Citrus Sinensis ID: 042207

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-------52

SADAQENFLQCLLQNSDNSTTSISKVIYTQNNSSYSSILDFTIQNRRFLTAATPKPQVIVKPLQVSHIQSVIFCSQWHGMQVRVRSGGHDYEGLSYISHVPYVVIDLINLRSISIDVEKTTAWIQAGATIGELYHKIADTSGTLGFPAGVCPSVGVGGHFSGGGYGILLRKYGLAADHVVDAHLVDVKGRLLDRKSMGEDLFWAIRGGGGASFGVIVAWKVELVTIPSTVTVCSSRRSLKRNLTRLVHRWQFVADKFDEDLITGVFLSSVNASTGGNRTVIASFESVFLGGVDGVIPLMQKSFPELGLVEKECTETSWVRAVLHHARFPIEASLDVLLNRSPVTKRFYKAKSDYVREPMPEIAFEGIFELFNEKEGGNAEIMLVPYGGKMSEIPESAIPFPHRAGNIYKMSPVVYWYEEGSETAERHINWIRKLHSFLTPFVSKNPRASYINYRDIDIGANKIRGYTSYKQASIWGRKYFRNNFDRLVVVKTMVDPHNFFRNEQSIPSLSSWRKQKDD

ccccHHHHHHHHcccccccccccccEEEcccccccHHHHHHHHccccccccccccccEEEEcccHHHHHHHHHHHHHcccEEEEEcccccccccccccccccEEEEccccccEEEEccccEEEEcccccHHHHHHHHHHccccccccccccccccccccccccccHHHHHHHHccccEEEEEEEEEEccEEEEccccccccEEEEEcccccccEEEEEEEEEEEEcccEEEEEEEcccHHHHHHHHHHHHHHHHHccccccEEEEEEcccccccccccEEEEEEEEEEcccHHcHHHHHHHHcccccccccccccccHHHHHHHHccccccHHHHHHccccccccccEEEEcccccccccHHHHHHHHHHHHccccccEEEEECccccccccccccccccccccccEEEEEEEEEEcccccHHHHHHHHHHHHHHHHcccccccccccEEccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccc

***AQENFLQCLLQNSD**TTSISKVIYTQNNSSYSSILDFTIQNRRFLTAATPKPQVIVKPLQVSHIQSVIFCSQWHGMQVRVRSGGHDYEGLSYISHVPYVVIDLINLRSISIDVEKTTAWIQAGATIGELYHKIADTSGTLGFPAGVCPSVGVGGHFSGGGYGILLRKYGLAADHVVDAHLVDVKGRLLDRKSMGEDLFWAIRGGGGASFGVIVAWKVELVTIPSTVTVCSSRRSLKRNLTRLVHRWQFVADKFDEDLITGVFLSSVNASTGGNRTVIASFESVFLGGVDGVIPLMQKSFPELGLVEKECTETSWVRAVLHHARFPIEASLDVLLNRSPVTKRFYKAKSDYVREPMPEIAFEGIFELFNEKEGGNAEIMLVPYGGKMSEIPESAIPFPHRAGNIYKMSPVVYWYEEGSETAERHINWIRKLHSFLTPFVSKNPRASYINYRDIDIGANKIRGYTSYKQASIWGRKYFRNNFDRLVVVKTMVDPHNFFRNEQS*************

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Tetrahydrocannabinolic acid synthase	Catalyzes the oxidative cyclization of the monoterpene moiety in cannabigerolic acid (CBGA), producing delta(9)-tetrahydrocannabinolate (THCA), the major cannabioid in drug-type Cannabis plants. Can also use cannabinerolic acid as substrate, but not cannabigerol or cannabinerol.	probable	Q8GTB6
Cannabidiolic acid synthase	Catalyzes the stereoselective oxidative cyclization of the monoterpene moiety in cannabigerolic acid (CBGA), producing cannabidiolate (CBDA), the major cannabioid in fiber-type Cannabis plants. Can also use cannabinerolic acid as substrate, but not cannabigerol or cannabinerol.	probable	A6P6V9
Cannabidiolic acid synthase-like 1	Has no cannabidiolic acid synthase activity.	probable	A6P6W0

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3VTE, chain A
Confidence level:very confident
Coverage over the Query: 2-512
View the alignment between query and template
View the model in PyMOL