A {Rattus norvegicus} SCOP: c.2.1.2 PDB: 1zbq_A* Back     alignment and structure
>1yo6_A Putative carbonyl reductase sniffer; tyrosine-dependent oxidoreductase (SDR family), structural genomics, PSI; 2.60A {Caenorhabditis elegans} SCOP: c.2.1.2 Back     alignment and structure
>1sny_A Sniffer CG10964-PA; alpha and beta protein, rossmann fold, dinucleotide binding oxidoreductase; HET: NAP; 1.75A {Drosophila melanogaster} SCOP: c.2.1.2 Back     alignment and structure
>3oml_A GH14720P, peroxisomal multifunctional enzyme type 2, CG3415; rossmann fold, hot-DOG fold, hydratase 2 motif, peroxisomes, oxidoreductase; 2.15A {Drosophila melanogaster} Back     alignment and structure
>2yut_A Putative short-chain oxidoreductase; alpha and beta proteins (A/B), NAD(P)-binding rossmann-fold structural genomics, NPPSFA; HET: NAP; 2.20A {Thermus thermophilus} Back     alignment and structure
>1sby_A Alcohol dehydrogenase; ternary complex, NAD, trifluoroethanol, oxidoreductase; HET: NAD; 1.10A {Scaptodrosophila lebanonensis} SCOP: c.2.1.2 PDB: 1b14_A* 1b15_A* 1a4u_A* 1b2l_A* 1b16_A* 3rj5_A* 3rj9_A* 1mg5_A* Back     alignment and structure
>1wma_A Carbonyl reductase [NADPH] 1; oxidoreductase; HET: AB3 NDP PE5 P33; 1.24A {Homo sapiens} SCOP: c.2.1.2 PDB: 3bhi_A* 3bhj_A* 3bhm_A* 2pfg_A* 1n5d_A* 2hrb_A* Back     alignment and structure
>1fjh_A 3alpha-hydroxysteroid dehydrogenase/carbonyl reductase; short chain dehydrogenase, SDR, xenobiotic, metyrapone, oligomerisation; 1.68A {Comamonas testosteroni} SCOP: c.2.1.2 PDB: 1fk8_A* Back     alignment and structure
>3d7l_A LIN1944 protein; APC89317, structural genomics, PS protein structure initiative, midwest center for structural genomics, MCSG; 2.06A {Listeria innocua} Back     alignment and structure
>2uv8_A Fatty acid synthase subunit alpha (FAS2); fatty acid biosynthesis, malonyl/palmitoyl transferase, phosphopantetheine, transferase; HET: GVL FMN; 3.10A {Saccharomyces cerevisiae} PDB: 2vkz_A* 3hmj_A* Back     alignment and structure
>3qp9_A Type I polyketide synthase pikaii; rossmann fold, ketoreductase, epimerization, oxidoreductase; 1.88A {Streptomyces venezuelae} Back     alignment and structure
>3slk_A Polyketide synthase extender module 2; rossmann fold, NADPH, oxidoreductase; HET: NDP; 3.00A {Saccharopolyspora spinosa} Back     alignment and structure
>2uv9_A Fatty acid synthase alpha subunits; fungal, dehydratase, enoyl reductase, ketoacyl synthase, ketoacyl reductase; 3.1A {Thermomyces lanuginosus} PDB: 2uvb_A* Back     alignment and structure
>2pff_A Fatty acid synthase subunit alpha, 3-oxoacyl-[acyl-carrier-PR; fatty acid synthase, acyl-carrier-protein, beta-ketoacyl RED beta-ketoacyl synthase, dehydratase; 4.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3mje_A AMPHB; rossmann fold, oxidoreductase; HET: NDP; 1.36A {Streptomyces nodosus} PDB: 3mjc_A* 3mjs_A* 3mjv_A* 3mjt_A* Back     alignment and structure
>2fr1_A Erythromycin synthase, eryai; short chain dehydrogenase/reductase, oxidoreductase; HET: NDP; 1.79A {Saccharopolyspora erythraea} SCOP: c.2.1.2 c.2.1.2 PDB: 2fr0_A* Back     alignment and structure
>2z5l_A Tylkr1, tylactone synthase starter module and modules 1 & 2; short-chain dehydrogenase/reductase, rossman fold; 1.95A {Streptomyces fradiae} Back     alignment and structure
>2dkn_A 3-alpha-hydroxysteroid dehydrogenase; oxidoreductase, rossmann fold; HET: NAI; 1.80A {Pseudomonas SP} Back     alignment and structure
>3zen_D Fatty acid synthase; transferase, mycolic acid biosynthesis, multifunctional ENZY substrate channeling; HET: FMN; 7.50A {Mycobacterium smegmatis} PDB: 4b3y_A* Back     alignment and structure
>3rft_A Uronate dehydrogenase; apoenzyme, rossmann fold, NAD binding, oxidoreductase; 1.90A {Agrobacterium tumefaciens} PDB: 3rfv_A* 3rfx_A* Back     alignment and structure
>2gn4_A FLAA1 protein, UDP-GLCNAC C6 dehydratase; rossmann fold, TYK triad, SDR, enzyme, NADP, NADPH, lyase; HET: NDP UD1 MES; 1.90A {Helicobacter pylori} PDB: 2gn6_A* 2gn8_A* 2gn9_A* 2gna_A* Back     alignment and structure
>1orr_A CDP-tyvelose-2-epimerase; rossmann fold, short-chain dehydrogenase/reductase, isomeras; HET: NAD CDP; 1.50A {Salmonella typhi} SCOP: c.2.1.2 Back     alignment and structure
>2vz8_A Fatty acid synthase; transferase, phosphopantetheine, multienzyme, megasynthase, fatty acid synthesis; 3.2A {Sus scrofa} PDB: 2vz9_A* Back     alignment and structure
>3enk_A UDP-glucose 4-epimerase; seattle structural genomics center for infectious disease, ssgcid, isomerase, NAD; HET: NAD GUD; 1.90A {Burkholderia pseudomallei 1710B} SCOP: c.2.1.0 Back     alignment and structure
>1rkx_A CDP-glucose-4,6-dehydratase; SDR, lyase; HET: NAD; 1.80A {Yersinia pseudotuberculosis} SCOP: c.2.1.2 PDB: 1wvg_A* Back     alignment and structure
>1y1p_A ARII, aldehyde reductase II; rossmann fold, short chain dehydrogenase reductase, oxidoreductase; HET: NMN AMP; 1.60A {Sporidiobolus salmonicolor} SCOP: c.2.1.2 PDB: 1ujm_A* 1zze_A Back     alignment and structure
>4ggo_A Trans-2-enoyl-COA reductase; rossmann fold, oxidoreductase; 2.00A {Treponema denticola atcc 35405} PDB: 4ggp_A Back     alignment and structure
>2bka_A CC3, TAT-interacting protein TIP30; NADPH, PEG600, transcription; HET: NDP PE8; 1.7A {Homo sapiens} SCOP: c.2.1.2 PDB: 2fmu_A Back     alignment and structure
>3e8x_A Putative NAD-dependent epimerase/dehydratase; structural genomics, APC7755, NADP, P protein structure initiative; HET: MSE NAP; 2.10A {Bacillus halodurans} Back     alignment and structure
>2pk3_A GDP-6-deoxy-D-LYXO-4-hexulose reductase; SDR, short-chain dehydrogenase/reductase, rossmann fold, oxidoreductase; HET: A2R GDD; 1.82A {Aneurinibacillus thermoaerophilus} Back     alignment and structure
>1i24_A Sulfolipid biosynthesis protein SQD1; SDR, short-chain dehydrogenase/reductase, rossmann fold, BIO protein; HET: NAD UPG; 1.20A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1i2c_A* 1i2b_A* 1qrr_A* Back     alignment and structure
>1gy8_A UDP-galactose 4-epimerase; oxidoreductase; HET: NAD UDP; 2.0A {Trypanosoma brucei} SCOP: c.2.1.2 PDB: 2cnb_A* Back     alignment and structure
>1sb8_A WBPP; epimerase, 4-epimerase, UDP-galnac, UDP-GLCNAC, SDR, G SYK, UDP, N-acetylglucosamine, N- acetylgalactosamine, UDP-GLC, isomerase; HET: NAD UD2; 2.10A {Pseudomonas aeruginosa} SCOP: c.2.1.2 PDB: 1sb9_A* Back     alignment and structure
>3dqp_A Oxidoreductase YLBE; alpha-beta protein., structural genomics, PSI-2, protein structure initiative; 1.40A {Lactococcus lactis subsp} Back     alignment and structure
>2z1m_A GDP-D-mannose dehydratase; short-chain dehydrogenase/reductase, lyase, structural genom NPPSFA; HET: NDP GDP; 2.00A {Aquifex aeolicus} PDB: 2z95_A* Back     alignment and structure
>2hun_A 336AA long hypothetical DTDP-glucose 4,6-dehydrat; rossmann fold, structural genomics, NPPSFA; HET: NAD; 2.07A {Pyrococcus horikoshii} Back     alignment and structure
>1kew_A RMLB;, DTDP-D-glucose 4,6-dehydratase; rossmann fold, lyase; HET: TYD NAD; 1.80A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1g1a_A* 1keu_A* 1bxk_A* Back     alignment and structure
>2p5y_A UDP-glucose 4-epimerase; TTHA0591, structural genomics, PSI; HET: NAD; 1.92A {Thermus thermophilus HB8} PDB: 2p5u_A* Back     alignment and structure
>1xq6_A Unknown protein; structural genomics, protein structure initiative, CESG, AT5G02240, NADP, center for eukaryotic structural genomics; HET: NAP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1ybm_A* 2q46_A* 2q4b_A* Back     alignment and structure
>3r6d_A NAD-dependent epimerase/dehydratase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, veillo parvula; HET: MLZ; 1.25A {Veillonella parvula dsm 2008} PDB: 4hng_A 4hnh_A* 3r14_A* Back     alignment and structure
>3ay3_A NAD-dependent epimerase/dehydratase; glucuronic acid dehydrogeanse, oxidoreductase; 2.10A {Chromohalobacter salexigens} Back     alignment and structure
>2c29_D Dihydroflavonol 4-reductase; flavonoids, short dehydrogenase reductase, NADPH, dihydroquercetin, rossmann fold, oxidoreductase; HET: NAP DQH; 1.81A {Vitis vinifera} PDB: 2iod_A* 2nnl_D* 3bxx_A* 3c1t_A* Back     alignment and structure
>3dhn_A NAD-dependent epimerase/dehydratase; reductase, PF01370, Q89Z24_bactn, NESG, BTR310, structural genomics, PSI-2; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3ruf_A WBGU; rossmann fold, UDP-hexose 4-epimerase, isomerase; HET: NAD UDP; 2.00A {Plesiomonas shigelloides} SCOP: c.2.1.2 PDB: 3ru9_A* 3rud_A* 3rue_A* 3rua_A* 3ruh_A* 3ruc_A* 3ru7_A* 3lu1_A* Back     alignment and structure
