Citrus Sinensis ID: 042215


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------15
MNDTHKHEMGGMAPPPTMPRHKMMMHMTFFWGKNALVLFKGWPGTSTGMYALALVFVFAMGILVEWLSHSRLIKTGTGNVAAGIIQTFMHTIRVGLANLVMLALMSFNVGVFLAAVAGHSLGFLLFGSRVFHKSAPPPKTNDLSPMSC
ccccccccccccccccccccccccEEEEEEcccEEEEEEcccccccHHHHHHHHHHHHHHHHHHHHHHHccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccccc
***********************MMHMTFFWGKNALVLFKGWPGTSTGMYALALVFVFAMGILVEWLSHSRLIKTGTGNVAAGIIQTFMHTIRVGLANLVMLALMSFNVGVFLAAVAGHSLGFLLFGSRVF*****************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MNDTHKHEMGGMAPPPTMPRHKMMMHMTFFWGKNALVLFKGWPGTSTGMYALALVFVFAMGILVEWLSHSRLIKTGTGNVAAGIIQTFMHTIRVGLANLVMLALMSFNVGVFLAAVAGHSLGFLLFGSRVFHKSAPPPKTNDLSPMSC

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Copper transporter 1 Involved in the transport of copper, in cooperation with SWEET11 and COPT2. Contributes to the removal of copper (Cu) from xylem, and thus to the sensitivity toward bacterial pathogens such as X.oryzae pv. oryzae (Xoo).probableQ94EE4
Copper transporter 1 Copper transporter involved in copper acquisition and transport in leaves. Required for copper homeostasis and normal plant growth and development.probableQ39065

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2LS3, chain A
Confidence level:probable
Coverage over the Query: 82-109
View the alignment between query and template
View the model in PyMOL
Template: 2LS2, chain A
Confidence level:probable
Coverage over the Query: 45-68
View the alignment between query and template
View the model in PyMOL
Template: 2LS4, chain A
Confidence level:probable
Coverage over the Query: 107-130
View the alignment between query and template
View the model in PyMOL