>2x4g_A Nucleoside-diphosphate-sugar epimerase; isomerase; 2.65A {Pseudomonas aeruginosa} Back     alignment and structure
>3ko8_A NAD-dependent epimerase/dehydratase; isomerase, UDP-galactose 4-epimerase; HET: NAD; 1.80A {Pyrobaculum calidifontis} SCOP: c.2.1.0 PDB: 3icp_A* 3aw9_A* Back     alignment and structure
>2c20_A UDP-glucose 4-epimerase; carbohydrate metabolism, galactose metabolism, isomerase, NAD, spine; HET: NAD; 2.7A {Bacillus anthracis} Back     alignment and structure
>1ek6_A UDP-galactose 4-epimerase; short-chain dehydrogenase, galactosemia, isomerase; HET: NAI UPG; 1.50A {Homo sapiens} SCOP: c.2.1.2 PDB: 1ek5_A* 1hzj_A* 1i3k_A* 1i3l_A* 1i3m_A* 1i3n_A* Back     alignment and structure
>1oc2_A DTDP-glucose 4,6-dehydratase; lyase, NADH, rhamnose; HET: TDX NAD; 1.5A {Streptococcus suis} SCOP: c.2.1.2 PDB: 1ker_A* 1ket_A* 1kep_A* Back     alignment and structure
>3h2s_A Putative NADH-flavin reductase; Q03B84, NESG, LCR19, structural genomics, PSI-2, protein structure initiative; HET: NDP; 1.78A {Lactobacillus casei atcc 334} Back     alignment and structure
>2pzm_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, protein-nucleotide comple binding protein; HET: NAD UDP; 2.00A {Bordetella bronchiseptica} PDB: 2pzl_A* 2pzk_A* Back     alignment and structure
>1r6d_A TDP-glucose-4,6-dehydratase; rossmann fold, short-chain dehydrogenase/reductase, lyase; HET: NAD DAU; 1.35A {Streptomyces venezuelae} SCOP: c.2.1.2 PDB: 1r66_A* Back     alignment and structure
>2c5a_A GDP-mannose-3', 5'-epimerase; short chain dehydratase/reductase, GDP-gulose, GDP-galactose, keto intermediate, vitamin C, SDR; HET: GDC NAD BTB; 1.4A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 2c59_A* 2c54_A* 2c5e_A* Back     alignment and structure
>3ehe_A UDP-glucose 4-epimerase (GALE-1); PSI-II, NYSGXRC, ST genomics, protein structure initiative, NEW YORK SGX resear for structural genomics; HET: NAD; 1.87A {Archaeoglobus fulgidus} SCOP: c.2.1.0 Back     alignment and structure
>4egb_A DTDP-glucose 4,6-dehydratase; rhamnose pathway, center for structural genomics of infectio diseases, csgid, niaid; HET: NAD SUC; 3.00A {Bacillus anthracis} Back     alignment and structure
>1db3_A GDP-mannose 4,6-dehydratase; NADP, GDP-fucose, lyase; 2.30A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1udb_A Epimerase, UDP-galactose-4-epimerase; isomerase; HET: NAD UFG; 1.65A {Escherichia coli} SCOP: c.2.1.2 PDB: 1lrj_A* 1nai_A* 1uda_A* 1nah_A* 1xel_A* 1kvq_A* 1kvs_A* 1udc_A* 2udp_A* 1a9z_A* 1kvt_A* 1kvr_A* 1lrk_A* 1lrl_A* 1kvu_A* 1a9y_A* Back     alignment and structure
>2p4h_X Vestitone reductase; NADPH-dependent reductase, isoflavonoid, plant protein; 1.40A {Medicago sativa} Back     alignment and structure
>1hdo_A Biliverdin IX beta reductase; foetal metabolism, HAEM degradation, flavin reductase, diaphorase, green HAEM binding protein; HET: NAP; 1.15A {Homo sapiens} SCOP: c.2.1.2 PDB: 1he2_A* 1he3_A* 1he4_A* 1he5_A* Back     alignment and structure
>1rpn_A GDP-mannose 4,6-dehydratase; short-chain dehydrogenase/reductase, rossmann fold, lyase; HET: NDP GDP; 2.15A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>1t2a_A GDP-mannose 4,6 dehydratase; structural genomics consortium, rossman-fold, short-chain dehydrogenase/reductase, SDR, structural genomics,lyase; HET: NDP GDP; 1.84A {Homo sapiens} SCOP: c.2.1.2 Back     alignment and structure
>2bll_A Protein YFBG; decarboxylase, short chain dehydrogenase, L-ARA4N biosynthes methyltransferase, transferase; 2.3A {Escherichia coli} SCOP: c.2.1.2 PDB: 1u9j_A 1z73_A 1z75_A 1z7b_A 1z74_A Back     alignment and structure
>4id9_A Short-chain dehydrogenase/reductase; putative dehydrogenase, enzyme function initiative, EFI, STR genomics, oxidoreductase; HET: NAD; 1.60A {Agrobacterium fabrum} PDB: 4idg_A* Back     alignment and structure
>2q1w_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NAD complex, sugar binding protein; HET: NAD; 2.19A {Bordetella bronchiseptica} Back     alignment and structure
>3slg_A PBGP3 protein; structural genomics, seattle structural genomics center for infectious disease, ssgcid, melioidosis, glanders; 2.10A {Burkholderia pseudomallei} Back     alignment and structure
>2rh8_A Anthocyanidin reductase; flavonoids, rossmann fold, short chain dehydrogenase/reductase, oxidoreductase; 2.22A {Vitis vinifera} PDB: 3hfs_A Back     alignment and structure
>4f6c_A AUSA reductase domain protein; thioester reductase, oxidoreductase; 2.81A {Staphylococcus aureus} Back     alignment and structure
>2yy7_A L-threonine dehydrogenase; thermolabIle, flavobacterium FRIG KUC-1, oxidoreductase; HET: PE8 NAD MES; 2.06A {Flavobacterium frigidimaris} Back     alignment and structure
>2q1s_A Putative nucleotide sugar epimerase/ dehydratase; rossman fold, protein-NADH complex, sugar binding protein; HET: NAI; 1.50A {Bordetella bronchiseptica} PDB: 2pzj_A* 2q1t_A* 2q1u_A* Back     alignment and structure
>2hrz_A AGR_C_4963P, nucleoside-diphosphate-sugar epimerase; agrobacterium tumefa structural genomics, PSI-2, protein structure initiative; 1.85A {Agrobacterium tumefaciens} Back     alignment and structure
>1n7h_A GDP-D-mannose-4,6-dehydratase; rossmann fold, SDR, short-chain dehydrogenase/reductase, LYA; HET: NDP GDP; 1.80A {Arabidopsis thaliana} SCOP: c.2.1.2 PDB: 1n7g_A* Back     alignment and structure
>3ew7_A LMO0794 protein; Q8Y8U8_lismo, putative NAD-dependent epimerase/dehydratase, LMR162, NESG, structural genomics, PSI-2; 2.73A {Listeria monocytogenes} Back     alignment and structure
>2x6t_A ADP-L-glycero-D-manno-heptose-6-epimerase; isomerase, carbohydrate metabolism, stress response; HET: NAP ADP BMA; 2.36A {Escherichia coli} PDB: 2x86_A* Back     alignment and structure
>3ajr_A NDP-sugar epimerase; L-threonine dehydrogenase, L-3- hydroxynorvaline, oxidoreductase; HET: NAD; 1.77A {Thermoplasma volcanium} PDB: 3a9w_A* 3a4v_A* 3a1n_A* Back     alignment and structure
>3m2p_A UDP-N-acetylglucosamine 4-epimerase; SGXNY, 11155J, isomerase, structural genomics, PSI-2, protein structure initiative; HET: UDP; 2.95A {Bacillus cereus} Back     alignment and structure
>3sxp_A ADP-L-glycero-D-mannoheptose-6-epimerase; rossman fold, NAD binding, isomerase; HET: NAD; 2.55A {Helicobacter pylori} Back     alignment and structure
>2b69_A UDP-glucuronate decarboxylase 1; UDP-glucoronic acid decarboxylase, structural genomics, STRU genomics consortium, SGC, lyase; HET: MSE NAD UDP; 1.21A {Homo sapiens} SCOP: c.2.1.2 PDB: 4ef7_A* Back     alignment and structure
>2ydy_A Methionine adenosyltransferase 2 subunit beta; oxidoreductase; 2.25A {Homo sapiens} PDB: 2ydx_A Back     alignment and structure
>1z45_A GAL10 bifunctional protein; epimerase, mutarotase, metabolism, isomerase; HET: GAL NAD GUD; 1.85A {Saccharomyces cerevisiae} SCOP: b.30.5.4 c.2.1.2 Back     alignment and structure
>1z7e_A Protein aRNA; rossmann fold, OB-like fold, hydrolase; HET: ATP UGA; 3.00A {Escherichia coli} SCOP: b.46.1.1 c.2.1.2 c.65.1.1 Back     alignment and structure
>3qvo_A NMRA family protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; HET: MNB; 2.30A {Shigella flexneri 2A} Back     alignment and structure
>1eq2_A ADP-L-glycero-D-mannoheptose 6-epimerase; N-terminal domain rossmann fold, C-terminal mixed alpha/beta domain; HET: NAP ADQ; 2.00A {Escherichia coli} SCOP: c.2.1.2 Back     alignment and structure
>1e6u_A GDP-fucose synthetase; epimerase/reductase, SDR, RED; HET: NAP; 1.45A {Escherichia coli} SCOP: c.2.1.2 PDB: 1e7q_A* 1bsv_A* 1fxs_A* 1gfs_A 1e7s_A* 1bws_A* 1e7r_A* Back     alignment and structure
>1vl0_A DTDP-4-dehydrorhamnose reductase, RFBD ortholog; structural joint center for structural genomics, JCSG, protein structu initiative; HET: NAI UNL; 2.05A {Clostridium acetobutylicum} SCOP: c.2.1.2 Back     alignment and structure
>2a35_A Hypothetical protein PA4017; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.2.1.2 Back     alignment and structure
>3gpi_A NAD-dependent epimerase/dehydratase; structural genomics, unknown function, PSI-2, protein structure initiative; 1.44A {Methylobacillus flagellatus KT} Back     alignment and structure
>4dqv_A Probable peptide synthetase NRP (peptide synthase; GXXGXXG motif, rossmann fold, short chain dehydrogenase/REDU family, reductase; 2.30A {Mycobacterium tuberculosis} Back     alignment and structure
>1n2s_A DTDP-4-, DTDP-glucose oxidoreductase; rossman-fold, sugar-nucleotide-binding domain; HET: NAD; 2.00A {Salmonella enterica subsp} SCOP: c.2.1.2 PDB: 1kc1_A* 1kc3_A* 1kbz_A* Back     alignment and structure
>3sc6_A DTDP-4-dehydrorhamnose reductase; RFBD, structural genomics, infectious diseases, bacillus anthracis STR. AMES, rhamnose biosynthetic pathway; HET: NAP; 2.65A {Bacillus anthracis} SCOP: c.2.1.0 Back     alignment and structure
>2zcu_A Uncharacterized oxidoreductase YTFG; alpha-beta sandwich; 1.80A {Escherichia coli} PDB: 2zcv_A* Back     alignment and structure
>2jl1_A Triphenylmethane reductase; oxidoreductase, bioremediation; HET: NAP GOL; 1.96A {Citrobacter SP} PDB: 2vrb_A* 2vrc_A 2vrc_D Back     alignment and structure
>4b8w_A GDP-L-fucose synthase; oxidoreductase; HET: NAP GDP; 2.75A {Homo sapiens} Back     alignment and structure
>4f6l_B AUSA reductase domain protein; thioester reductase, oxidoreductase; 3.86A {Staphylococcus aureus} Back     alignment and structure
>2ggs_A 273AA long hypothetical DTDP-4-dehydrorhamnose reductase; alpha, beta, oxidoreductase; HET: NDP; 1.70A {Sulfolobus tokodaii} Back     alignment and structure
>2wm3_A NMRA-like family domain containing protein 1; unknown function; HET: NAP NFL; 1.85A {Homo sapiens} PDB: 2wmd_A* 2exx_A* 3dxf_A 3e5m_A Back     alignment and structure
>1xgk_A Nitrogen metabolite repression regulator NMRA; rossmann fold, transcriptional regulation, short chain dehyd reductase, NADP binding; 1.40A {Emericella nidulans} SCOP: c.2.1.2 PDB: 1k6x_A* 1k6j_A 1k6i_A* 1ti7_A* 2vus_A 2vut_A* 2vuu_A* Back     alignment and structure
>3ius_A Uncharacterized conserved protein; APC63810, silicibacter pomeroyi DSS, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.66A {Ruegeria pomeroyi dss-3} Back     alignment and structure
>3vps_A TUNA, NAD-dependent epimerase/dehydratase; tunicamycins, biosynthesis, EXO-glycal, rossman transferase; HET: UD1 NAD; 1.90A {Streptomyces chartreusis} Back     alignment and structure
>3st7_A Capsular polysaccharide synthesis enzyme CAP5F; rossmann fold, cupid domain, short-chain dehydrogenase/reduc NADPH; 2.45A {Staphylococcus aureus} PDB: 2zkl_A 3vhr_A Back     alignment and structure
>1qyd_A Pinoresinol-lariciresinol reductase; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.50A {Thuja plicata} SCOP: c.2.1.2 Back     alignment and structure
>2gas_A Isoflavone reductase; NADPH-dependent reductase, oxidoreductase; 1.60A {Medicago sativa} Back     alignment and structure
>3i6i_A Putative leucoanthocyanidin reductase 1; rossmann fold, short chain dehydrogenase reductase, flavonoi oxidoreductase; HET: NDP; 1.75A {Vitis vinifera} PDB: 3i5m_A 3i52_A* 3i6q_A* Back     alignment and structure
>3e48_A Putative nucleoside-diphosphate-sugar epimerase; alpha-beta protein., structural genomics, PSI-2, protein STR initiative; 1.60A {Staphylococcus aureus subsp} Back     alignment and structure
>3c1o_A Eugenol synthase; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, oxidoreductase; HET: NAP; 1.80A {Clarkia breweri} Back     alignment and structure
>1qyc_A Phenylcoumaran benzylic ether reductase PT1; NADPH-dependent aromatic alcohol reductases, pcber, PLR, IFR, lignans, isoflavonoids, plant protein; 2.20A {Pinus taeda} SCOP: c.2.1.2 Back     alignment and structure
>3gxh_A Putative phosphatase (DUF442); YP_001181608.1, structural GE joint center for structural genomics, JCSG; HET: MSE; 1.40A {Shewanella putrefaciens cn-32} PDB: 3gxg_A* Back     alignment and structure
>2r6j_A Eugenol synthase 1; phenylpropene, PIP reductase, short-chain dehydrogenase/reductase, plant protein; HET: NDP; 1.50A {Ocimum basilicum} PDB: 2qys_A 2qx7_A* 2qzz_A* 2r2g_A* 3c3x_A* 2qw8_A* Back     alignment and structure
>2v6g_A Progesterone 5-beta-reductase; tyrosine-dependent oxidoreductase, oxidoreductase, SDR, cardenolides, cardiac glycosides; HET: NAP; 2.3A {Digitalis lanata} PDB: 2v6f_A* Back     alignment and structure
>3oh8_A Nucleoside-diphosphate sugar epimerase (SULA FAMI; DUF1731_C, northeast structural genomics consortium, NESG, C PSI-biology; 2.00A {Corynebacterium glutamicum} Back     alignment and structure
>1lu9_A Methylene tetrahydromethanopterin dehydrogenase; alpha/beta twisted open sheet structure, oxidoreductase; 1.90A {Methylobacterium extorquens} SCOP: c.2.1.7 c.58.1.4 PDB: 1lua_A* Back     alignment and structure
>1y7t_A Malate dehydrogenase; NAD-dependent-MDH-NADPH complex, oxidoreductase; HET: NDP; 1.65A {Thermus thermophilus} SCOP: c.2.1.5 d.162.1.1 PDB: 1iz9_A* 2cvq_A* 1bmd_A* 1bdm_A* 1wze_A* 1wzi_A* Back     alignment and structure
>4b4o_A Epimerase family protein SDR39U1; isomerase; HET: NDP PE4; 2.70A {Homo sapiens} Back     alignment and structure
>3ic5_A Putative saccharopine dehydrogenase; structural genomics, APC63807.2, N-terminal domain, saccharo dehydrogenase, PSI-2; HET: MSE; 2.08A {Ruegeria pomeroyi} Back     alignment and structure
>4ina_A Saccharopine dehydrogenase; structural genomics, PSI-biology, northeast structural genom consortium, NESG, oxidoreductas; 2.49A {Wolinella succinogenes} Back     alignment and structure
>1ff9_A Saccharopine reductase; lysine biosynthesis, alpha-aminoadipate pathway, dehydrogenase, oxidoreductase; 2.00A {Magnaporthe grisea} SCOP: c.2.1.3 d.81.1.2 PDB: 1e5l_A* 1e5q_A Back     alignment and structure
>1u7z_A Coenzyme A biosynthesis bifunctional protein coabc; ligase; HET: PMT; 2.30A {Escherichia coli} SCOP: c.72.3.1 PDB: 1u7w_A* 1u7u_A* 1u80_A* Back     alignment and structure
>2axq_A Saccharopine dehydrogenase; rossmann fold variant, saccharopine reductase fold (domain II), alpha/beta protein; 1.70A {Saccharomyces cerevisiae} Back     alignment and structure
>1v3u_A Leukotriene B4 12- hydroxydehydrogenase/prostaglandin 15-keto reductase; rossmann fold, riken structural genomics/proteomics initiative, RSGI; 2.00A {Cavia porcellus} SCOP: b.35.1.2 c.2.1.1 PDB: 1v3t_A 1v3v_A* 2dm6_A* 1zsv_A 2y05_A* Back     alignment and structure
>3llv_A Exopolyphosphatase-related protein; NAD(P)-binding, rossmann, PSI, M structural genomics; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>3abi_A Putative uncharacterized protein PH1688; L-lysine dehydrogenase, oxidoreductase; HET: NAD; 2.44A {Pyrococcus horikoshii} Back     alignment and structure
>2o7s_A DHQ-SDH PR, bifunctional 3-dehydroquinate dehydratase/shikima dehydrogenase; shikimate, NADPH, dehydroshikimate, bifunctional enzyme; HET: DHK TLA NAP; 1.78A {Arabidopsis thaliana} PDB: 2o7q_A* 2gpt_A* Back     alignment and structure
>1qor_A Quinone oxidoreductase; HET: NAP; 2.20A {Escherichia coli} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>1pqw_A Polyketide synthase; rossmann fold, dimer, structural genomics, PSI, protein STRU initiative; 2.66A {Mycobacterium tuberculosis} SCOP: c.2.1.1 Back     alignment and structure
>2gk4_A Conserved hypothetical protein; alpha-beta-alpha sandwich, flavoprotein, structural genomics protein structure initiative; 1.83A {Streptococcus pneumoniae} Back     alignment and structure
>3ond_A Adenosylhomocysteinase; plant protein, enzyme-substrate complex, NAD cofactor, regul SAM-dependent methylation reactions; HET: NAD ADN; 1.17A {Lupinus luteus} PDB: 3one_A* 3onf_A* Back     alignment and structure
>2eez_A Alanine dehydrogenase; TTHA0216, structural genomic NPPSFA, national project on protein structural and function analyses; 2.71A {Thermus thermophilus} Back     alignment and structure
>1id1_A Putative potassium channel protein; RCK domain, E.coli potassium channel, BK channel, rossmann fold, membrane protein; 2.40A {Escherichia coli} SCOP: c.2.1.9 Back     alignment and structure
>1lss_A TRK system potassium uptake protein TRKA homolog; KTN domain, NAD, RCK domain, potassium transport, potassium channel, KTRA; HET: NAD; 2.30A {Methanocaldococcus jannaschii} SCOP: c.2.1.9 Back     alignment and structure
>2j3h_A NADP-dependent oxidoreductase P1; double bond reductase (AT5G16970), APO form; 2.5A {Arabidopsis thaliana} PDB: 2j3i_A* 2j3j_A* 2j3k_A* Back     alignment and structure
>3tnl_A Shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD SKM; 1.45A {Listeria monocytogenes} PDB: 3toz_A* Back     alignment and structure
>1nvt_A Shikimate 5'-dehydrogenase; structural genomics, PSI, protein structure initiative; HET: NAP; 2.35A {Methanocaldococcus jannaschii} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>1wly_A CAAR, 2-haloacrylate reductase; NADPH-dependent oxidoreductase, oxidoreductase; 1.30A {Burkholderia SP} Back     alignment and structure
>2hmt_A YUAA protein; RCK, KTN, KTR, KTRA, ktrab, membrane protein, ION transporter, symporter, transport protein; HET: NAI; 2.20A {Bacillus subtilis} SCOP: c.2.1.9 PDB: 2hms_A* 2hmu_A* 2hmv_A* 2hmw_A* 1lsu_A* Back     alignment and structure
>2hcy_A Alcohol dehydrogenase 1; tetramer of asymmetric dimers, zinc coordination, intramolec disulfide bonds, oxidoreductase; HET: 8ID; 2.44A {Saccharomyces cerevisiae} Back     alignment and structure
>2zb4_A Prostaglandin reductase 2; rossmann fold, alternative splicing, cytoplasm, NADP, oxidoreductase; HET: NAP 5OP; 1.63A {Homo sapiens} PDB: 2zb7_A* 2zb8_A* 2w98_A* 2vna_A* 2w4q_A* 1vj1_A 2zb3_A* Back     alignment and structure
>2j8z_A Quinone oxidoreductase; medium-chain dehydrogenase- reductases, QUIN oxidoreductase, oxidative stress response; HET: NAP; 2.50A {Homo sapiens} PDB: 2oby_A* Back     alignment and structure
>3fwz_A Inner membrane protein YBAL; TRKA-N domain, E.coli, structural genomics, PSI-2, Pro structure initiative; HET: MSE AMP; 1.79A {Escherichia coli k-12} Back     alignment and structure
>4b7c_A Probable oxidoreductase; NADP cofactor, rossmann fold; HET: MES; 2.10A {Pseudomonas aeruginosa PA01} PDB: 4b7x_A* Back     alignment and structure
>1yb5_A Quinone oxidoreductase; medium-chain dehydrogenase/reductase, quinon reduction, structural genomics, structural genomics consort; HET: NAP; 1.85A {Homo sapiens} SCOP: b.35.1.2 c.2.1.1 Back     alignment and structure
>2eih_A Alcohol dehydrogenase; zinc ION binding protein, structural genomics, NPPSFA, natio project on protein structural and functional analyses; 2.30A {Thermus thermophilus} Back     alignment and structure
>3l4b_C TRKA K+ channel protien TM1088B; potassium channel, ring-gating complex, structural GEN PSI-2-2, protein structure initiative; HET: AMP; 3.45A {Thermotoga maritima} Back     alignment and structure
>1nyt_A Shikimate 5-dehydrogenase; alpha/beta domains, WIDE cleft separation, oxidoreductase; HET: NAP; 1.50A {Escherichia coli} SCOP: c.2.1.7 c.58.1.5 Back     alignment and structure
>3qwb_A Probable quinone oxidoreductase; rossmann fold, quinone oxidoreductases, NADPH, cytoplasm and oxidoreductase; HET: NDP; 1.59A {Saccharomyces cerevisiae} PDB: 3qwa_A* Back     alignment and structure
>4dup_A Quinone oxidoreductase; PSI-biology, structural genomics, protein structure initiati structural genomics research consortium, nysgrc; 2.45A {Rhizobium etli} Back     alignment and structure
>1jvb_A NAD(H)-dependent alcohol dehydrogenase; archaeon, zinc, oxidoreductase; HET: MSE; 1.85A {Sulfolobus solfataricus} SCOP: b.35.1.2 c.2.1.1 PDB: 1r37_A* 1nto_A 1nvg_A 3i4c_A 2eer_A* Back     alignment and structure
>3c85_A Putative glutathione-regulated potassium-efflux S protein KEFB; TRKA domain; HET: AMP; 1.90A {Vibrio parahaemolyticus rimd 2210633} Back     alignment and structure
>1b8p_A Protein (malate dehydrogenase); oxidoreductase; 1.90A {Aquaspirillum arcticum} SCOP: c.2.1.5 d.162.1.1 PDB: 1b8u_A* 1b8v_A* 3d5t_A Back     alignment and structure
>3jyn_A Quinone oxidoreductase; rossmann fold, protein-NADPH complex; HET: NDP; 2.01A {Pseudomonas syringae PV} PDB: 3jyl_A* Back     alignment and structure
>3t4e_A Quinate/shikimate dehydrogenase; structural genomics, center for structural genomics of infec diseases, csgid; HET: NAD; 1.95A {Salmonella enterica subsp} PDB: 1npd_A* 1o9b_A* 1vi2_A* Back     alignment and structure
>1yqd_A Sinapyl alcohol dehydrogenase; lignin, monolignol, oxidoreductase, zinc-dependent, plant DE biosynthesis, substrate inhibition; HET: NAP; 1.65A {Populus tremuloides} PDB: 1yqx_A* Back     alignment and structure
>3oj0_A Glutr, glutamyl-tRNA reductase; structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE SO4; 1.65A {Thermoplasma volcanium} Back     alignment and structure
>2egg_A AROE, shikimate 5-dehydrogenase; dimer, X-RAY diffraction, structural genomics, NPPSFA; 2.25A {Geobacillus kaustophilus} Back     alignment and structure
>2gb4_A Thiopurine S-methyltransferase; 18204406, thiopurine methyltransferase, structural genomics, PSI, protein structure initiative; HET: SAH; 1.25A {Mus musculus} PDB: 3bgi_A* 3bgd_A* 2bzg_A* 2h11_A* Back     alignment and structure
>3gms_A Putative NADPH:quinone reductase; structural genomics, putative quinone oxidoreductase, unknown function, PSI-2; 1.76A {Bacillus thuringiensis} Back     alignment and structure
>1p77_A Shikimate 5-dehydrogenase; NADPH, oxidoreductase; HET: ATR; 1.95A {Haemophilus influenzae} SCOP: c.2.1.7 c.58.1.5 PDB: 1p74_A* Back     alignment and structure
>1wg8_A Predicted S-adenosylmethionine-dependent methyltransferase; S-adenosyl-methyltransferase, MRAW; HET: SAM; 2.00A {Thermus thermophilus} SCOP: a.60.13.1 c.66.1.23 Back     alignment and structure
>3m6i_A L-arabinitol 4-dehydrogenase; medium chain dehydrogenase/reductase, oxidoreductase; HET: NAD; 2.60A {Neurospora crassa} Back     alignment and structure
>4g65_A TRK system potassium uptake protein TRKA; structural genomics, center for structural genomics of infec diseases, csgid, niaid; HET: MSE; 2.09A {Vibrio vulnificus} Back     alignment and structure
>3jyo_A Quinate/shikimate dehydrogenase; enzyme-cofactor complex, amino-acid biosynthesis, aromatic A biosynthesis, NAD, oxidoreductase; HET: NAD; 1.00A {Corynebacterium glutamicum} PDB: 3jyp_A* 3jyq_A* 2nlo_A Back     alignment and structure
>2aef_A Calcium-gated potassium channel MTHK; rossmann fold, helix-turn-helix, Ca2+ binding, flexible interface; 1.70A {Methanothermobacterthermautotrophicus} PDB: 2aej_A 2aem_A 3rbx_A 2ogu_A 2fy8_A 3kxd_A Back     alignment and structure
>4eye_A Probable oxidoreductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 2.10A {Mycobacterium abscessus} Back     alignment and structure
>1pjc_A Protein (L-alanine dehydrogenase); oxidoreductase, NAD; HET: NAD; 2.00A {Phormidium lapideum} SCOP: c.2.1.4 c.23.12.2 PDB: 1pjb_A* 1say_A Back     alignment and structure
>2g1u_A Hypothetical protein TM1088A; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: AMP; 1.50A {Thermotoga maritima} PDB: 3l4b_A* Back     alignment and structure
>2cdc_A Glucose dehydrogenase glucose 1-dehydrogenase, DHG-1; reductase, oxidoreductase, MDR family; HET: XYS XYP NAP; 1.50A {Sulfolobus solfataricus} PDB: 2cdb_A* 2cd9_A 2cda_A* Back     alignment and structure
>3uog_A Alcohol dehydrogenase; structural genomics, protein structure initiative, PSI-biolo YORK structural genomics research consortium; 2.20A {Sinorhizobium meliloti 1021} Back     alignment and structure
>2vhw_A Alanine dehydrogenase; NAD, secreted, oxidoreductase; HET: NAI; 2.0A {Mycobacterium tuberculosis} PDB: 2vhx_A* 2vhy_A 2vhz_A* 2vhv_A* 2voe_A 2voj_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 181
d2bgka1268 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol de 6e-26
d1spxa_264 c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nemato 1e-19
d2d1ya1248 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {T 3e-19
d2ew8a1247 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenas 5e-18
d1zk4a1251 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase 7e-18
d1ydea1250 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 1e-17
d1hxha_253 c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydroge 1e-17
d1xkqa_272 c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorh 8e-17
d1cyda_242 c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus muscul 4e-16
d1fmca_255 c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase 9e-16
d1xhla_274 c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorh 9e-16
d1gz6a_302 c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase do 2e-15
d1xg5a_257 c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC41 2e-15
d1hdca_254 c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydr 3e-15
d1xq1a_259 c.2.1.2 (A:) Tropinone reductase {Thale cress (Ara 1e-14
d1yxma1297 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA re 1e-14
d1ulsa_242 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-14
d1pr9a_244 c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapie 3e-14
d1vl8a_251 c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga 4e-14
d2a4ka1241 c.2.1.2 (A:2-242) beta-keto acyl carrier protein r 4e-14
d2ae2a_259 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 5e-14
d1zmta1252 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Ag 1e-13
d2c07a1251 c.2.1.2 (A:54-304) beta-keto acyl carrier protein 2e-13
d1yb1a_244 c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase 2e-13
d1w6ua_294 c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondr 2e-13
d1bdba_276 c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehy 3e-13
d2gdza1254 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrog 4e-13
d1sbya1254 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase 5e-13
d2rhca1257 c.2.1.2 (A:5-261) beta-keto acyl carrier protein r 7e-13
d1nffa_244 c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycob 3e-12
d1g0oa_272 c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase 3e-12
d1ae1a_258 c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datu 7e-12
d1iy8a_258 c.2.1.2 (A:) Levodione reductase {Corynebacterium 9e-12
d2ag5a1245 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR fami 1e-11
d1gega_255 c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Kl 2e-11
d1h5qa_260 c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Aga 2e-11
d1ja9a_259 c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reduc 5e-11
d1geea_261 c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megat 6e-11
d1zema1260 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconoba 1e-10
d2bd0a1240 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase 1e-10
d1o5ia_234 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-10
d1xu9a_269 c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 2e-10
d1x1ta1260 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydroge 3e-09
d1mxha_266 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 9e-09
d1dhra_236 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 1e-08
d1q7ba_243 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 1e-08
d1edoa_244 c.2.1.2 (A:) beta-keto acyl carrier protein reduct 2e-08
d1k2wa_256 c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter s 2e-08
d1uaya_241 c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogena 2e-08
d1ooea_235 c.2.1.2 (A:) Dihydropteridin reductase (pteridine 3e-08
d1yo6a1250 c.2.1.2 (A:1-250) Putative carbonyl reductase snif 1e-07
d1uzma1237 c.2.1.2 (A:9-245) beta-keto acyl carrier protein r 2e-07
d1wmaa1275 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydrox 8e-07
d1oaaa_259 c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus mus 9e-07
d1jtva_285 c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroi 7e-06
d1snya_248 c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly 2e-05
d1qsga_258 c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli 1e-04
d2o23a1248 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydr 6e-04
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Length = 268 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: Rhizome secoisolariciresinol dehydrogenase
species: Mayapple (Podophyllum peltatum) [TaxId: 35933]
 Score = 97.8 bits (243), Expect = 6e-26
 Identities = 80/200 (40%), Positives = 122/200 (61%), Gaps = 20/200 (10%)

Query: 2   FIQHRAKVIIADVQDDLCRALCKEFDSDELISYVCCNVTIDSDVKNVFDFT--KFGKLDI 59
           F+++ AKV+IAD+ DD  + +C    S ++IS+V C+VT D DV+N+ D T  K GKLDI
Sbjct: 26  FVRYGAKVVIADIADDHGQKVCNNIGSPDVISFVHCDVTKDEDVRNLVDTTIAKHGKLDI 85

Query: 60  MFNNAGIISNMDRTTLDTDNEKVKRVMIMVVFL-----------------GVLLFTANLA 102
           MF N G++S    + L+  NE  KRVM + V+                  G ++FTA+++
Sbjct: 86  MFGNVGVLSTTPYSILEAGNEDFKRVMDINVYGAFLVAKHAARVMIPAKKGSIVFTASIS 145

Query: 103 TETIGEAL-YDYLMSKYAVLGLMKNLCVELGQYDIRVNSIAHIVSATPFFCNAMGIDKKT 161
           + T GE + + Y  +K+AVLGL  +LC ELG+Y IRVN ++  + A+P   +  G+D   
Sbjct: 146 SFTAGEGVSHVYTATKHAVLGLTTSLCTELGEYGIRVNCVSPYIVASPLLTDVFGVDSSR 205

Query: 162 FKELLYASANLKGVVLKAAD 181
            +EL + +ANLKG +L+A D
Sbjct: 206 VEELAHQAANLKGTLLRAED 225


>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 264 Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Length = 248 Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Length = 247 Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Length = 251 Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Length = 250 Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Length = 253 Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Length = 272 Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 242 Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Length = 255 Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Length = 274 Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 302 Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Length = 257 Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Length = 254 Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 259 Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 297 Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Length = 242 Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Length = 251 Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Length = 259 Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Length = 252 Back     information, alignment and structure
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Length = 251 Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Length = 244 Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Length = 294 Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Length = 276 Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Length = 254 Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Length = 254 Back     information, alignment and structure
>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Length = 257 Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Length = 244 Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 272 Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Length = 258 Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Length = 258 Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Length = 245 Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Length = 255 Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Length = 260 Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Length = 259 Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Length = 261 Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Length = 260 Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Length = 240 Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Length = 234 Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Length = 269 Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Length = 260 Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Length = 266 Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 236 Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Length = 243 Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Length = 244 Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Length = 256 Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Length = 241 Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 235 Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Length = 250 Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Length = 237 Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 275 Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Length = 259 Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 285 Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 248 Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Length = 258 Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Length = 248 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query181
d2c07a1251 beta-keto acyl carrier protein reductase {Malaria 100.0
d2rhca1257 beta-keto acyl carrier protein reductase {Streptom 100.0
d1q7ba_243 beta-keto acyl carrier protein reductase {Escheric 100.0
d1vl8a_251 Gluconate 5-dehydrogenase {Thermotoga maritima [Ta 100.0
d1fmca_255 7-alpha-hydroxysteroid dehydrogenase {Escherichia 100.0
d1gega_255 meso-2,3-butanediol dehydrogenase {Klebsiella pneu 100.0
d1k2wa_256 Sorbitol dehydrogenase {Rhodobacter sphaeroides [T 100.0
d1iy8a_258 Levodione reductase {Corynebacterium aquaticum [Ta 100.0
d1edoa_244 beta-keto acyl carrier protein reductase {Oil seed 100.0
d2ae2a_259 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1ydea1250 Retinal dehydrogenase/reductase 3 {Human (Homo sap 100.0
d1cyda_242 Carbonyl reductase {Mouse (Mus musculus) [TaxId: 1 100.0
d1zema1260 Xylitol dehydrogenase {Gluconobacter oxydans [TaxI 100.0
d1zk4a1251 R-specific alcohol dehydrogenase {Lactobacillus br 100.0
d1geea_261 Glucose dehydrogenase {Bacillus megaterium [TaxId: 100.0
d1nffa_244 Putative oxidoreductase Rv2002 {Mycobacterium tube 100.0
d1x1ta1260 D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas 100.0
d2bgka1268 Rhizome secoisolariciresinol dehydrogenase {Mayapp 100.0
d1pr9a_244 Carbonyl reductase {Human (Homo sapiens) [TaxId: 9 100.0
d1xq1a_259 Tropinone reductase {Thale cress (Arabidopsis thal 100.0
d1ulsa_242 beta-keto acyl carrier protein reductase {Thermus 100.0
d1hdca_254 3-alpha,20-beta-hydroxysteroid dehydrogenase {Stre 100.0
d2ew8a1247 (s)-1-phenylethanol dehydrogenase {Azoarcus sp. eb 100.0
d2d1ya1248 Hypothetical protein TTHA0369 {Thermus thermophilu 100.0
d1ae1a_258 Tropinone reductase {Jimsonweed (Datura stramonium 100.0
d1uzma1237 beta-keto acyl carrier protein reductase {Mycobact 100.0
d1hxha_253 3beta/17beta hydroxysteroid dehydrogenase {Comamon 100.0
d1xhla_274 Hypothetical protein F25D1.5 {Caenorhabditis elega 100.0
d1xkqa_272 Hypothetical protein R05D8.7 {Caenorhabditis elega 100.0
d1spxa_264 Glucose dehydrogenase (5l265) {Nematode (Caenorhab 100.0
d1h5qa_260 Mannitol dehydrogenase {Mushroom (Agaricus bisporu 100.0
d1zmta1252 Halohydrin dehalogenase HheC {Agrobacterium tumefa 100.0
d2bd0a1240 Bacterial sepiapterin reductase {Chlorobium tepidu 100.0
d2a4ka1241 beta-keto acyl carrier protein reductase {Thermus 100.0
d1yxma1297 Peroxisomal trans 2-enoyl CoA reductase {Human (Ho 100.0
d2gdza1254 15-hydroxyprostaglandin dehydrogenase, PGDH {Human 100.0
d1ulua_256 Enoyl-ACP reductase {Thermus thermophilus [TaxId: 100.0
d1bdba_276 Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Ps 100.0
d1xg5a_257 Putative dehydrogenase ARPG836 (MGC4172) {Human (H 100.0
d1w6ua_294 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {H 100.0
d1o5ia_234 beta-keto acyl carrier protein reductase {Thermoto 100.0
d1ja9a_259 1,3,6,8-tetrahydroxynaphthalene reductase {Rice bl 100.0
d1yb1a_244 17-beta-hydroxysteroid dehydrogenase type XI {Huma 100.0
d1g0oa_272 1,3,8-trihydroxynaphtalene reductase (THNR, naphto 100.0
d1oaaa_259 Sepiapterin reductase {Mouse (Mus musculus) [TaxId 100.0
d2ag5a1245 Dehydrogenase/reductase SDR family member 6, DHRS6 100.0
d1jtva_285 Human estrogenic 17beta-hydroxysteroid dehydrogena 99.98
d1gz6a_302 (3R)-hydroxyacyl-CoA dehydrogenase domain of estra 99.97
d2o23a1248 Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Ho 99.97
d1snya_248 Carbonyl reductase sniffer {Fruit fly (Drosophila 99.97
d1qsga_258 Enoyl-ACP reductase {Escherichia coli [TaxId: 562] 99.97
d1wmaa1275 Carbonyl reductase/20beta-hydroxysteroid dehydroge 99.97
d1sbya1254 Drosophila alcohol dehydrogenase {Fly (Drosophila 99.96
d1xu9a_269 11-beta-hydroxysteroid dehydrogenase 1 {Human (Hom 99.96
d1e7wa_284 Dihydropteridin reductase (pteridine reductase) {L 99.96
d1uh5a_329 Enoyl-ACP reductase {Malaria parasite (Plasmodium 99.95
d1yo6a1250 Putative carbonyl reductase sniffer {Caenorhabditi 99.95
d2h7ma1268 Enoyl-ACP reductase {Mycobacterium tuberculosis, T 99.95
d2pd4a1274 Enoyl-ACP reductase {Helicobacter pylori [TaxId: 2 99.95
d1mxha_266 Dihydropteridin reductase (pteridine reductase) {T 99.94
d1uaya_241 Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus t 99.94
d1d7oa_297 Enoyl-ACP reductase {Oil seed rape (Brassica napus 99.94
d1dhra_236 Dihydropteridin reductase (pteridine reductase) {R 99.93
d1ooea_235 Dihydropteridin reductase (pteridine reductase) {N 99.93
d1fjha_257 3-alpha-hydroxysteroid dehydrogenase {Comamonas te 99.89
d2fr1a1259 Erythromycin synthase, eryAI, 1st ketoreductase mo 99.88
d1db3a_ 357 GDP-mannose 4,6-dehydratase {Escherichia coli [Tax 99.34
d1luaa1191 Methylene-tetrahydromethanopterin dehydrogenase {M 99.25
d1udca_ 338 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.2
d1i24a_ 393 Sulfolipid biosynthesis protein SQD1 {Thale cress 99.15
d1z45a2 347 Uridine diphosphogalactose-4-epimerase (UDP-galact 99.07
d1kewa_ 361 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 99.06
d1t2aa_ 347 GDP-mannose 4,6-dehydratase {Human (Homo sapiens) 98.98
d1n7ha_ 339 GDP-mannose 4,6-dehydratase {Thale-cress (Arabidop 98.98
d1y1pa1342 Aldehyde reductase II {Sporobolomyces salmonicolor 98.94
d1gy8a_ 383 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.84
d1orra_ 338 CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 98.81
d1hdoa_205 Biliverdin IX beta reductase {Human (Homo sapiens) 98.81
d2b69a1 312 UDP-glucuronate decarboxylase 1 {Human (Homo sapie 98.81
d1rpna_ 321 GDP-mannose 4,6-dehydratase {Pseudomonas aeruginos 98.81
d1sb8a_ 341 UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomo 98.78
d2blla1 342 Polymyxin resistance protein ArnA (PrmI) {Escheric 98.75
d1ek6a_ 346 Uridine diphosphogalactose-4-epimerase (UDP-galact 98.72
d1oc2a_ 346 dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus 98.71
d1rkxa_ 356 CDP-glucose-4,6-dehydratase {Yersinia pseudotuberc 98.71
d1e6ua_ 315 GDP-4-keto-6-deoxy-d-mannose epimerase/reductase ( 98.67
d2c5aa1 363 GDP-mannose-3', 5'-epimerase {Thale cress (Arabido 98.67
d1r6da_ 322 dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces 98.56
d2q46a1252 Hypothetical protein At5g02240 (T7H20_290) {Thale 97.87
d2bkaa1232 TAT-interacting protein TIP30 {Human (Homo sapiens 97.83
d1vl0a_281 DTDP-4-dehydrorhamnose reductase RfbD {Clostridium 97.81
d1jaya_212 Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archae 97.74
d1n2sa_ 298 dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {S 97.71
d1eq2a_ 307 ADP-L-glycero-D-mannoheptose 6-epimerase {Escheric 97.57
d1qyca_ 307 Phenylcoumaran benzylic ether reductase {Loblolly 97.23
d1qyda_ 312 Pinoresinol-lariciresinol reductase {Giant arborvi 97.12
d2a35a1212 Hypothetical protein PA4017 {Pseudomonas aeruginos 96.63
d1xgka_ 350 Negative transcriptional regulator NmrA {Aspergill 96.6
d1e3ja2170 Ketose reductase (sorbitol dehydrogenase) {Silverl 93.86
d1v3va2182 Leukotriene b4 12-hydroxydehydrogenase/prostagland 92.98
d1lssa_132 Ktn Mja218 {Archaeon Methanococcus jannaschii [Tax 92.74
d1e5qa1182 Saccharopine reductase {Rice blast fungus (Magnapo 91.4
d1vj0a2182 Hypothetical protein TM0436 {Thermotoga maritima [ 90.6
d1pl8a2171 Ketose reductase (sorbitol dehydrogenase) {Human ( 88.36
d1id1a_153 Rck domain from putative potassium channel Kch {Es 88.08
d1jqba2174 Bacterial secondary alcohol dehydrogenase {Clostri 86.78
d1wg8a2182 TM0872, methyltransferase domain {Thermus thermoph 86.06
d1wxxa2318 Hypothetical protein TTHA1280, middle and C-termin 85.59
d1qora2179 Quinone oxidoreductase {Escherichia coli [TaxId: 5 84.82
d2hmva1134 Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} 84.55
d1yb5a2174 Quinone oxidoreductase {Human (Homo sapiens) [TaxI 84.16
d1vi2a1182 Putative shikimate dehydrogenase YdiB {Escherichia 83.85
d1p77a1171 Shikimate 5-dehydrogenase AroE {Haemophilus influe 83.69
d2b78a2317 Hypothetical protein SMu776, middle and C-terminal 83.64
d1vj1a2187 Putative zinc-binding alcohol dehydrogenase {Mouse 83.36
d1gpja2159 Glutamyl tRNA-reductase middle domain {Archaeon Me 82.87
d1pqwa_183 Putative enoyl reductase domain of polyketide synt 82.23
d1pjca1168 L-alanine dehydrogenase {Phormidium lapideum [TaxI 81.93
d1y8ca_246 Putative methyltransferase CAC2371 {Clostridium ac 80.52
d1gu7a2189 2,4-dienoyl-CoA reductase {Yeast (Candida tropical 80.38
d1nyta1170 Shikimate 5-dehydrogenase AroE {Escherichia coli [ 80.35
>d2c07a1 c.2.1.2 (A:54-304) beta-keto acyl carrier protein reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: NAD(P)-binding Rossmann-fold domains
superfamily: NAD(P)-binding Rossmann-fold domains
family: Tyrosine-dependent oxidoreductases
domain: beta-keto acyl carrier protein reductase
species: Malaria parasite (Plasmodium falciparum) [TaxId: 5833]
Probab=100.00  E-value=5.9e-40  Score=241.52  Aligned_cols=174  Identities=21%  Similarity=0.252  Sum_probs=156.0

Q ss_pred             CcccCCCEEEEeecchHHHHHHHhHcCCC-CceEEEeeecCChhHHHHHHHh--cccCCccEEEEcccccCCCCCCcccC
Q 042200            1 VFIQHRAKVIIADVQDDLCRALCKEFDSD-ELISYVCCNVTIDSDVKNVFDF--TKFGKLDIMFNNAGIISNMDRTTLDT   77 (181)
Q Consensus         1 ~l~~~G~~Vv~~~r~~~~~~~~~~~~~~~-~~~~~~~~D~~~~~~i~~~~~~--~~~~~id~vi~~ag~~~~~~~~~~~~   77 (181)
                      +|+++|++|++++|+++.++++.+++... .++.++.+|+++++++++++++  .++|++|++|||||....  ..+.+.
T Consensus        29 ~la~~Ga~V~~~~r~~~~l~~~~~~l~~~g~~~~~~~~Dvt~~~~v~~~~~~~~~~~g~iDilvnnag~~~~--~~~~~~  106 (251)
T d2c07a1          29 MLAKSVSHVICISRTQKSCDSVVDEIKSFGYESSGYAGDVSKKEEISEVINKILTEHKNVDILVNNAGITRD--NLFLRM  106 (251)
T ss_dssp             HHTTTSSEEEEEESSHHHHHHHHHHHHTTTCCEEEEECCTTCHHHHHHHHHHHHHHCSCCCEEEECCCCCCC--CCTTTC
T ss_pred             HHHHcCCEEEEEECCHHHHHHHHHHHHhcCCcEEEEEccCCCHHHHHHHHHHHHHhcCCceeeeeccccccc--cccccc
Confidence            37899999999999999999998888665 6899999999999999999999  888999999999999877  888899


Q ss_pred             CHHHHHHhhheeec-----------------ceeEEEeccccccccCccchhhHhhHHHHHHHHHHHHHHhcCCCeEEEE
Q 042200           78 DNEKVKRVMIMVVF-----------------LGVLLFTANLATETIGEALYDYLMSKYAVLGLMKNLCVELGQYDIRVNS  140 (181)
Q Consensus        78 ~~~~~~~~~~~n~~-----------------~~~iv~iss~~~~~~~~~~~~y~~sK~a~~~l~~~la~~~~~~~i~v~~  140 (181)
                      +.++|++++++|+.                 .|+||++||.++..+.++...|++||+|+.+|+|+|+.|++++|||||+
T Consensus       107 ~~~~~~~~~~vNl~~~~~~~~~~~~~m~~~~~G~IVnisS~~~~~~~~~~~~Y~asKaal~~ltr~lA~el~~~gIrVN~  186 (251)
T d2c07a1         107 KNDEWEDVLRTNLNSLFYITQPISKRMINNRYGRIINISSIVGLTGNVGQANYSSSKAGVIGFTKSLAKELASRNITVNA  186 (251)
T ss_dssp             CHHHHHHHHHHHTTHHHHHHHHHHHHHHHHTCEEEEEECCTHHHHCCTTCHHHHHHHHHHHHHHHHHHHHHGGGTEEEEE
T ss_pred             cHHHHhhhheeeehhhhhhhhhcCcccccCCCeEEEEECCHHhcCCCCCCHHHHHHHHHHHHHHHHHHHHhhhhCeEEEE
Confidence            99999999999999                 6999999999999999999999999999999999999999999999999


Q ss_pred             EecCcccCcccchhcCCChHHHHHHHHHhhcccccccccCC
Q 042200          141 IAHIVSATPFFCNAMGIDKKTFKELLYASANLKGVVLKAAD  181 (181)
Q Consensus       141 i~Pg~v~t~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~e  181 (181)
                      |+||+++|+|....   .++..+.+....  |++|+++|+|
T Consensus       187 V~PG~v~T~~~~~~---~~~~~~~~~~~~--pl~R~~~ped  222 (251)
T d2c07a1         187 IAPGFISSDMTDKI---SEQIKKNIISNI--PAGRMGTPEE  222 (251)
T ss_dssp             EEECSBCC-----C---CHHHHHHHHTTC--TTSSCBCHHH
T ss_pred             EccCCEeccccccc---CHHHHHHHHhcC--CCCCCcCHHH
Confidence            99999999998765   456667777776  9999999986



>d2rhca1 c.2.1.2 (A:5-261) beta-keto acyl carrier protein reductase {Streptomyces coelicolor [TaxId: 1902]} Back     information, alignment and structure
>d1q7ba_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl8a_ c.2.1.2 (A:) Gluconate 5-dehydrogenase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1fmca_ c.2.1.2 (A:) 7-alpha-hydroxysteroid dehydrogenase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1gega_ c.2.1.2 (A:) meso-2,3-butanediol dehydrogenase {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d1k2wa_ c.2.1.2 (A:) Sorbitol dehydrogenase {Rhodobacter sphaeroides [TaxId: 1063]} Back     information, alignment and structure
>d1iy8a_ c.2.1.2 (A:) Levodione reductase {Corynebacterium aquaticum [TaxId: 144185]} Back     information, alignment and structure
>d1edoa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d2ae2a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), II [TaxId: 4076]} Back     information, alignment and structure
>d1ydea1 c.2.1.2 (A:4-253) Retinal dehydrogenase/reductase 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cyda_ c.2.1.2 (A:) Carbonyl reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zema1 c.2.1.2 (A:3-262) Xylitol dehydrogenase {Gluconobacter oxydans [TaxId: 442]} Back     information, alignment and structure
>d1zk4a1 c.2.1.2 (A:1-251) R-specific alcohol dehydrogenase {Lactobacillus brevis [TaxId: 1580]} Back     information, alignment and structure
>d1geea_ c.2.1.2 (A:) Glucose dehydrogenase {Bacillus megaterium [TaxId: 1404]} Back     information, alignment and structure
>d1nffa_ c.2.1.2 (A:) Putative oxidoreductase Rv2002 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1x1ta1 c.2.1.2 (A:1-260) D(-)-3-hydroxybutyrate dehydrogenase {Pseudomonas fragi [TaxId: 296]} Back     information, alignment and structure
>d2bgka1 c.2.1.2 (A:11-278) Rhizome secoisolariciresinol dehydrogenase {Mayapple (Podophyllum peltatum) [TaxId: 35933]} Back     information, alignment and structure
>d1pr9a_ c.2.1.2 (A:) Carbonyl reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xq1a_ c.2.1.2 (A:) Tropinone reductase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ulsa_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1hdca_ c.2.1.2 (A:) 3-alpha,20-beta-hydroxysteroid dehydrogenase {Streptomyces hydrogenans [TaxId: 1905]} Back     information, alignment and structure
>d2ew8a1 c.2.1.2 (A:3-249) (s)-1-phenylethanol dehydrogenase {Azoarcus sp. ebn1 [TaxId: 76114]} Back     information, alignment and structure
>d2d1ya1 c.2.1.2 (A:2-249) Hypothetical protein TTHA0369 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1ae1a_ c.2.1.2 (A:) Tropinone reductase {Jimsonweed (Datura stramonium), I [TaxId: 4076]} Back     information, alignment and structure
>d1uzma1 c.2.1.2 (A:9-245) beta-keto acyl carrier protein reductase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1hxha_ c.2.1.2 (A:) 3beta/17beta hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d1xhla_ c.2.1.2 (A:) Hypothetical protein F25D1.5 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1xkqa_ c.2.1.2 (A:) Hypothetical protein R05D8.7 {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d1spxa_ c.2.1.2 (A:) Glucose dehydrogenase (5l265) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1h5qa_ c.2.1.2 (A:) Mannitol dehydrogenase {Mushroom (Agaricus bisporus) [TaxId: 5341]} Back     information, alignment and structure
>d1zmta1 c.2.1.2 (A:2-253) Halohydrin dehalogenase HheC {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2bd0a1 c.2.1.2 (A:2-241) Bacterial sepiapterin reductase {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2a4ka1 c.2.1.2 (A:2-242) beta-keto acyl carrier protein reductase {Thermus thermophilus, TTHB020 [TaxId: 274]} Back     information, alignment and structure
>d1yxma1 c.2.1.2 (A:7-303) Peroxisomal trans 2-enoyl CoA reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2gdza1 c.2.1.2 (A:3-256) 15-hydroxyprostaglandin dehydrogenase, PGDH {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ulua_ c.2.1.2 (A:) Enoyl-ACP reductase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1bdba_ c.2.1.2 (A:) Cis-biphenyl-2,3-dihydrodiol-2,3-dehydrogenase {Pseudomonas sp., lb400 [TaxId: 306]} Back     information, alignment and structure
>d1xg5a_ c.2.1.2 (A:) Putative dehydrogenase ARPG836 (MGC4172) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1w6ua_ c.2.1.2 (A:) 2,4-dienoyl-CoA reductase, mitochondrial (DECR) {Human (Homo sapiens), [TaxId: 9606]} Back     information, alignment and structure
>d1o5ia_ c.2.1.2 (A:) beta-keto acyl carrier protein reductase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1ja9a_ c.2.1.2 (A:) 1,3,6,8-tetrahydroxynaphthalene reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1yb1a_ c.2.1.2 (A:) 17-beta-hydroxysteroid dehydrogenase type XI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1g0oa_ c.2.1.2 (A:) 1,3,8-trihydroxynaphtalene reductase (THNR, naphtol reductase) {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1oaaa_ c.2.1.2 (A:) Sepiapterin reductase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2ag5a1 c.2.1.2 (A:1-245) Dehydrogenase/reductase SDR family member 6, DHRS6 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1jtva_ c.2.1.2 (A:) Human estrogenic 17beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1gz6a_ c.2.1.2 (A:) (3R)-hydroxyacyl-CoA dehydrogenase domain of estradiol 17 beta-Dehydrogenase 4 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d2o23a1 c.2.1.2 (A:6-253) Type II 3-hydroxyacyl-CoA dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1snya_ c.2.1.2 (A:) Carbonyl reductase sniffer {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qsga_ c.2.1.2 (A:) Enoyl-ACP reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wmaa1 c.2.1.2 (A:2-276) Carbonyl reductase/20beta-hydroxysteroid dehydrogenase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1sbya1 c.2.1.2 (A:1-254) Drosophila alcohol dehydrogenase {Fly (Drosophila lebanonensis) [TaxId: 7225]} Back     information, alignment and structure
>d1xu9a_ c.2.1.2 (A:) 11-beta-hydroxysteroid dehydrogenase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1e7wa_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Leishmania major [TaxId: 5664]} Back     information, alignment and structure
>d1uh5a_ c.2.1.2 (A:) Enoyl-ACP reductase {Malaria parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d1yo6a1 c.2.1.2 (A:1-250) Putative carbonyl reductase sniffer {Caenorhabditis elegans [TaxId: 6239]} Back     information, alignment and structure
>d2h7ma1 c.2.1.2 (A:2-269) Enoyl-ACP reductase {Mycobacterium tuberculosis, TB, gene InhA [TaxId: 1773]} Back     information, alignment and structure
>d2pd4a1 c.2.1.2 (A:2-275) Enoyl-ACP reductase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1mxha_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d1uaya_ c.2.1.2 (A:) Type II 3-hydroxyacyl-CoA dehydrogenase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1d7oa_ c.2.1.2 (A:) Enoyl-ACP reductase {Oil seed rape (Brassica napus) [TaxId: 3708]} Back     information, alignment and structure
>d1dhra_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1ooea_ c.2.1.2 (A:) Dihydropteridin reductase (pteridine reductase) {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1fjha_ c.2.1.2 (A:) 3-alpha-hydroxysteroid dehydrogenase {Comamonas testosteroni [TaxId: 285]} Back     information, alignment and structure
>d2fr1a1 c.2.1.2 (A:1657-1915) Erythromycin synthase, eryAI, 1st ketoreductase module {Saccharopolyspora erythraea [TaxId: 1836]} Back     information, alignment and structure
>d1db3a_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1luaa1 c.2.1.7 (A:98-288) Methylene-tetrahydromethanopterin dehydrogenase {Methylobacterium extorquens [TaxId: 408]} Back     information, alignment and structure
>d1udca_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1i24a_ c.2.1.2 (A:) Sulfolipid biosynthesis protein SQD1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1z45a2 c.2.1.2 (A:11-357) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1kewa_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1t2aa_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n7ha_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Thale-cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1y1pa1 c.2.1.2 (A:2-343) Aldehyde reductase II {Sporobolomyces salmonicolor [TaxId: 5005]} Back     information, alignment and structure
>d1gy8a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1orra_ c.2.1.2 (A:) CDP-tyvelose-2-epimerase {Salmonella typhi [TaxId: 90370]} Back     information, alignment and structure
>d1hdoa_ c.2.1.2 (A:) Biliverdin IX beta reductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b69a1 c.2.1.2 (A:4-315) UDP-glucuronate decarboxylase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rpna_ c.2.1.2 (A:) GDP-mannose 4,6-dehydratase {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1sb8a_ c.2.1.2 (A:) UDP-N-acetylglucosamine 4-epimerase WbpP {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2blla1 c.2.1.2 (A:316-657) Polymyxin resistance protein ArnA (PrmI) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ek6a_ c.2.1.2 (A:) Uridine diphosphogalactose-4-epimerase (UDP-galactose 4-epimerase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1oc2a_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptococcus suis, serotype 2 [TaxId: 1307]} Back     information, alignment and structure
>d1rkxa_ c.2.1.2 (A:) CDP-glucose-4,6-dehydratase {Yersinia pseudotuberculosis [TaxId: 633]} Back     information, alignment and structure
>d1e6ua_ c.2.1.2 (A:) GDP-4-keto-6-deoxy-d-mannose epimerase/reductase (GDP-fucose synthetase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c5aa1 c.2.1.2 (A:13-375) GDP-mannose-3', 5'-epimerase {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1r6da_ c.2.1.2 (A:) dTDP-glucose 4,6-dehydratase (RmlB) {Streptomyces venezuelae [TaxId: 54571]} Back     information, alignment and structure
>d2q46a1 c.2.1.2 (A:2-253) Hypothetical protein At5g02240 (T7H20_290) {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2bkaa1 c.2.1.2 (A:5-236) TAT-interacting protein TIP30 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vl0a_ c.2.1.2 (A:) DTDP-4-dehydrorhamnose reductase RfbD {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1jaya_ c.2.1.6 (A:) Coenzyme F420H2:NADP+ oxidoreductase (FNO) {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1n2sa_ c.2.1.2 (A:) dTDP-6-deoxy-L-lyxo-4-hexulose reductase (RmlD) {Salmonella enterica serovar typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d1eq2a_ c.2.1.2 (A:) ADP-L-glycero-D-mannoheptose 6-epimerase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qyca_ c.2.1.2 (A:) Phenylcoumaran benzylic ether reductase {Loblolly pine (Pinus taeda) [TaxId: 3352]} Back     information, alignment and structure
>d1qyda_ c.2.1.2 (A:) Pinoresinol-lariciresinol reductase {Giant arborvitae (Thuja plicata) [TaxId: 3316]} Back     information, alignment and structure
>d2a35a1 c.2.1.2 (A:4-215) Hypothetical protein PA4017 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1xgka_ c.2.1.2 (A:) Negative transcriptional regulator NmrA {Aspergillus nidulans [TaxId: 162425]} Back     information, alignment and structure
>d1e3ja2 c.2.1.1 (A:143-312) Ketose reductase (sorbitol dehydrogenase) {Silverleaf whitefly (Bemisia argentifolii) [TaxId: 77855]} Back     information, alignment and structure
>d1v3va2 c.2.1.1 (A:113-294) Leukotriene b4 12-hydroxydehydrogenase/prostaglandin 15-keto reductase {Guinea pig (Cavia porcellus) [TaxId: 10141]} Back     information, alignment and structure
>d1lssa_ c.2.1.9 (A:) Ktn Mja218 {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1e5qa1 c.2.1.3 (A:2-124,A:392-450) Saccharopine reductase {Rice blast fungus (Magnaporthe grisea) [TaxId: 148305]} Back     information, alignment and structure
>d1vj0a2 c.2.1.1 (A:156-337) Hypothetical protein TM0436 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pl8a2 c.2.1.1 (A:146-316) Ketose reductase (sorbitol dehydrogenase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1id1a_ c.2.1.9 (A:) Rck domain from putative potassium channel Kch {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1jqba2 c.2.1.1 (A:1140-1313) Bacterial secondary alcohol dehydrogenase {Clostridium beijerinckii [TaxId: 1520]} Back     information, alignment and structure
>d1wg8a2 c.66.1.23 (A:5-108,A:207-284) TM0872, methyltransferase domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1wxxa2 c.66.1.51 (A:65-382) Hypothetical protein TTHA1280, middle and C-terminal domains {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1qora2 c.2.1.1 (A:113-291) Quinone oxidoreductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2hmva1 c.2.1.9 (A:7-140) Ktn bsu222 {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1yb5a2 c.2.1.1 (A:121-294) Quinone oxidoreductase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1vi2a1 c.2.1.7 (A:107-288) Putative shikimate dehydrogenase YdiB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1p77a1 c.2.1.7 (A:102-272) Shikimate 5-dehydrogenase AroE {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d2b78a2 c.66.1.51 (A:69-385) Hypothetical protein SMu776, middle and C-terminal domains {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1vj1a2 c.2.1.1 (A:125-311) Putative zinc-binding alcohol dehydrogenase {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1gpja2 c.2.1.7 (A:144-302) Glutamyl tRNA-reductase middle domain {Archaeon Methanopyrus kandleri [TaxId: 2320]} Back     information, alignment and structure
>d1pqwa_ c.2.1.1 (A:) Putative enoyl reductase domain of polyketide synthase {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1pjca1 c.2.1.4 (A:136-303) L-alanine dehydrogenase {Phormidium lapideum [TaxId: 32060]} Back     information, alignment and structure
>d1y8ca_ c.66.1.43 (A:) Putative methyltransferase CAC2371 {Clostridium acetobutylicum [TaxId: 1488]} Back     information, alignment and structure
>d1gu7a2 c.2.1.1 (A:161-349) 2,4-dienoyl-CoA reductase {Yeast (Candida tropicalis) [TaxId: 5482]} Back     information, alignment and structure
>d1nyta1 c.2.1.7 (A:102-271) Shikimate 5-dehydrogenase AroE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure