Citrus Sinensis ID: 042239
Local Sequence Feature Prediction
| Prediction and (Method) | Result |
|---|
|
|
Close Homologs for Annotation Transfer
Close Homologs in SWISS-PROT Database Detected by BLAST 
Original result of BLAST against SWISS-PROT Database
| ID | Alignment graph | Length |
Definition |
RBH(Q2H) |
RBH(H2Q) |
Q cover |
H cover |
Identity |
E-value |
| Query | 413 | 2.2.26 [Sep-21-2011] | |||||||
| Q9M2S4 | 684 | L-type lectin-domain cont | yes | no | 0.818 | 0.494 | 0.293 | 2e-25 | |
| Q9LYX1 | 711 | L-type lectin-domain cont | no | no | 0.736 | 0.427 | 0.294 | 6e-25 | |
| Q9LFH9 | 715 | L-type lectin-domain cont | no | no | 0.799 | 0.461 | 0.282 | 2e-20 | |
| O22833 | 658 | L-type lectin-domain cont | no | no | 0.714 | 0.448 | 0.274 | 2e-19 | |
| Q9M345 | 677 | L-type lectin-domain cont | no | no | 0.709 | 0.432 | 0.283 | 2e-19 | |
| Q9M1G4 | 674 | Probable L-type lectin-do | no | no | 0.779 | 0.477 | 0.248 | 3e-19 | |
| O81292 | 674 | L-type lectin-domain cont | no | no | 0.721 | 0.442 | 0.272 | 5e-19 | |
| Q9FHG4 | 681 | Probable L-type lectin-do | no | no | 0.782 | 0.474 | 0.261 | 6e-19 | |
| Q9SZD5 | 669 | L-type lectin-domain cont | no | no | 0.777 | 0.479 | 0.255 | 8e-19 | |
| O80939 | 675 | L-type lectin-domain cont | no | no | 0.721 | 0.441 | 0.256 | 4e-18 |
| >sp|Q9M2S4|LRKS4_ARATH L-type lectin-domain containing receptor kinase S.4 OS=Arabidopsis thaliana GN=LECRKS4 PE=1 SV=1 | Back alignment and function desciption |
|---|
Score = 117 bits (292), Expect = 2e-25, Method: Compositional matrix adjust.
Identities = 119/406 (29%), Positives = 175/406 (43%), Gaps = 68/406 (16%)
Query: 38 DFSLHNNSKILHDLKLLGSAKLSNEKRVIQIPDDSQATDLRHQAGRAIYSSPVRLLDPVT 97
DFS K +L L G A+++ + T+ + G A YS P+R
Sbjct: 25 DFSFIGFKKASPNLTLNGVAEIAPTGAI------RLTTETQRVIGHAFYSLPIRFKPIGV 78
Query: 98 KTPTSFETTFSFQFNTSNNTRTSRDGGSSLTFIIVPDEFTVGRA-GPWLGVLNDACKDDY 156
SF T+F+ T GG L F I P G +LG+LN + + ++
Sbjct: 79 NRALSFSTSFAIAMVPEFVTL----GGHGLAFAITPTPDLRGSLPSQYLGLLN-SSRVNF 133
Query: 157 KA--VAVKFDTCRDLEFGGPNDNHVGINLGSI---VSTRA----INASDVGIFLNDGSVH 207
+ AV+FDT RDLEF NDNHVGI++ S+ +ST A N++ +FL+ G V
Sbjct: 134 SSHFFAVEFDTVRDLEFEDINDNHVGIDINSMESSISTPAGYFLANSTKKELFLDGGRVI 193
Query: 208 RAWIAYDGTRGWMDVRIG-----------SDGRDYPST--KPTFSGFSASTGNMTQIHNL 254
+AWI YD + +DV++ S D S + GFSASTG + H +
Sbjct: 194 QAWIDYDSNKKRLDVKLSPFSEKPKLSLLSYDVDLSSVLGDEMYVGFSASTGLLASSHYI 253
Query: 255 LSWNFSSISQPFLL-------IPSTETCENNTMLQQIAGAGSSGSGQHRQPEPAHGFLIF 307
L WNF+ + F L IPS+ I G +
Sbjct: 254 LGWNFNMSGEAFSLSLPSLPRIPSSIKKRKKKRQSLILG-------------------VS 294
Query: 308 IVVSVLALVIFLAMYCISRRQRKDIALPGKKQRPRPPNKPRRFTLSEISVATRAFSELEC 367
++ S+L + +A R+ KD + + P RF+ E+ AT F + E
Sbjct: 295 LLCSLLIFAVLVAASLFVVRKVKD---EDRVEEWELDFGPHRFSYRELKKATNGFGDKEL 351
Query: 368 LGSDYRGVYYRGKLPNGRQPVAGKRFSSQFLSSQQGLDKRRLLEEI 413
LGS G Y+GKLP + VA KR S + S+QG+ R + E+
Sbjct: 352 LGSGGFGKVYKGKLPGSDEFVAVKRISHE---SRQGV--REFMSEV 392
|
Arabidopsis thaliana (taxid: 3702) EC: 2EC: .EC: 7EC: .EC: 1EC: 1EC: .EC: 1 |
| >sp|Q9LYX1|LRK82_ARATH L-type lectin-domain containing receptor kinase VIII.2 OS=Arabidopsis thaliana GN=LECRK82 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9LFH9|LRK81_ARATH L-type lectin-domain containing receptor kinase VIII.1 OS=Arabidopsis thaliana GN=LECRK81 PE=1 SV=1 | Back alignment and function description |
|---|
| >sp|O22833|LRK54_ARATH L-type lectin-domain containing receptor kinase V.4 OS=Arabidopsis thaliana GN=LECRK54 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9M345|LRK42_ARATH L-type lectin-domain containing receptor kinase IV.2 OS=Arabidopsis thaliana GN=LECRK42 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9M1G4|LRK15_ARATH Probable L-type lectin-domain containing receptor kinase I.5 OS=Arabidopsis thaliana GN=LECRK15 PE=2 SV=2 | Back alignment and function description |
|---|
| >sp|O81292|LRK43_ARATH L-type lectin-domain containing receptor kinase IV.3 OS=Arabidopsis thaliana GN=LECRK43 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9FHG4|LRKS7_ARATH Probable L-type lectin-domain containing receptor kinase S.7 OS=Arabidopsis thaliana GN=LECRKS7 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|Q9SZD5|LRK59_ARATH L-type lectin-domain containing receptor kinase V.9 OS=Arabidopsis thaliana GN=LECRK59 PE=2 SV=1 | Back alignment and function description |
|---|
| >sp|O80939|LRK41_ARATH L-type lectin-domain containing receptor kinase IV.1 OS=Arabidopsis thaliana GN=LECRK41 PE=1 SV=1 | Back alignment and function description |
|---|
Close Homologs in the Non-Redundant Database Detected by BLAST
Original result of BLAST against Nonredundant Database
| GI | Alignment Graph | Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 413 | ||||||
| 356551830 | 670 | PREDICTED: probable L-type lectin-domain | 0.978 | 0.602 | 0.563 | 1e-122 | |
| 255557152 | 681 | serine-threonine protein kinase, plant-t | 0.966 | 0.585 | 0.573 | 1e-122 | |
| 356500819 | 674 | PREDICTED: probable L-type lectin-domain | 0.951 | 0.583 | 0.567 | 1e-120 | |
| 224134999 | 672 | predicted protein [Populus trichocarpa] | 0.978 | 0.601 | 0.577 | 1e-119 | |
| 357490413 | 672 | Lectin-domain containing receptor kinase | 0.975 | 0.599 | 0.546 | 1e-115 | |
| 359490774 | 671 | PREDICTED: probable L-type lectin-domain | 0.912 | 0.561 | 0.567 | 1e-113 | |
| 302144004 | 606 | unnamed protein product [Vitis vinifera] | 0.661 | 0.450 | 0.567 | 4e-81 | |
| 302768969 | 221 | hypothetical protein SELMODRAFT_88859 [S | 0.460 | 0.859 | 0.447 | 2e-35 | |
| 302761192 | 219 | hypothetical protein SELMODRAFT_82090 [S | 0.447 | 0.844 | 0.423 | 2e-33 | |
| 302822109 | 661 | hypothetical protein SELMODRAFT_135805 [ | 0.745 | 0.465 | 0.313 | 9e-31 |
| >gi|356551830|ref|XP_003544276.1| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Glycine max] | Back alignment and taxonomy information |
|---|
Score = 445 bits (1145), Expect = e-122, Method: Compositional matrix adjust.
Identities = 245/435 (56%), Positives = 309/435 (71%), Gaps = 31/435 (7%)
Query: 2 DICLYYCFFLLVSIEVFSILVDSSPE--ISARKHVFFPDFSLHNNSKILHDLKLLGSAKL 59
+I L +C F L++ + + V S+ E I+ KH F +FS NN +++HD+KLLGSAK
Sbjct: 6 NILLMFCLFNLLA---YPVSVHSAGEVPINVTKHFSFYNFSFSNNPRLVHDVKLLGSAKF 62
Query: 60 SNEKRVIQIPDDSQATDLRHQAGRAIYSSPVRLLDPVTKTPTSFETTFSFQFNTSNNTRT 119
SNEK +QIP++S+ D+RHQAGR IYS P+RLLDP TKTP SF+TTFSFQ N S +
Sbjct: 63 SNEKGALQIPNESE--DIRHQAGRGIYSFPIRLLDPSTKTPASFQTTFSFQMNNSTASEQ 120
Query: 120 SRDGGSSLTFIIVPDEFTVGRAGPWLGVLNDACKDDYKAVAVKFDTCRDLEFGGPNDNHV 179
+ GGS LTFIIVPDEFTVGR+GPWLG+LNDAC++DYKAVAV+FDT ++ EFG PNDNHV
Sbjct: 121 AAYGGSGLTFIIVPDEFTVGRSGPWLGMLNDACENDYKAVAVEFDTRKNPEFGDPNDNHV 180
Query: 180 GINLGSIVSTRAINASDVGIFLNDGSVHRAWIAYDGTRGWMDVRIG-SDGRDYPSTKPTF 238
GINLG+IVST+ IN SDVG+ L DGSV+RAWI YDG + MD+R+G ++ DYPS KP F
Sbjct: 181 GINLGTIVSTKVINVSDVGLSLKDGSVYRAWITYDGPQRRMDIRLGKANQEDYPS-KPMF 239
Query: 239 S---------------GFSASTGNMTQIHNLLSWNFSSISQPFLLIPSTETCENNTMLQQ 283
S GFSASTGN TQIHNLLSWNF+S SQ FL +PS+E+C+ +L+
Sbjct: 240 SESMDLSPYLNEYMFVGFSASTGNHTQIHNLLSWNFTSTSQAFLHLPSSESCQGKILLEN 299
Query: 284 -IAGAGSSGSGQHRQPEPAHGFLIFIVVSVLALVIFLAMYCISRRQRK----DIALPGKK 338
A + S + + EP FLIF+ LAL +FL Y IS+ +R + ++ +
Sbjct: 300 STAATEPTNSQKSSKNEPPRSFLIFVAAVALALALFLGFYFISKHRRNAAKLNTSVETEL 359
Query: 339 QRPRPPNKPRRFTLSEISVATRAFSELECLGSDYRGVYYRGKLPNGRQPVAGKRFSSQFL 398
PRPPNKPRRF S++S ATR+FSE+E LGSD RG YYRGKL G Q VA KRFS+QFL
Sbjct: 360 HMPRPPNKPRRFAFSQLSTATRSFSEIELLGSDNRGEYYRGKLSGGSQ-VAVKRFSAQFL 418
Query: 399 SSQQGLDKRRLLEEI 413
S+ G DK+RLL+EI
Sbjct: 419 ST-HGSDKKRLLKEI 432
|
Source: Glycine max Species: Glycine max Genus: Glycine Family: Fabaceae Order: Fabales Class: Phylum: Streptophyta Superkingdom: Eukaryota |
| >gi|255557152|ref|XP_002519607.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] gi|223541197|gb|EEF42752.1| serine-threonine protein kinase, plant-type, putative [Ricinus communis] | Back alignment and taxonomy information |
|---|
| >gi|356500819|ref|XP_003519228.1| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Glycine max] | Back alignment and taxonomy information |
|---|
| >gi|224134999|ref|XP_002321958.1| predicted protein [Populus trichocarpa] gi|222868954|gb|EEF06085.1| predicted protein [Populus trichocarpa] | Back alignment and taxonomy information |
|---|
| >gi|357490413|ref|XP_003615494.1| Lectin-domain containing receptor kinase A4.2 [Medicago truncatula] gi|355516829|gb|AES98452.1| Lectin-domain containing receptor kinase A4.2 [Medicago truncatula] | Back alignment and taxonomy information |
|---|
| >gi|359490774|ref|XP_002270021.2| PREDICTED: probable L-type lectin-domain containing receptor kinase S.7-like [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302144004|emb|CBI23109.3| unnamed protein product [Vitis vinifera] | Back alignment and taxonomy information |
|---|
| >gi|302768969|ref|XP_002967904.1| hypothetical protein SELMODRAFT_88859 [Selaginella moellendorffii] gi|300164642|gb|EFJ31251.1| hypothetical protein SELMODRAFT_88859 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|302761192|ref|XP_002964018.1| hypothetical protein SELMODRAFT_82090 [Selaginella moellendorffii] gi|300167747|gb|EFJ34351.1| hypothetical protein SELMODRAFT_82090 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
| >gi|302822109|ref|XP_002992714.1| hypothetical protein SELMODRAFT_135805 [Selaginella moellendorffii] gi|300139455|gb|EFJ06195.1| hypothetical protein SELMODRAFT_135805 [Selaginella moellendorffii] | Back alignment and taxonomy information |
|---|
Prediction of Gene Ontology (GO) Terms
Close Homologs with Gene Ontology terms Detected by BLAST
Original result of BLAST against Gene Ontology (AMIGO)
| ID |
Alignment graph |
Length |
Definition |
Q cover |
H cover |
Identity |
E-value |
| Query | 413 | ||||||
| TAIR|locus:2083986 | 715 | AT3G53380 [Arabidopsis thalian | 0.496 | 0.286 | 0.352 | 3.5e-29 | |
| TAIR|locus:2143528 | 711 | AT5G03140 [Arabidopsis thalian | 0.525 | 0.305 | 0.351 | 4.1e-29 | |
| TAIR|locus:2133229 | 674 | LPK1 "lectin-like protein kina | 0.871 | 0.534 | 0.252 | 4e-18 | |
| UNIPROTKB|P42088 | 240 | P42088 "Lectin" [Leucomphalos | 0.472 | 0.812 | 0.321 | 4.2e-17 | |
| TAIR|locus:2099941 | 684 | AT3G55550 [Arabidopsis thalian | 0.438 | 0.264 | 0.326 | 6.1e-17 | |
| TAIR|locus:2162212 | 681 | AT5G55830 [Arabidopsis thalian | 0.428 | 0.259 | 0.317 | 9.1e-17 | |
| TAIR|locus:2119936 | 669 | AT4G29050 [Arabidopsis thalian | 0.380 | 0.234 | 0.316 | 5.1e-15 | |
| TAIR|locus:2084375 | 677 | AT3G53810 [Arabidopsis thalian | 0.736 | 0.449 | 0.276 | 1.6e-14 | |
| TAIR|locus:2170224 | 652 | AT5G06740 [Arabidopsis thalian | 0.518 | 0.328 | 0.307 | 1.6e-14 | |
| TAIR|locus:2165740 | 691 | AT5G42120 [Arabidopsis thalian | 0.404 | 0.241 | 0.322 | 2.3e-13 |
| TAIR|locus:2083986 AT3G53380 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Score = 284 (105.0 bits), Expect = 3.5e-29, Sum P(2) = 3.5e-29
Identities = 80/227 (35%), Positives = 113/227 (49%)
Query: 48 LHDLKLLGSAKLSNEKRVIQIPDDSQATDLRHQAGRAIYSSPVRLLDPVTKTPTSFETTF 107
+ +LKLLG A+LSN ++ + D + AG+ +YS+P+R P T PTSF + F
Sbjct: 31 ISNLKLLGDARLSNG--IVGLTRDLSVPN--SGAGKVLYSNPIRFRQPGTHFPTSFSSFF 86
Query: 108 SFQFNTSNNTRTSRDGGSSLTFIIVPDEFTVGRAGPWLGVLNDACKDDYKAVAVKFDTCR 167
SF N S GG L F+I PD ++G AG LG L K VAV+FDT
Sbjct: 87 SFSIT---NVNPSSIGGG-LAFVISPDANSIGIAGGSLG-LTGPNGSGSKFVAVEFDTLM 141
Query: 168 DLEFGGPNDNHVGINLGSIVSTRAINASDVGIFLNDGSVHRAWIAYDGTRGWMDVRIGSD 227
D++F N NHVG ++ +VS+ + + V I L G+ +WI YDG +V +
Sbjct: 142 DVDFKDINSNHVGFDVNGVVSSVSGDLGTVNIDLKSGNTINSWIEYDGLTRVFNVSVSYS 201
Query: 228 GR-------DYPSTKPT------FSGFSASTGNMTQIHNLLSWNFSS 261
+P F GFS ST T+IH++ W+FSS
Sbjct: 202 NLKPKVPILSFPLDLDRYVNDFMFVGFSGSTQGSTEIHSIEWWSFSS 248
|
|
| TAIR|locus:2143528 AT5G03140 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2133229 LPK1 "lectin-like protein kinase 1" [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| UNIPROTKB|P42088 P42088 "Lectin" [Leucomphalos mildbraedii (taxid:28956)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2099941 AT3G55550 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2162212 AT5G55830 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2119936 AT4G29050 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2084375 AT3G53810 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2170224 AT5G06740 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
| TAIR|locus:2165740 AT5G42120 [Arabidopsis thaliana (taxid:3702)] | Back alignment and assigned GO terms |
|---|
Prediction of Enzyme Commission (EC) Number
EC Number Prediction by Annotation Transfer from SWISS-PROT Entries
Original result of BLAST against SWISS-PROT
No confident hit for EC number transfering in SWISSPROT detected by BLAST
EC Number Prediction by Ezypred Server
Original result from Ezypred Server
Fail to connect to Ezypred Server
EC Number Prediction by EFICAz Software
No EC number assignment, probably not an enzyme!
Prediction of Functionally Associated Proteins
Functionally Associated Proteins Detected by STRING
Original result from the STRING server
Fail to connect to STRING server
Conserved Domains and Related Protein Families
Conserved Domains Detected by RPS-BLAST
Original result of RPS-BLAST against CDD database part I
| ID | Alignment Graph | Length |
Definition |
E-value |
| Query | 413 | |||
| cd06899 | 236 | cd06899, lectin_legume_LecRK_Arcelin_ConA, legume | 9e-62 | |
| pfam00139 | 231 | pfam00139, Lectin_legB, Legume lectin domain | 3e-51 | |
| cd01951 | 223 | cd01951, lectin_L-type, legume lectins | 1e-21 |
| >gnl|CDD|173887 cd06899, lectin_legume_LecRK_Arcelin_ConA, legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Score = 198 bits (507), Expect = 9e-62
Identities = 86/241 (35%), Positives = 121/241 (50%), Gaps = 27/241 (11%)
Query: 39 FSLHNNSKILHDLKLLGSAKLSNEKRVIQIPDDSQATDLRHQAGRAIYSSPVRLLDPVTK 98
F+ + S +L L G A +S+ +Q+ +D+ GRA+YS PVRL D T
Sbjct: 3 FNFNGFSSDQSNLTLQGDATISSNG-ALQLTNDTSPA---SSVGRALYSKPVRLWDSTTG 58
Query: 99 TPTSFETTFSFQFNTSNNTRTSRDGGSSLTFIIVPDEFTVGR-AGPWLGVLNDAC--KDD 155
SF T+FSF N + GG L F + P + +G +LG+ N +
Sbjct: 59 KVASFSTSFSFSITPPNPS----LGGDGLAFFLAPTDSLPPASSGGYLGLFNSSNNGNSS 114
Query: 156 YKAVAVKFDTCRDLEFGGPNDNHVGINLGSIVSTRAINASDVGIFLNDGSVHRAWIAYDG 215
VAV+FDT ++ EFG P+DNHVGI++ S+VS +A D G L G +AWI YD
Sbjct: 115 NHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVSVKAGYWDDDGGKLKSGKPMQAWIDYDS 174
Query: 216 TRGWMDVRIGSDGRDYPSTKPTFS---------------GFSASTGNMTQIHNLLSWNFS 260
+ + V + G P KP S GFSASTG +T++H +LSW+FS
Sbjct: 175 SSKRLSVTLAYSGVAKP-KKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHYILSWSFS 233
Query: 261 S 261
S
Sbjct: 234 S 234
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by binding glycans on the cell surface. Medically, PHA is used as a mitogen to trigger cell division in T-lymphocytes and to activate latent HIV-1 from human peripheral lymphocytes. Plant L-type lectins are primarily found in the seeds of leguminous plants where they constitute about 10% of the total soluble protein of the seed extracts. They are synthesized during seed development several weeks after flowering and transported to the vacuole where they become condensed into specialized vesicles called protein bodies. L-type lectins have a dome-shaped beta-barrel carbohydrate recognition domain with a curved seven-stranded beta-sheet referred to as the "front face" and a flat six-stranded beta-sheet referred to as the "back face". This domain homodimerizes so that adjacent back sheets form a contiguous 12-stranded sheet and homotetramers occur by a back-to-back association of these homodimers. Though L-type lectins exhibit both sequence and structural similarity to one another, their carbohydrate binding specificities differ widely. Length = 236 |
| >gnl|CDD|215744 pfam00139, Lectin_legB, Legume lectin domain | Back alignment and domain information |
|---|
| >gnl|CDD|173886 cd01951, lectin_L-type, legume lectins | Back alignment and domain information |
|---|
Conserved Domains Detected by HHsearch
Original result of HHsearch against CDD database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 413 | |||
| cd06899 | 236 | lectin_legume_LecRK_Arcelin_ConA legume lectins, l | 100.0 | |
| PF00139 | 236 | Lectin_legB: Legume lectin domain; InterPro: IPR00 | 100.0 | |
| cd01951 | 223 | lectin_L-type legume lectins. The L-type (legume-t | 100.0 | |
| cd07308 | 218 | lectin_leg-like legume-like lectins: ERGIC-53, ERG | 99.9 | |
| cd06901 | 248 | lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembr | 99.8 | |
| cd06902 | 225 | lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 tran | 99.77 | |
| cd06903 | 215 | lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmem | 99.65 | |
| PF03388 | 229 | Lectin_leg-like: Legume-like lectin family; InterP | 99.6 | |
| KOG3839 | 351 | consensus Lectin VIP36, involved in the transport | 99.47 | |
| KOG3838 | 497 | consensus Mannose lectin ERGIC-53, involved in gly | 99.27 | |
| KOG1187 | 361 | consensus Serine/threonine protein kinase [Signal | 98.97 | |
| cd06900 | 255 | lectin_VcfQ VcfQ bacterial pilus biogenesis protei | 98.96 | |
| KOG3653 | 534 | consensus Transforming growth factor beta/activin | 98.11 | |
| KOG0196 | 996 | consensus Tyrosine kinase, EPH (ephrin) receptor f | 97.86 | |
| PLN00113 | 968 | leucine-rich repeat receptor-like protein kinase; | 97.65 | |
| KOG1025 | 1177 | consensus Epidermal growth factor receptor EGFR an | 97.26 | |
| KOG1094 | 807 | consensus Discoidin domain receptor DDR1 [Signal t | 96.95 | |
| PLN03224 | 507 | probable serine/threonine protein kinase; Provisio | 96.86 | |
| KOG0193 | 678 | consensus Serine/threonine protein kinase RAF [Sig | 96.63 | |
| KOG2052 | 513 | consensus Activin A type IB receptor, serine/threo | 96.54 | |
| KOG0658 | 364 | consensus Glycogen synthase kinase-3 [Carbohydrate | 96.4 | |
| KOG1026 | 774 | consensus Nerve growth factor receptor TRKA and re | 96.11 | |
| cd06624 | 268 | STKc_ASK Catalytic domain of the Protein Serine/Th | 95.85 | |
| KOG0595 | 429 | consensus Serine/threonine-protein kinase involved | 95.81 | |
| PTZ00284 | 467 | protein kinase; Provisional | 95.5 | |
| PLN03225 | 566 | Serine/threonine-protein kinase SNT7; Provisional | 95.31 | |
| cd06638 | 286 | STKc_myosinIIIA Catalytic domain of the Protein Se | 95.18 | |
| KOG1095 | 1025 | consensus Protein tyrosine kinase [Signal transduc | 94.84 | |
| cd06639 | 291 | STKc_myosinIIIB Catalytic domain of the Protein Se | 94.75 | |
| cd05108 | 316 | PTKc_EGFR Catalytic domain of the Protein Tyrosine | 94.54 | |
| cd07879 | 342 | STKc_p38delta_MAPK13 Catalytic domain of the Serin | 94.25 | |
| KOG0192 | 362 | consensus Tyrosine kinase specific for activated ( | 94.23 | |
| PTZ00283 | 496 | serine/threonine protein kinase; Provisional | 93.76 | |
| cd07877 | 345 | STKc_p38alpha_MAPK14 Catalytic domain of the Serin | 93.67 | |
| KOG0194 | 474 | consensus Protein tyrosine kinase [Signal transduc | 93.53 | |
| KOG0201 | 467 | consensus Serine/threonine protein kinase [Signal | 93.31 | |
| cd06636 | 282 | STKc_MAP4K4_6 Catalytic domain of the Protein Seri | 93.29 | |
| KOG4236 | 888 | consensus Serine/threonine protein kinase PKC mu/P | 93.1 | |
| cd05596 | 370 | STKc_ROCK Catalytic domain of the Protein Serine/T | 93.03 | |
| cd07856 | 328 | STKc_Sty1_Hog1 Catalytic domain of the Serine/Thre | 92.98 | |
| cd05104 | 375 | PTKc_Kit Catalytic domain of the Protein Tyrosine | 92.88 | |
| PRK09188 | 365 | serine/threonine protein kinase; Provisional | 92.79 | |
| PLN00034 | 353 | mitogen-activated protein kinase kinase; Provision | 92.75 | |
| cd05103 | 343 | PTKc_VEGFR2 Catalytic domain of the Protein Tyrosi | 92.74 | |
| cd05102 | 338 | PTKc_VEGFR3 Catalytic domain of the Protein Tyrosi | 92.72 | |
| cd05144 | 198 | RIO2_C RIO kinase family; RIO2, C-terminal catalyt | 92.53 | |
| KOG0199 | 1039 | consensus ACK and related non-receptor tyrosine ki | 92.46 | |
| PTZ00036 | 440 | glycogen synthase kinase; Provisional | 92.45 | |
| PTZ00263 | 329 | protein kinase A catalytic subunit; Provisional | 92.39 | |
| cd06607 | 307 | STKc_TAO Catalytic domain of the Protein Serine/Th | 92.1 | |
| PHA02988 | 283 | hypothetical protein; Provisional | 92.03 | |
| cd05621 | 370 | STKc_ROCK2 Catalytic domain of the Protein Serine/ | 91.88 | |
| cd05105 | 400 | PTKc_PDGFR_alpha Catalytic domain of the Protein T | 91.77 | |
| cd07878 | 343 | STKc_p38beta_MAPK11 Catalytic domain of the Serine | 91.67 | |
| cd06656 | 297 | STKc_PAK3 Catalytic domain of the Protein Serine/T | 91.45 | |
| cd05107 | 401 | PTKc_PDGFR_beta Catalytic domain of the Protein Ty | 91.45 | |
| cd05106 | 374 | PTKc_CSF-1R Catalytic domain of the Protein Tyrosi | 91.29 | |
| cd07876 | 359 | STKc_JNK2 Catalytic domain of the Serine/Threonine | 91.28 | |
| cd06657 | 292 | STKc_PAK4 Catalytic domain of the Protein Serine/T | 91.17 | |
| cd06635 | 317 | STKc_TAO1 Catalytic domain of the Protein Serine/T | 91.06 | |
| cd07875 | 364 | STKc_JNK1 Catalytic domain of the Serine/Threonine | 90.99 | |
| cd05109 | 279 | PTKc_HER2 Catalytic domain of the Protein Tyrosine | 90.99 | |
| cd06644 | 292 | STKc_STK10_LOK Catalytic domain of the Protein Ser | 90.98 | |
| cd06659 | 297 | STKc_PAK6 Catalytic domain of the Protein Serine/T | 90.79 | |
| cd05622 | 371 | STKc_ROCK1 Catalytic domain of the Protein Serine/ | 90.74 | |
| KOG0663 | 419 | consensus Protein kinase PITSLRE and related kinas | 90.72 | |
| cd07864 | 302 | STKc_CDK12 Catalytic domain of the Serine/Threonin | 90.69 | |
| cd06614 | 286 | STKc_PAK Catalytic domain of the Protein Serine/Th | 90.62 | |
| cd07874 | 355 | STKc_JNK3 Catalytic domain of the Serine/Threonine | 90.53 | |
| KOG0197 | 468 | consensus Tyrosine kinases [Signal transduction me | 90.51 | |
| KOG0594 | 323 | consensus Protein kinase PCTAIRE and related kinas | 90.38 | |
| cd06647 | 293 | STKc_PAK_I Catalytic domain of the Protein Serine/ | 90.33 | |
| KOG0580 | 281 | consensus Serine/threonine protein kinase [Cell cy | 90.25 | |
| cd06648 | 285 | STKc_PAK_II Catalytic domain of the Protein Serine | 90.25 | |
| cd06654 | 296 | STKc_PAK1 Catalytic domain of the Protein Serine/T | 90.17 | |
| KOG1006 | 361 | consensus Mitogen-activated protein kinase (MAPK) | 90.16 | |
| cd06655 | 296 | STKc_PAK2 Catalytic domain of the Protein Serine/T | 90.05 | |
| PTZ00426 | 340 | cAMP-dependent protein kinase catalytic subunit; P | 89.8 | |
| KOG4257 | 974 | consensus Focal adhesion tyrosine kinase FAK, cont | 89.68 | |
| PHA02882 | 294 | putative serine/threonine kinase; Provisional | 89.39 | |
| PF04478 | 154 | Mid2: Mid2 like cell wall stress sensor; InterPro: | 89.36 | |
| cd07851 | 343 | STKc_p38 Catalytic domain of the Serine/Threonine | 89.36 | |
| smart00090 | 237 | RIO RIO-like kinase. | 89.3 | |
| cd05053 | 293 | PTKc_FGFR Catalytic domain of the Protein Tyrosine | 89.29 | |
| cd06658 | 292 | STKc_PAK5 Catalytic domain of the Protein Serine/T | 89.19 | |
| cd07880 | 343 | STKc_p38gamma_MAPK12 Catalytic domain of the Serin | 89.17 | |
| cd06618 | 296 | PKc_MKK7 Catalytic domain of the dual-specificity | 89.0 | |
| TIGR01982 | 437 | UbiB 2-polyprenylphenol 6-hydroxylase. This model | 88.94 | |
| cd06646 | 267 | STKc_MAP4K5 Catalytic domain of the Protein Serine | 88.87 | |
| cd06633 | 313 | STKc_TAO3 Catalytic domain of the Protein Serine/T | 88.85 | |
| cd07865 | 310 | STKc_CDK9 Catalytic domain of the Serine/Threonine | 88.64 | |
| KOG1035 | 1351 | consensus eIF-2alpha kinase GCN2 [Translation, rib | 88.52 | |
| cd05054 | 337 | PTKc_VEGFR Catalytic domain of the Protein Tyrosin | 88.45 | |
| KOG4278 | 1157 | consensus Protein tyrosine kinase [Signal transduc | 88.32 | |
| KOG0577 | 948 | consensus Serine/threonine protein kinase [Signal | 88.16 | |
| cd07845 | 309 | STKc_CDK10 Catalytic domain of the Serine/Threonin | 88.01 | |
| cd05057 | 279 | PTKc_EGFR_like Catalytic domain of Epidermal Growt | 87.93 | |
| KOG0575 | 592 | consensus Polo-like serine/threonine protein kinas | 87.83 | |
| cd05110 | 303 | PTKc_HER4 Catalytic domain of the Protein Tyrosine | 87.57 | |
| cd05055 | 302 | PTKc_PDGFR Catalytic domain of the Protein Tyrosin | 87.41 | |
| cd06634 | 308 | STKc_TAO2 Catalytic domain of the Protein Serine/T | 87.29 | |
| KOG0694 | 694 | consensus Serine/threonine protein kinase [Signal | 87.28 | |
| KOG0600 | 560 | consensus Cdc2-related protein kinase [Cell cycle | 87.23 | |
| cd05111 | 279 | PTK_HER3 Pseudokinase domain of the Protein Tyrosi | 86.92 | |
| cd07850 | 353 | STKc_JNK Catalytic domain of the Serine/Threonine | 86.29 | |
| PHA03209 | 357 | serine/threonine kinase US3; Provisional | 86.2 | |
| KOG0661 | 538 | consensus MAPK related serine/threonine protein ki | 86.12 | |
| KOG0591 | 375 | consensus NIMA (never in mitosis)-related G2-speci | 85.89 | |
| PTZ00024 | 335 | cyclin-dependent protein kinase; Provisional | 85.87 | |
| KOG0605 | 550 | consensus NDR and related serine/threonine kinases | 85.7 | |
| PF03109 | 119 | ABC1: ABC1 family; InterPro: IPR004147 This entry | 85.47 | |
| PHA03211 | 461 | serine/threonine kinase US3; Provisional | 85.45 | |
| cd07852 | 337 | STKc_MAPK15 Catalytic domain of the Serine/Threoni | 85.07 | |
| PHA03212 | 391 | serine/threonine kinase US3; Provisional | 84.9 | |
| KOG0032 | 382 | consensus Ca2+/calmodulin-dependent protein kinase | 84.56 | |
| cd07866 | 311 | STKc_BUR1 Catalytic domain of the Serine/Threonine | 84.42 | |
| PRK09605 | 535 | bifunctional UGMP family protein/serine/threonine | 84.29 | |
| KOG0198 | 313 | consensus MEKK and related serine/threonine protei | 84.21 | |
| cd05101 | 304 | PTKc_FGFR2 Catalytic domain of the Protein Tyrosin | 83.76 | |
| PF15065 | 350 | NCU-G1: Lysosomal transcription factor, NCU-G1 | 83.42 | |
| KOG4250 | 732 | consensus TANK binding protein kinase TBK1 [Signal | 83.19 | |
| cd05098 | 307 | PTKc_FGFR1 Catalytic domain of the Protein Tyrosin | 83.02 | |
| cd05099 | 314 | PTKc_FGFR4 Catalytic domain of the Protein Tyrosin | 82.61 | |
| PTZ00266 | 1021 | NIMA-related protein kinase; Provisional | 82.13 | |
| KOG0581 | 364 | consensus Mitogen-activated protein kinase kinase | 81.82 | |
| KOG0667 | 586 | consensus Dual-specificity tyrosine-phosphorylatio | 81.67 | |
| PTZ00382 | 96 | Variant-specific surface protein (VSP); Provisiona | 81.45 | |
| PF01102 | 122 | Glycophorin_A: Glycophorin A; InterPro: IPR001195 | 81.45 | |
| PRK04750 | 537 | ubiB putative ubiquinone biosynthesis protein UbiB | 81.31 | |
| KOG0574 | 502 | consensus STE20-like serine/threonine kinase MST [ | 80.59 | |
| cd06645 | 267 | STKc_MAP4K3 Catalytic domain of the Protein Serine | 80.46 |
| >cd06899 lectin_legume_LecRK_Arcelin_ConA legume lectins, lectin-like receptor kinases, arcelin, concanavalinA, and alpha-amylase inhibitor | Back alignment and domain information |
|---|
Probab=100.00 E-value=2.2e-50 Score=378.58 Aligned_cols=217 Identities=39% Similarity=0.639 Sum_probs=191.5
Q ss_pred eeEEcCCCCCCCCcCcccCeEEecceEEeCCCCeEEcCCCCCCcCCCCceEEEEecCceeecCCCCCCccceEEEEEEEE
Q 042239 32 KHVFFPDFSLHNNSKILHDLKLLGSAKLSNEKRVIQIPDDSQATDLRHQAGRAIYSSPVRLLDPVTKTPTSFETTFSFQF 111 (413)
Q Consensus 32 ~~f~~~~f~~~~~~~~~~~l~l~G~A~~~~~~~~i~LT~~~~~~~~~~~~G~~~y~~pv~l~~~~~~~~~sF~t~F~f~i 111 (413)
++|+|+.|..+ . ++|+|+|+|.+.+ ++.|+||++.. ..+++|||||++||+||++.+++++||+|+|+|+|
T Consensus 1 ~~f~f~~f~~~-~----~~l~l~G~A~~~~-~~~i~LT~~~~---~~~~~G~v~y~~pi~l~~~~~~~~~sFst~F~F~i 71 (236)
T cd06899 1 LSFNFNGFSSD-Q----SNLTLQGDATISS-NGALQLTNDTS---PASSVGRALYSKPVRLWDSTTGKVASFSTSFSFSI 71 (236)
T ss_pred CceecCCCCCC-C----CCEEEecceEcCC-CCeEEecCCCC---CCcceEEEEeCCCEEeecCCCCCceeEEEEEEEEE
Confidence 47999999862 2 7999999999985 78999999872 12899999999999999999999999999999999
Q ss_pred ecCCCCCCCCCCCCcEEEEEecCCCCC-CCCCCccccccCCCC--CCCceEEEEeeecccCccCCCCCCceeEecCCCcc
Q 042239 112 NTSNNTRTSRDGGSSLTFIIVPDEFTV-GRAGPWLGVLNDACK--DDYKAVAVKFDTCRDLEFGGPNDNHVGINLGSIVS 188 (413)
Q Consensus 112 ~~~~~~~~~~~~gdGlaF~l~~~~~~~-~~~g~~lGl~~~~~~--g~~~~vAVEfDT~~n~~~~dp~~~Hvgi~~ns~~s 188 (413)
.... ...+||||||+|+|+.... +..|++|||++..+. +.++.||||||||+|.+++||+.+||||++|++.|
T Consensus 72 ~~~~----~~~~gdGlAF~i~~~~~~~~~~~G~~lG~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHigIdvn~~~S 147 (236)
T cd06899 72 TPPN----PSLGGDGLAFFLAPTDSLPPASSGGYLGLFNSSNNGNSSNHIVAVEFDTFQNPEFGDPDDNHVGIDVNSLVS 147 (236)
T ss_pred EcCC----CCCCCCeEEEEEecCCCCCCCCCcceeeeecCCCCCCcccceEEEEeecccCcccCCCCCCeEEEEcCCccc
Confidence 9765 5678999999999988544 688999999987765 46899999999999998889999999999999998
Q ss_pred cccccCCCCccccCCCCeEEEEEEEeCCCcEEEEEEEecCCCCCCCCCeee---------------eeeeecCCccceEe
Q 042239 189 TRAINASDVGIFLNDGSVHRAWIAYDGTRGWMDVRIGSDGRDYPSTKPTFS---------------GFSASTGNMTQIHN 253 (413)
Q Consensus 189 ~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~~l~---------------GFsasTG~~~~~h~ 253 (413)
..+..+....++|.+|+.++|||+||+.+++|+|+|+ .....+|..++|+ |||||||...|.|+
T Consensus 148 ~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~-~~~~~~~~~~~ls~~vdL~~~l~~~~~vGFSasTG~~~~~h~ 226 (236)
T cd06899 148 VKAGYWDDDGGKLKSGKPMQAWIDYDSSSKRLSVTLA-YSGVAKPKKPLLSYPVDLSKVLPEEVYVGFSASTGLLTELHY 226 (236)
T ss_pred ceeeccccccccccCCCeEEEEEEEcCCCCEEEEEEE-eCCCCCCcCCEEEEeccHHHhCCCceEEEEEeEcCCCcceEE
Confidence 8888777656678999999999999999999999999 4432577788876 99999999999999
Q ss_pred EEeeEEeeC
Q 042239 254 LLSWNFSSI 262 (413)
Q Consensus 254 I~sWsf~~~ 262 (413)
|++|+|+++
T Consensus 227 i~sWsF~s~ 235 (236)
T cd06899 227 ILSWSFSSN 235 (236)
T ss_pred EEEEEEEcC
Confidence 999999985
|
This alignment model includes the legume lectins (also known as agglutinins), the arcelin (also known as phytohemagglutinin-L) family of lectin-like defense proteins, the LecRK family of lectin-like receptor kinases, concanavalinA (ConA), and an alpha-amylase inhibitor. Arcelin is a major seed glycoprotein discovered in kidney beans (Phaseolus vulgaris) that has insecticidal properties and protects the seeds from predation by larvae of various bruchids. Arcelin is devoid of monosaccharide binding properties and lacks a key metal-binding loop that is present in other members of this family. Phytohaemagglutinin (PHA) is a lectin found in plants, especially beans, that affects cell metabolism by inducing mitosis and by altering the permeability of the cell membrane to various proteins. PHA agglutinates most mammalian red blood cell types by bindin |
| >PF00139 Lectin_legB: Legume lectin domain; InterPro: IPR001220 Legume lectins are one of the largest lectin families with more than 70 lectins reported | Back alignment and domain information |
|---|
| >cd01951 lectin_L-type legume lectins | Back alignment and domain information |
|---|
| >cd07308 lectin_leg-like legume-like lectins: ERGIC-53, ERGL, VIP36, VIPL, EMP46, and EMP47 | Back alignment and domain information |
|---|
| >cd06901 lectin_VIP36_VIPL VIP36 and VIPL type 1 transmembrane proteins, lectin domain | Back alignment and domain information |
|---|
| >cd06902 lectin_ERGIC-53_ERGL ERGIC-53 and ERGL type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >cd06903 lectin_EMP46_EMP47 EMP46 and EMP47 type 1 transmembrane proteins, N-terminal lectin domain | Back alignment and domain information |
|---|
| >PF03388 Lectin_leg-like: Legume-like lectin family; InterPro: IPR005052 Lectins are structurally diverse proteins that bind to specific carbohydrates | Back alignment and domain information |
|---|
| >KOG3839 consensus Lectin VIP36, involved in the transport of glycoproteins carrying high mannose-type glycans [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG3838 consensus Mannose lectin ERGIC-53, involved in glycoprotein traffic [Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >KOG1187 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06900 lectin_VcfQ VcfQ bacterial pilus biogenesis protein, lectin domain | Back alignment and domain information |
|---|
| >KOG3653 consensus Transforming growth factor beta/activin receptor subfamily of serine/threonine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0196 consensus Tyrosine kinase, EPH (ephrin) receptor family [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN00113 leucine-rich repeat receptor-like protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG1025 consensus Epidermal growth factor receptor EGFR and related tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG1094 consensus Discoidin domain receptor DDR1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PLN03224 probable serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0193 consensus Serine/threonine protein kinase RAF [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG2052 consensus Activin A type IB receptor, serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0658 consensus Glycogen synthase kinase-3 [Carbohydrate transport and metabolism] | Back alignment and domain information |
|---|
| >KOG1026 consensus Nerve growth factor receptor TRKA and related tyrosine kinases [Signal transduction mechanisms; Intracellular trafficking, secretion, and vesicular transport] | Back alignment and domain information |
|---|
| >cd06624 STKc_ASK Catalytic domain of the Protein Serine/Threonine Kinase, Apoptosis signal-regulating kinase | Back alignment and domain information |
|---|
| >KOG0595 consensus Serine/threonine-protein kinase involved in autophagy [Posttranslational modification, protein turnover, chaperones; Intracellular trafficking, secretion, and vesicular transport; Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00284 protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN03225 Serine/threonine-protein kinase SNT7; Provisional | Back alignment and domain information |
|---|
| >cd06638 STKc_myosinIIIA Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIA myosin | Back alignment and domain information |
|---|
| >KOG1095 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06639 STKc_myosinIIIB Catalytic domain of the Protein Serine/Threonine Kinase, Class IIIB myosin | Back alignment and domain information |
|---|
| >cd05108 PTKc_EGFR Catalytic domain of the Protein Tyrosine Kinase, Epidermal Growth Factor Receptor | Back alignment and domain information |
|---|
| >cd07879 STKc_p38delta_MAPK13 Catalytic domain of the Serine/Threonine Kinase, p38delta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0192 consensus Tyrosine kinase specific for activated (GTP-bound) p21cdc42Hs [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00283 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >cd07877 STKc_p38alpha_MAPK14 Catalytic domain of the Serine/Threonine Kinase, p38alpha Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >KOG0194 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0201 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06636 STKc_MAP4K4_6 Catalytic domain of the Protein Serine/Threonine Kinases, Mitogen-Activated Protein Kinase Kinase Kinase Kinase 4 and 6 | Back alignment and domain information |
|---|
| >KOG4236 consensus Serine/threonine protein kinase PKC mu/PKD and related proteins [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05596 STKc_ROCK Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase | Back alignment and domain information |
|---|
| >cd07856 STKc_Sty1_Hog1 Catalytic domain of the Serine/Threonine Kinases, Fungal Mitogen-Activated Protein Kinases Sty1 and Hog1 | Back alignment and domain information |
|---|
| >cd05104 PTKc_Kit Catalytic domain of the Protein Tyrosine Kinase, Kit | Back alignment and domain information |
|---|
| >PRK09188 serine/threonine protein kinase; Provisional | Back alignment and domain information |
|---|
| >PLN00034 mitogen-activated protein kinase kinase; Provisional | Back alignment and domain information |
|---|
| >cd05103 PTKc_VEGFR2 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >cd05102 PTKc_VEGFR3 Catalytic domain of the Protein Tyrosine Kinase, Vascular Endothelial Growth Factor Receptor 3 | Back alignment and domain information |
|---|
| >cd05144 RIO2_C RIO kinase family; RIO2, C-terminal catalytic domain | Back alignment and domain information |
|---|
| >KOG0199 consensus ACK and related non-receptor tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PTZ00036 glycogen synthase kinase; Provisional | Back alignment and domain information |
|---|
| >PTZ00263 protein kinase A catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >cd06607 STKc_TAO Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids proteins | Back alignment and domain information |
|---|
| >PHA02988 hypothetical protein; Provisional | Back alignment and domain information |
|---|
| >cd05621 STKc_ROCK2 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 2 | Back alignment and domain information |
|---|
| >cd05105 PTKc_PDGFR_alpha Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor alpha | Back alignment and domain information |
|---|
| >cd07878 STKc_p38beta_MAPK11 Catalytic domain of the Serine/Threonine Kinase, p38beta Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06656 STKc_PAK3 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 3 | Back alignment and domain information |
|---|
| >cd05107 PTKc_PDGFR_beta Catalytic domain of the Protein Tyrosine Kinase, Platelet Derived Growth Factor Receptor beta | Back alignment and domain information |
|---|
| >cd05106 PTKc_CSF-1R Catalytic domain of the Protein Tyrosine Kinase, Colony-Stimulating Factor-1 Receptor | Back alignment and domain information |
|---|
| >cd07876 STKc_JNK2 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 2 | Back alignment and domain information |
|---|
| >cd06657 STKc_PAK4 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 4 | Back alignment and domain information |
|---|
| >cd06635 STKc_TAO1 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 1 | Back alignment and domain information |
|---|
| >cd07875 STKc_JNK1 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 1 | Back alignment and domain information |
|---|
| >cd05109 PTKc_HER2 Catalytic domain of the Protein Tyrosine Kinase, HER2 | Back alignment and domain information |
|---|
| >cd06644 STKc_STK10_LOK Catalytic domain of the Protein Serine/Threonine Kinase, STK10 or Lymphocyte-oriented kinase | Back alignment and domain information |
|---|
| >cd06659 STKc_PAK6 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 6 | Back alignment and domain information |
|---|
| >cd05622 STKc_ROCK1 Catalytic domain of the Protein Serine/Threonine Kinase, Rho-associated coiled-coil containing protein kinase 1 | Back alignment and domain information |
|---|
| >KOG0663 consensus Protein kinase PITSLRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd07864 STKc_CDK12 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 12 | Back alignment and domain information |
|---|
| >cd06614 STKc_PAK Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase | Back alignment and domain information |
|---|
| >cd07874 STKc_JNK3 Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase 3 | Back alignment and domain information |
|---|
| >KOG0197 consensus Tyrosine kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0594 consensus Protein kinase PCTAIRE and related kinases [General function prediction only] | Back alignment and domain information |
|---|
| >cd06647 STKc_PAK_I Catalytic domain of the Protein Serine/Threonine Kinase, Group I p21-activated kinase | Back alignment and domain information |
|---|
| >KOG0580 consensus Serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd06648 STKc_PAK_II Catalytic domain of the Protein Serine/Threonine Kinase, Group II p21-activated kinase | Back alignment and domain information |
|---|
| >cd06654 STKc_PAK1 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 1 | Back alignment and domain information |
|---|
| >KOG1006 consensus Mitogen-activated protein kinase (MAPK) kinase MKK4 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06655 STKc_PAK2 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 2 | Back alignment and domain information |
|---|
| >PTZ00426 cAMP-dependent protein kinase catalytic subunit; Provisional | Back alignment and domain information |
|---|
| >KOG4257 consensus Focal adhesion tyrosine kinase FAK, contains FERM domain [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >PHA02882 putative serine/threonine kinase; Provisional | Back alignment and domain information |
|---|
| >PF04478 Mid2: Mid2 like cell wall stress sensor; InterPro: IPR007567 This family represents a region near the C terminus of Mid2, which contains a transmembrane region | Back alignment and domain information |
|---|
| >cd07851 STKc_p38 Catalytic domain of the Serine/Threonine Kinase, p38 Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >smart00090 RIO RIO-like kinase | Back alignment and domain information |
|---|
| >cd05053 PTKc_FGFR Catalytic domain of the Protein Tyrosine Kinases, Fibroblast Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06658 STKc_PAK5 Catalytic domain of the Protein Serine/Threonine Kinase, p21-activated kinase 5 | Back alignment and domain information |
|---|
| >cd07880 STKc_p38gamma_MAPK12 Catalytic domain of the Serine/Threonine Kinase, p38gamma Mitogen-Activated Protein Kinase | Back alignment and domain information |
|---|
| >cd06618 PKc_MKK7 Catalytic domain of the dual-specificity Protein Kinase, MAP kinase kinase 7 | Back alignment and domain information |
|---|
| >TIGR01982 UbiB 2-polyprenylphenol 6-hydroxylase | Back alignment and domain information |
|---|
| >cd06646 STKc_MAP4K5 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 5 | Back alignment and domain information |
|---|
| >cd06633 STKc_TAO3 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 3 | Back alignment and domain information |
|---|
| >cd07865 STKc_CDK9 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 9 | Back alignment and domain information |
|---|
| >KOG1035 consensus eIF-2alpha kinase GCN2 [Translation, ribosomal structure and biogenesis] | Back alignment and domain information |
|---|
| >cd05054 PTKc_VEGFR Catalytic domain of the Protein Tyrosine Kinases, Vascular Endothelial Growth Factor Receptors | Back alignment and domain information |
|---|
| >KOG4278 consensus Protein tyrosine kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0577 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07845 STKc_CDK10 Catalytic domain of the Serine/Threonine Kinase, Cyclin-Dependent protein Kinase 10 | Back alignment and domain information |
|---|
| >cd05057 PTKc_EGFR_like Catalytic domain of Epidermal Growth Factor Receptor-like Protein Tyrosine Kinases | Back alignment and domain information |
|---|
| >KOG0575 consensus Polo-like serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05110 PTKc_HER4 Catalytic domain of the Protein Tyrosine Kinase, HER4 | Back alignment and domain information |
|---|
| >cd05055 PTKc_PDGFR Catalytic domain of the Protein Tyrosine Kinases, Platelet Derived Growth Factor Receptors | Back alignment and domain information |
|---|
| >cd06634 STKc_TAO2 Catalytic domain of the Protein Serine/Threonine Kinase, Thousand-and-one amino acids 2 | Back alignment and domain information |
|---|
| >KOG0694 consensus Serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0600 consensus Cdc2-related protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >cd05111 PTK_HER3 Pseudokinase domain of the Protein Tyrosine Kinase, HER3 | Back alignment and domain information |
|---|
| >cd07850 STKc_JNK Catalytic domain of the Serine/Threonine Kinase, c-Jun N-terminal Kinase | Back alignment and domain information |
|---|
| >PHA03209 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0661 consensus MAPK related serine/threonine protein kinase [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0591 consensus NIMA (never in mitosis)-related G2-specific serine/threonine protein kinase [Cell cycle control, cell division, chromosome partitioning] | Back alignment and domain information |
|---|
| >PTZ00024 cyclin-dependent protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0605 consensus NDR and related serine/threonine kinases [General function prediction only] | Back alignment and domain information |
|---|
| >PF03109 ABC1: ABC1 family; InterPro: IPR004147 This entry includes ABC1 from yeast [] and AarF from Escherichia coli [] | Back alignment and domain information |
|---|
| >PHA03211 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >cd07852 STKc_MAPK15 Catalytic domain of the Serine/Threonine Kinase, Mitogen-Activated Protein Kinase 15 | Back alignment and domain information |
|---|
| >PHA03212 serine/threonine kinase US3; Provisional | Back alignment and domain information |
|---|
| >KOG0032 consensus Ca2+/calmodulin-dependent protein kinase, EF-Hand protein superfamily [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd07866 STKc_BUR1 Catalytic domain of the Serine/Threonine Kinase, Fungal Cyclin-Dependent protein Kinase Bypass UAS Requirement 1 and similar proteins | Back alignment and domain information |
|---|
| >PRK09605 bifunctional UGMP family protein/serine/threonine protein kinase; Validated | Back alignment and domain information |
|---|
| >KOG0198 consensus MEKK and related serine/threonine protein kinases [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05101 PTKc_FGFR2 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 2 | Back alignment and domain information |
|---|
| >PF15065 NCU-G1: Lysosomal transcription factor, NCU-G1 | Back alignment and domain information |
|---|
| >KOG4250 consensus TANK binding protein kinase TBK1 [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd05098 PTKc_FGFR1 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 1 | Back alignment and domain information |
|---|
| >cd05099 PTKc_FGFR4 Catalytic domain of the Protein Tyrosine Kinase, Fibroblast Growth Factor Receptor 4 | Back alignment and domain information |
|---|
| >PTZ00266 NIMA-related protein kinase; Provisional | Back alignment and domain information |
|---|
| >KOG0581 consensus Mitogen-activated protein kinase kinase (MAP2K) [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >KOG0667 consensus Dual-specificity tyrosine-phosphorylation regulated kinase [General function prediction only] | Back alignment and domain information |
|---|
| >PTZ00382 Variant-specific surface protein (VSP); Provisional | Back alignment and domain information |
|---|
| >PF01102 Glycophorin_A: Glycophorin A; InterPro: IPR001195 Proteins in this group are responsible for the molecular basis of the blood group antigens, surface markers on the outside of the red blood cell membrane | Back alignment and domain information |
|---|
| >PRK04750 ubiB putative ubiquinone biosynthesis protein UbiB; Reviewed | Back alignment and domain information |
|---|
| >KOG0574 consensus STE20-like serine/threonine kinase MST [Signal transduction mechanisms] | Back alignment and domain information |
|---|
| >cd06645 STKc_MAP4K3 Catalytic domain of the Protein Serine/Threonine Kinase, Mitogen-activated protein kinase kinase kinase kinase 3 | Back alignment and domain information |
|---|
Homologous Structure Templates
Structure Templates Detected by BLAST
Original result of BLAST against Protein Data Bank
| ID | Alignment Graph | Length |
Definition |
E-value | |
| Query | 413 | ||||
| 1gnz_A | 257 | Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)m | 8e-18 | ||
| 1hql_A | 257 | The Xenograft Antigen In Complex With The B4 Isolec | 9e-18 | ||
| 2e7q_A | 237 | Crystal Structure Of Basic Winged Bean Lectin In Co | 7e-16 | ||
| 1wbf_A | 242 | Winged Bean Lectin, Saccharide Free Form Length = 2 | 7e-16 | ||
| 1wbl_A | 241 | Winged Bean Lectin Complexed With Methyl-Alpha-D-Ga | 8e-16 | ||
| 2fmd_A | 240 | Structural Basis Of Carbohydrate Recognition By Bow | 4e-15 | ||
| 3ipv_B | 239 | Crystal Structure Of Spatholobus Parviflorus Seed L | 1e-14 | ||
| 1fay_A | 238 | Winged Bean Acidic Lectin Complexed With Methyl-Alp | 2e-14 | ||
| 3usu_A | 256 | Crystal Structure Of Butea Monosperma Seed Lectin L | 4e-14 | ||
| 3usu_B | 242 | Crystal Structure Of Butea Monosperma Seed Lectin L | 5e-14 | ||
| 3ipv_A | 251 | Crystal Structure Of Spatholobus Parviflorus Seed L | 2e-13 | ||
| 2bqp_A | 234 | The Structure Of The Pea Lectin-D-Glucopyranose Com | 2e-12 | ||
| 1fat_A | 252 | Phytohemagglutinin-L Length = 252 | 3e-12 | ||
| 1fx5_A | 242 | Crystal Structure Analysis Of Ulex Europaeus Lectin | 3e-12 | ||
| 1dbn_A | 239 | Maackia Amurensis Leukoagglutinin (Lectin) With Sia | 3e-12 | ||
| 1g8w_A | 233 | Improved Structure Of Phytohemagglutinin-L From The | 4e-12 | ||
| 2sba_A | 253 | Soybean Agglutinin Complexed With 2,6-Pentasacchari | 5e-12 | ||
| 3n35_A | 242 | Erythrina Corallodendron Lectin Mutant (Y106g) With | 1e-11 | ||
| 1uzy_A | 242 | Erythrina Crystagalli Lectin Length = 242 | 2e-11 | ||
| 1gz9_A | 239 | High-Resolution Crystal Structure Of Erythrina Cris | 2e-11 | ||
| 3zvx_A | 261 | Structure Of The Lectin From Platypodium Elegans In | 3e-11 | ||
| 1sfy_A | 239 | Crystal Structure Of Recombinant Erythrina Corallod | 9e-11 | ||
| 1gsl_A | 243 | Lectin (Fourth Isolated From (Griffonia Simplicifol | 1e-10 | ||
| 1avb_A | 226 | Arcelin-1 From Phaseolus Vulgaris L Length = 226 | 1e-10 | ||
| 1ax0_A | 239 | Erythrina Corallodendron Lectin In Complex With N-A | 2e-10 | ||
| 1lte_A | 239 | Structure Of A Legume Lectin With An Ordered N-Link | 3e-10 | ||
| 1fyu_A | 255 | Crystal Structure Of Erythrina Corallodendron Lecti | 3e-10 | ||
| 1bzw_A | 232 | Peanut Lectin Complexed With C-Lactose Length = 232 | 4e-10 | ||
| 2pel_A | 236 | Peanut Lectin Length = 236 | 5e-10 | ||
| 1fny_A | 237 | Legume Lectin Of The Bark Of Robinia Pseudoacacia. | 6e-10 | ||
| 1ofs_A | 187 | Pea Lectin-sucrose Complex Length = 187 | 8e-10 | ||
| 1lul_A | 253 | Db58, A Legume Lectin From Dolichos Biflorus Length | 8e-10 | ||
| 2ltn_A | 181 | Design, Expression, And Crystallization Of Recombin | 8e-10 | ||
| 1rin_A | 180 | X-Ray Crystal Structure Of A Pea Lectin-Trimannosid | 9e-10 | ||
| 1lgb_A | 181 | Interaction Of A Legume Lectin With The N2 Fragment | 1e-09 | ||
| 1lgc_A | 181 | Interaction Of A Legume Lectin With The N2 Fragment | 2e-09 | ||
| 1bjq_A | 253 | The Dolichos Biflorus Seed Lectin In Complex With A | 3e-09 | ||
| 1lof_C | 181 | X-Ray Structure Of A Biantennary Octasaccharide-Lec | 5e-09 | ||
| 1loa_A | 181 | Three-Dimensional Structures Of Complexes Of Lathyr | 5e-09 | ||
| 3ujo_A | 281 | Galactose-Specific Seed Lectin From Dolichos Lablab | 6e-09 | ||
| 1n47_A | 233 | Isolectin B4 From Vicia Villosa In Complex With The | 1e-08 | ||
| 2eig_A | 234 | Lotus Tetragonolobus Seed Lectin (Isoform) Length = | 4e-08 | ||
| 1n3o_A | 252 | Pterocarcpus Angolensis Lectin In Complex With Alph | 2e-07 | ||
| 1q8o_A | 252 | Pterocartpus Angolensis Lectin Pal In Complex With | 2e-07 | ||
| 2b7y_A | 182 | Fava Bean Lectin-Glucose Complex Length = 182 | 2e-07 | ||
| 2lal_A | 181 | Crystal Structure Determination And Refinement At 2 | 5e-07 | ||
| 1qnw_A | 242 | Lectin Ii From Ulex Europaeus Length = 242 | 8e-07 | ||
| 1qmo_A | 113 | Structure Of Fril, A Legume Lectin That Delays Hema | 2e-04 | ||
| 3u4x_A | 236 | Crystal Structure Of A Lectin From Camptosema Pedic | 3e-04 | ||
| 2d3p_A | 236 | Cratylia Floribunda Seed Lectin Crystallized At Bas | 4e-04 |
| >pdb|1GNZ|A Chain A, Lectin I-B4 From Griffonia Simplicifolia (Gs I-B4)metal Free Form Length = 257 | Back alignment and structure |
|
| >pdb|1HQL|A Chain A, The Xenograft Antigen In Complex With The B4 Isolectin Of Griffonia Simplicifolia Lectin-1 Length = 257 | Back alignment and structure |
| >pdb|2E7Q|A Chain A, Crystal Structure Of Basic Winged Bean Lectin In Complex With B Blood Group Trisaccharide Length = 237 | Back alignment and structure |
| >pdb|1WBF|A Chain A, Winged Bean Lectin, Saccharide Free Form Length = 242 | Back alignment and structure |
| >pdb|1WBL|A Chain A, Winged Bean Lectin Complexed With Methyl-Alpha-D-Galactose Length = 241 | Back alignment and structure |
| >pdb|2FMD|A Chain A, Structural Basis Of Carbohydrate Recognition By Bowringia Milbraedii Seed Agglutinin Length = 240 | Back alignment and structure |
| >pdb|3IPV|B Chain B, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 239 | Back alignment and structure |
| >pdb|1FAY|A Chain A, Winged Bean Acidic Lectin Complexed With Methyl-Alpha-D-Galactose (Monoclinic Form) Length = 238 | Back alignment and structure |
| >pdb|3USU|A Chain A, Crystal Structure Of Butea Monosperma Seed Lectin Length = 256 | Back alignment and structure |
| >pdb|3USU|B Chain B, Crystal Structure Of Butea Monosperma Seed Lectin Length = 242 | Back alignment and structure |
| >pdb|3IPV|A Chain A, Crystal Structure Of Spatholobus Parviflorus Seed Lectin Length = 251 | Back alignment and structure |
| >pdb|2BQP|A Chain A, The Structure Of The Pea Lectin-D-Glucopyranose Complex Length = 234 | Back alignment and structure |
| >pdb|1FAT|A Chain A, Phytohemagglutinin-L Length = 252 | Back alignment and structure |
| >pdb|1FX5|A Chain A, Crystal Structure Analysis Of Ulex Europaeus Lectin I Length = 242 | Back alignment and structure |
| >pdb|1DBN|A Chain A, Maackia Amurensis Leukoagglutinin (Lectin) With Sialyllactose Length = 239 | Back alignment and structure |
| >pdb|1G8W|A Chain A, Improved Structure Of Phytohemagglutinin-L From The Kidney Bean Length = 233 | Back alignment and structure |
| >pdb|2SBA|A Chain A, Soybean Agglutinin Complexed With 2,6-Pentasaccharide Length = 253 | Back alignment and structure |
| >pdb|3N35|A Chain A, Erythrina Corallodendron Lectin Mutant (Y106g) With N- Acetylgalactosamine Length = 242 | Back alignment and structure |
| >pdb|1UZY|A Chain A, Erythrina Crystagalli Lectin Length = 242 | Back alignment and structure |
| >pdb|1GZ9|A Chain A, High-Resolution Crystal Structure Of Erythrina Cristagalli Lectin In Complex With 2'-Alpha-L-Fucosyllactose Length = 239 | Back alignment and structure |
| >pdb|3ZVX|A Chain A, Structure Of The Lectin From Platypodium Elegans In Complex With A Trimannoside Length = 261 | Back alignment and structure |
| >pdb|1SFY|A Chain A, Crystal Structure Of Recombinant Erythrina Corallodandron Lectin Length = 239 | Back alignment and structure |
| >pdb|1GSL|A Chain A, Lectin (Fourth Isolated From (Griffonia Simplicifolia)) Complex With Y Human Blood Group Determinant Length = 243 | Back alignment and structure |
| >pdb|1AVB|A Chain A, Arcelin-1 From Phaseolus Vulgaris L Length = 226 | Back alignment and structure |
| >pdb|1AX0|A Chain A, Erythrina Corallodendron Lectin In Complex With N-Actylgalactosamine Length = 239 | Back alignment and structure |
| >pdb|1LTE|A Chain A, Structure Of A Legume Lectin With An Ordered N-Linked Carbohydrate In Complex With Lactose Length = 239 | Back alignment and structure |
| >pdb|1FYU|A Chain A, Crystal Structure Of Erythrina Corallodendron Lectin In Hexagonal Crystal Form Length = 255 | Back alignment and structure |
| >pdb|1BZW|A Chain A, Peanut Lectin Complexed With C-Lactose Length = 232 | Back alignment and structure |
| >pdb|2PEL|A Chain A, Peanut Lectin Length = 236 | Back alignment and structure |
| >pdb|1FNY|A Chain A, Legume Lectin Of The Bark Of Robinia Pseudoacacia. Length = 237 | Back alignment and structure |
| >pdb|1OFS|A Chain A, Pea Lectin-sucrose Complex Length = 187 | Back alignment and structure |
| >pdb|1LUL|A Chain A, Db58, A Legume Lectin From Dolichos Biflorus Length = 253 | Back alignment and structure |
| >pdb|2LTN|A Chain A, Design, Expression, And Crystallization Of Recombinant Lectin From The Garden Pea (Pisum Sativum) Length = 181 | Back alignment and structure |
| >pdb|1RIN|A Chain A, X-Ray Crystal Structure Of A Pea Lectin-Trimannoside Complex At 2.6 Angstroms Resolution Length = 180 | Back alignment and structure |
| >pdb|1LGB|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 | Back alignment and structure |
| >pdb|1LGC|A Chain A, Interaction Of A Legume Lectin With The N2 Fragment Of Human Lactotransferrin Or With The Isolated Biantennary Glycopeptide: Role Of The Fucose Moiety Length = 181 | Back alignment and structure |
| >pdb|1BJQ|A Chain A, The Dolichos Biflorus Seed Lectin In Complex With Adenine Length = 253 | Back alignment and structure |
| >pdb|1LOF|C Chain C, X-Ray Structure Of A Biantennary Octasaccharide-Lectin Complex At 2.3 Angstroms Resolution Length = 181 | Back alignment and structure |
| >pdb|1LOA|A Chain A, Three-Dimensional Structures Of Complexes Of Lathyrus Ochrus Isolectin I With Glucose And Mannose: Fine Specificity Of The Monosaccharide-Binding Site Length = 181 | Back alignment and structure |
| >pdb|3UJO|A Chain A, Galactose-Specific Seed Lectin From Dolichos Lablab In Complex With Adenine And Galactose Length = 281 | Back alignment and structure |
| >pdb|1N47|A Chain A, Isolectin B4 From Vicia Villosa In Complex With The Tn Antigen Length = 233 | Back alignment and structure |
| >pdb|2EIG|A Chain A, Lotus Tetragonolobus Seed Lectin (Isoform) Length = 234 | Back alignment and structure |
| >pdb|1N3O|A Chain A, Pterocarcpus Angolensis Lectin In Complex With Alpha-Methyl Glucose Length = 252 | Back alignment and structure |
| >pdb|1Q8O|A Chain A, Pterocartpus Angolensis Lectin Pal In Complex With The Dimmanoside Man(Alpha1-2)man Length = 252 | Back alignment and structure |
| >pdb|2B7Y|A Chain A, Fava Bean Lectin-Glucose Complex Length = 182 | Back alignment and structure |
| >pdb|2LAL|A Chain A, Crystal Structure Determination And Refinement At 2.3 Angstroms Resolution Of The Lentil Lectin Length = 181 | Back alignment and structure |
| >pdb|1QNW|A Chain A, Lectin Ii From Ulex Europaeus Length = 242 | Back alignment and structure |
| >pdb|1QMO|A Chain A, Structure Of Fril, A Legume Lectin That Delays Hematopoietic Progenitor Maturation Length = 113 | Back alignment and structure |
| >pdb|3U4X|A Chain A, Crystal Structure Of A Lectin From Camptosema Pedicellatum Seeds In Complex With 5-Bromo-4-Chloro-3-Indolyl-Alpha-D-Mannose Length = 236 | Back alignment and structure |
| >pdb|2D3P|A Chain A, Cratylia Floribunda Seed Lectin Crystallized At Basic Ph Length = 236 | Back alignment and structure |
Structure Templates Detected by RPS-BLAST
Original result of RPS-BLAST against PDB70 database
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* Length = 251 | Back alignment and structure |
|---|
Score = 140 bits (354), Expect = 2e-39
Identities = 58/242 (23%), Positives = 90/242 (37%), Gaps = 30/242 (12%)
Query: 36 FPDFSLHNNSKILHDLKLLGSAKLSNEKRVIQIPDDSQATDLRHQAGRAIYSSPVRLLDP 95
F F +L L G A ++ + D GRA YS+P+ + D
Sbjct: 8 FSKFKPLEP-----NLILQGDALVTVAGVLQLTNVDKNGVPEPSSLGRATYSAPINIWDS 62
Query: 96 VTKTPTSFETTFSFQFNTSNNTRTSRDGGSSLTFIIVPDEFTVGRAGPWLGVLNDACKD- 154
T SF T+F F N L F + P G +LG+ + A
Sbjct: 63 ATGLVASFATSFRFTIYAPNIAT----IADGLAFFLAPVASAPDSGGGFLGLFDSAVSGS 118
Query: 155 DYKAVAVKFDTCRDLEFGGPNDNHVGINLGSIVSTRAINASDVGIFLNDGSVHRAWIAYD 214
Y+ VAV+FDT + F P H+G ++ SI S + + S L +G + I Y+
Sbjct: 119 TYQTVAVEFDTYENTVFTDPPYTHIGFDVNSISSIKTVKWS-----LANGEAAKVLITYN 173
Query: 215 GTRGWMDVRIGSDGRDYPST------------KPTFSGFSASTGNM---TQIHNLLSWNF 259
+ + + GFSA+TG + H++ SW+F
Sbjct: 174 SAVKLLVASLVYPSSKTSFILADIVDLSSVLPEWVRVGFSAATGASGGKIETHDVFSWSF 233
Query: 260 SS 261
+S
Sbjct: 234 AS 235
|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 Length = 234 | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* Length = 257 | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... Length = 261 | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* Length = 243 | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* Length = 242 | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* Length = 237 | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* Length = 252 | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* Length = 242 | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... Length = 232 | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* Length = 239 | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 Length = 239 | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* Length = 253 | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} Length = 240 | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* Length = 253 | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} Length = 234 | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* Length = 238 | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 Length = 233 | Back alignment and structure |
|---|
| >2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* Length = 181 | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 240 | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 Length = 226 | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* Length = 242 | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* Length = 223 | Back alignment and structure |
|---|
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 133 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... Length = 237 | Back alignment and structure |
|---|
| >1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 Length = 113 | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A Length = 260 | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* Length = 253 | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* Length = 321 | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3tl8_A* Length = 326 | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B Length = 52 | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* Length = 307 | Back alignment and structure |
|---|
Structure Templates Detected by HHsearch
Original result of HHsearch against PDB70 database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 413 | |||
| 3ujo_A | 281 | Legume lectin; carbohydrate-binding, galactose, ad | 100.0 | |
| 3ipv_A | 251 | Lectin alpha chain; galactose binding, SEED lectin | 100.0 | |
| 3zyr_A | 261 | Lectin; sugar binding protein, N-glycan; HET: NAG | 100.0 | |
| 1fny_A | 237 | BARK lectin, BARK agglutinin I,polypeptide A; legu | 100.0 | |
| 1dbn_A | 239 | MAL, protein (leukoagglutinin); plant lectin, carb | 100.0 | |
| 1v6i_A | 232 | Agglutinin, PNA, galactose-binding lectin; open qu | 100.0 | |
| 1fx5_A | 242 | UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HO | 100.0 | |
| 1sbf_A | 253 | Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {G | 100.0 | |
| 1g7y_A | 253 | Stem/LEAF lectin DB58; jelly roll fold, sugar bind | 100.0 | |
| 1fat_A | 252 | Phytohemagglutinin-L; glycoprotein, plant defense | 100.0 | |
| 1gzc_A | 239 | Erythrina crista-galli lectin; carbohydrate, sugar | 100.0 | |
| 2eig_A | 234 | Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG bin | 100.0 | |
| 2bqp_A | 234 | Protein (PEA lectin); D-glucopyranose complex, sug | 100.0 | |
| 1f9k_A | 238 | Acidic lectin; legume lectin, glycosylated protein | 100.0 | |
| 1hql_A | 257 | Lectin; xenograft antigen, sugar BI protein; HET: | 100.0 | |
| 1wbf_A | 242 | Protein (agglutinin); lectin (agglutinin), legume | 100.0 | |
| 1qnw_A | 242 | Chitin binding lectin, UEA-II; carbohydrate bindin | 100.0 | |
| 1gsl_A | 243 | Griffonia simplicifolia lectin 4; glycoprotein, ma | 100.0 | |
| 1n47_A | 233 | Isolectin B4; cancer antigen, vicia villosa lectin | 100.0 | |
| 2fmd_A | 240 | Lectin, agglutinin, BMA; legume lectin, beta sandw | 100.0 | |
| 1avb_A | 226 | Arcelin-1; lectin-like glycoprotein, plant defense | 100.0 | |
| 1ioa_A | 240 | Arcelin-5A, ARC5A; lectin-like proteins, plant def | 100.0 | |
| 2ltn_A | 181 | PEA lectin, alpha chain; 1.70A {Pisum sativum} SCO | 100.0 | |
| 1dhk_B | 223 | Bean lectin-like inhibitor, porcine pancreatic alp | 100.0 | |
| 2dur_A | 253 | VIP36;, vesicular integral-membrane protein VIP36; | 100.0 | |
| 1gv9_A | 260 | P58/ergic-53; lectin, carbohydrate binding; 1.46A | 99.97 | |
| 1qmo_E | 133 | Mannose binding lectin, FRIL; crosslink, hematopoi | 99.96 | |
| 1qmo_A | 113 | Mannose binding lectin, FRIL; crosslink, hematopoi | 99.94 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 99.94 | |
| 2a6y_A | 256 | EMP47P (FORM1); beta sandwich, carbohydrate bindin | 99.92 | |
| 1nls_A | 237 | Concanavalin A; lectin, agglutinin; 0.94A {Canaval | 99.87 | |
| 2a6z_A | 222 | EMP47P (FORM2); beta sandwich, carbohydrate bindin | 99.82 | |
| 2a6v_A | 226 | EMP46P; beta sandwich, carbohydrate binding protei | 99.65 | |
| 2ltn_B | 52 | PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP | 98.21 | |
| 4gt4_A | 308 | Tyrosine-protein kinase transmembrane receptor RO; | 97.74 | |
| 2qkw_B | 321 | Protein kinase; three-helix bundle motif, AVRPTO-P | 97.54 | |
| 4aoj_A | 329 | High affinity nerve growth factor receptor; transf | 97.37 | |
| 3uim_A | 326 | Brassinosteroid insensitive 1-associated receptor; | 97.33 | |
| 2nru_A | 307 | Interleukin-1 receptor-associated kinase 4; inhibi | 97.29 | |
| 4asz_A | 299 | BDNF/NT-3 growth factors receptor; transferase, TR | 97.25 | |
| 3p1a_A | 311 | MYT1 kinase, membrane-associated tyrosine- and thr | 97.09 | |
| 2c30_A | 321 | Serine/threonine-protein kinase PAK 6; CRIB domain | 97.05 | |
| 3fpq_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 96.61 | |
| 4fih_A | 346 | Serine/threonine-protein kinase PAK 4; kinase doma | 96.61 | |
| 3omv_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 96.48 | |
| 4fie_A | 423 | Serine/threonine-protein kinase PAK 4; kinase doma | 96.36 | |
| 4ase_A | 353 | Vascular endothelial growth factor receptor 2; tra | 96.22 | |
| 3dzo_A | 413 | Rhoptry kinase domain; parasitic disease, transfer | 96.19 | |
| 3hyh_A | 275 | Carbon catabolite-derepressing protein kinase; kin | 96.18 | |
| 1qcf_A | 454 | Haematopoetic cell kinase (HCK); tyrosine kinase-i | 96.08 | |
| 4b9d_A | 350 | Serine/threonine-protein kinase NEK1; transferase, | 96.05 | |
| 2x7f_A | 326 | TRAF2 and NCK-interacting protein kinase; serine/t | 95.99 | |
| 2clq_A | 295 | Mitogen-activated protein kinase kinase kinase 5; | 95.83 | |
| 4aw2_A | 437 | Serine/threonine-protein kinase MRCK alpha; transf | 95.81 | |
| 3llt_A | 360 | Serine/threonine kinase-1, pflammer; lammer kinase | 95.76 | |
| 3kul_A | 325 | Ephrin type-A receptor 8; ATP-binding, kinase, nuc | 95.74 | |
| 4b99_A | 398 | Mitogen-activated protein kinase 7; transferase, i | 95.71 | |
| 3cek_A | 313 | Dual specificity protein kinase TTK; HMPS1, PYT, E | 95.63 | |
| 3kfa_A | 288 | Tyrosine-protein kinase ABL1; CML, drug resistance | 95.59 | |
| 2w4o_A | 349 | Calcium/calmodulin-dependent protein kinase type I | 95.57 | |
| 3gen_A | 283 | Tyrosine-protein kinase BTK; bruton'S tyrosine kin | 95.5 | |
| 1fmk_A | 452 | C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyros | 95.46 | |
| 1opk_A | 495 | P150, C-ABL, proto-oncogene tyrosine-protein kinas | 95.43 | |
| 3pg1_A | 362 | Mitogen-activated protein kinase, putative (MAP K | 95.42 | |
| 4g3f_A | 336 | NF-kappa-beta-inducing kinase; non-RD kinase, prot | 95.39 | |
| 4aw0_A | 311 | HPDK1, 3-phosphoinositide-dependent protein kinase | 95.33 | |
| 2vx3_A | 382 | Dual specificity tyrosine-phosphorylation- regula | 95.33 | |
| 3byv_A | 377 | Rhoptry kinase; malaria, transferase, structural g | 95.31 | |
| 3fxz_A | 297 | Serine/threonine-protein kinase PAK 1; transferase | 95.29 | |
| 2h8h_A | 535 | Proto-oncogene tyrosine-protein kinase SRC; SRC ki | 95.29 | |
| 2qol_A | 373 | Ephrin receptor; receptor tyrosine kinase, juxtame | 95.21 | |
| 2x4f_A | 373 | Myosin light chain kinase family member 4; LUNG, b | 95.18 | |
| 2ac3_A | 316 | MAP kinase-interacting serine/threonine kinase 2; | 95.18 | |
| 4f9c_A | 361 | Cell division cycle 7-related protein kinase; Ser/ | 95.17 | |
| 2i1m_A | 333 | Macrophage colony-stimulating factor 1 receptor; k | 95.02 | |
| 3vhe_A | 359 | Vascular endothelial growth factor receptor 2; kin | 94.99 | |
| 3ll6_A | 337 | Cyclin G-associated kinase; transferase, protein k | 94.94 | |
| 3qyz_A | 364 | Mitogen-activated protein kinase 1; transferase, s | 94.91 | |
| 3e7e_A | 365 | HBUB1, BUB1A, mitotic checkpoint serine/threonine- | 94.9 | |
| 3ugc_A | 295 | Tyrosine-protein kinase JAK2; small molecule inhib | 94.85 | |
| 3niz_A | 311 | Rhodanese family protein; structural genomics, str | 94.82 | |
| 3v8s_A | 410 | RHO-associated protein kinase 1; dimerization, myo | 94.79 | |
| 1t4h_A | 290 | Serine/threonine-protein kinase WNK1; protein seri | 94.78 | |
| 3qup_A | 323 | Tyrosine-protein kinase receptor TYRO3; protein ki | 94.78 | |
| 3cbl_A | 377 | C-FES, proto-oncogene tyrosine-protein kinase FES/ | 94.75 | |
| 2zmd_A | 390 | Dual specificity protein kinase TTK; MPS1, T686A, | 94.73 | |
| 1mqb_A | 333 | Ephrin type-A receptor 2; tyrosine protein kinase, | 94.72 | |
| 2vd5_A | 412 | DMPK protein; serine/threonine-protein kinase, kin | 94.7 | |
| 1u5q_A | 348 | Serine/threonine protein kinase TAO2; transferase; | 94.67 | |
| 4f0f_A | 287 | Serine/threonine-protein kinase ROCO4; LRRK2, ATP- | 94.66 | |
| 3an0_A | 340 | Dual specificity mitogen-activated protein kinase; | 94.64 | |
| 1p4o_A | 322 | Insulin-like growth factor I receptor protein; IGF | 94.64 | |
| 3soc_A | 322 | Activin receptor type-2A; structural genomics cons | 94.64 | |
| 3p86_A | 309 | Serine/threonine-protein kinase CTR1; ETR1, ERS1, | 94.55 | |
| 2j7t_A | 302 | Serine/threonine-protein kinase 10; transferase, A | 94.5 | |
| 2eue_A | 275 | Carbon catabolite derepressing protein kinase; kin | 94.49 | |
| 2zv2_A | 298 | Calcium/calmodulin-dependent protein kinase kinas; | 94.45 | |
| 3uqc_A | 286 | Probable conserved transmembrane protein; structur | 94.44 | |
| 1wak_A | 397 | Serine/threonine-protein kinase SPRK1; SRPK, trans | 94.37 | |
| 3ubd_A | 304 | Ribosomal protein S6 kinase alpha-3; kinase-inhibi | 94.3 | |
| 3eb0_A | 383 | Putative uncharacterized protein; kinase cryptospo | 94.28 | |
| 3aln_A | 327 | Dual specificity mitogen-activated protein kinase; | 94.26 | |
| 2buj_A | 317 | Serine/threonine-protein kinase 16; transferase, A | 94.24 | |
| 3is5_A | 285 | Calcium-dependent protein kinase; CDPK, structural | 94.22 | |
| 2b9h_A | 353 | MAP kinase FUS3, mitogen-activated protein kinase | 94.22 | |
| 3lm5_A | 327 | Serine/threonine-protein kinase 17B; STK17B, serin | 94.22 | |
| 3kvw_A | 429 | DYRK2, dual specificity tyrosine-phosphorylation-r | 94.21 | |
| 2wqm_A | 310 | Serine/threonine-protein kinase NEK7; ATP-binding, | 94.21 | |
| 3e3p_A | 360 | Protein kinase, putative glycogen synthase kinase; | 94.18 | |
| 1blx_A | 326 | Cyclin-dependent kinase 6; inhibitor protein, cycl | 94.17 | |
| 3q60_A | 371 | ROP5B; pseudokinase, transferase; HET: ATP; 1.72A | 94.15 | |
| 3uto_A | 573 | Twitchin; kinase, muscle sarcomere, transferase; H | 94.07 | |
| 3ork_A | 311 | Serine/threonine protein kinase; structural genomi | 94.05 | |
| 3fdn_A | 279 | Serine/threonine-protein kinase 6; aurora kinase i | 94.03 | |
| 3a7i_A | 303 | MST3 kinase, serine/threonine kinase 24 (STE20 hom | 94.03 | |
| 1k9a_A | 450 | Carboxyl-terminal SRC kinase; COOH-terminal SRC ki | 94.01 | |
| 2vuw_A | 336 | Serine/threonine-protein kinase haspin; cell cycle | 93.98 | |
| 2w1i_A | 326 | JAK2; chromosomal rearrangement, nucleotide-bindin | 93.92 | |
| 1x8b_A | 289 | WEE1HU, WEE1-like protein kinase; cell cycle, tran | 93.91 | |
| 1luf_A | 343 | Muscle-specific tyrosine kinase receptor MUSK; pho | 93.91 | |
| 3rp9_A | 458 | Mitogen-activated protein kinase; structural genom | 93.9 | |
| 3l9p_A | 367 | Anaplastic lymphoma kinase; kinase domain, ATP-bin | 93.89 | |
| 3dbq_A | 343 | Dual specificity protein kinase TTK; MPS1 structur | 93.87 | |
| 3mi9_A | 351 | Cell division protein kinase 9; P-TEFB, HIV-1, pro | 93.86 | |
| 4exu_A | 371 | Mitogen-activated protein kinase 13; P38 kinase, t | 93.86 | |
| 3lxl_A | 327 | Tyrosine-protein kinase JAK3; TYK2, inflammation, | 93.86 | |
| 1j1b_A | 420 | Glycogen synthase kinase-3 beta; complex, TAU, AMP | 93.81 | |
| 4dc2_A | 396 | Protein kinase C IOTA type; kinase, substrate, cel | 93.79 | |
| 3coi_A | 353 | Mitogen-activated protein kinase 13; P38D, P38delt | 93.78 | |
| 3uc3_A | 361 | Serine/threonine-protein kinase SRK2I; SNRK2, ABA | 93.74 | |
| 2ozo_A | 613 | Tyrosine-protein kinase ZAP-70; inactive ZAP-70, t | 93.74 | |
| 3fe3_A | 328 | MAP/microtubule affinity-regulating kinase 3; seri | 93.72 | |
| 4fvq_A | 289 | Tyrosine-protein kinase JAK2; janus protein kinase | 93.68 | |
| 3brb_A | 313 | Proto-oncogene tyrosine-protein kinase MER; ATP-bi | 93.65 | |
| 4fl3_A | 635 | Tyrosine-protein kinase SYK; transferase; HET: ANP | 93.64 | |
| 2r5t_A | 373 | Serine/threonine-protein kinase SGK1; AGC protein | 93.63 | |
| 3pls_A | 298 | Macrophage-stimulating protein receptor; protein k | 93.63 | |
| 3rgf_A | 405 | Cyclin-dependent kinase 8; protein kinase complex, | 93.63 | |
| 3n9x_A | 432 | Phosphotransferase; malaria kinase, structural gen | 93.6 | |
| 3gbz_A | 329 | Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide- | 93.59 | |
| 4aaa_A | 331 | Cyclin-dependent kinase-like 2; transferase, phosp | 93.56 | |
| 3poz_A | 327 | Epidermal growth factor receptor; kinase domain, a | 93.5 | |
| 3a8x_A | 345 | Protein kinase C IOTA type; transferase; HET: TPO; | 93.43 | |
| 2fst_X | 367 | Mitogen-activated protein kinase 14; active mutant | 93.42 | |
| 3nsz_A | 330 | CK II alpha, casein kinase II subunit alpha; inhib | 93.39 | |
| 4e5w_A | 302 | Tyrosine-protein kinase JAK1; kinase domain, trans | 93.39 | |
| 2psq_A | 370 | Fibroblast growth factor receptor 2; kinase domain | 93.37 | |
| 1cm8_A | 367 | Phosphorylated MAP kinase P38-gamma; phosphorylati | 93.37 | |
| 1kob_A | 387 | Twitchin; kinase, intrasteric regulation; 2.30A {A | 93.36 | |
| 1u59_A | 287 | Tyrosine-protein kinase ZAP-70; transferase; HET: | 93.33 | |
| 3zgw_A | 347 | Maternal embryonic leucine zipper kinase; transfer | 93.33 | |
| 1xbb_A | 291 | Tyrosine-protein kinase SYK; gleevec, STI-571, ima | 93.3 | |
| 2vwi_A | 303 | Serine/threonine-protein kinase OSR1; STE kinase, | 93.3 | |
| 3g33_A | 308 | Cell division protein kinase 4; Ser/Thr protein ki | 93.26 | |
| 2y0a_A | 326 | Death-associated protein kinase 1; transferase, ca | 93.23 | |
| 3com_A | 314 | Serine/threonine-protein kinase 4; MST1, STE20-lik | 93.22 | |
| 2rku_A | 294 | Serine/threonine-protein kinase PLK1; structure of | 93.21 | |
| 3op5_A | 364 | Serine/threonine-protein kinase VRK1; adenosine tr | 93.21 | |
| 1qpc_A | 279 | LCK kinase; alpha beta fold, transferase; HET: PTR | 93.18 | |
| 3lxp_A | 318 | Non-receptor tyrosine-protein kinase TYK2; JAK3, i | 93.17 | |
| 4eqm_A | 294 | Protein kinase; transferase; HET: ANP; 3.00A {Stap | 93.17 | |
| 2xir_A | 316 | Vascular endothelial growth factor receptor 2; ang | 93.16 | |
| 2xrw_A | 371 | Mitogen-activated protein kinase 8; transcription, | 93.15 | |
| 3fme_A | 290 | Dual specificity mitogen-activated protein kinase; | 93.14 | |
| 2ivs_A | 314 | Proto-oncogene tyrosine-protein kinase receptor RE | 93.13 | |
| 2iwi_A | 312 | Serine/threonine-protein kinase PIM-2; nucleotide- | 93.11 | |
| 3cok_A | 278 | Serine/threonine-protein kinase PLK4; POLO-like ki | 93.11 | |
| 2h34_A | 309 | Serine/threonine-protein kinase PKNE; apoenzyme, t | 93.1 | |
| 3eqc_A | 360 | Dual specificity mitogen-activated protein kinase; | 93.1 | |
| 3kn6_A | 325 | Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1 | 93.09 | |
| 4ejn_A | 446 | RAC-alpha serine/threonine-protein kinase; AKT1, a | 93.08 | |
| 1phk_A | 298 | Phosphorylase kinase; glycogen metabolism, transfe | 93.08 | |
| 1t46_A | 313 | HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcom | 93.04 | |
| 1rjb_A | 344 | FL cytokine receptor; kinase, structure, autoinhib | 93.03 | |
| 3ttj_A | 464 | Mitogen-activated protein kinase 10; JNK3, protein | 93.0 | |
| 2wei_A | 287 | Calmodulin-domain protein kinase 1, putative; nucl | 92.99 | |
| 3c1x_A | 373 | Hepatocyte growth factor receptor; receptor tyrosi | 92.96 | |
| 4hcu_A | 269 | Tyrosine-protein kinase ITK/TSK; transferase-trans | 92.96 | |
| 1xjd_A | 345 | Protein kinase C, theta type; PKC-theta, ATP, AMP, | 92.95 | |
| 3a99_A | 320 | Proto-oncogene serine/threonine-protein kinase PI; | 92.92 | |
| 2bdw_A | 362 | Hypothetical protein K11E8.1D; kinase, calmodulin | 92.91 | |
| 2yab_A | 361 | Death-associated protein kinase 2; apoptosis, tran | 92.9 | |
| 1byg_A | 278 | CSK, protein (C-terminal SRC kinase); protein kina | 92.87 | |
| 3cc6_A | 281 | Protein tyrosine kinase 2 beta; focal adhesion kin | 92.86 | |
| 3nyv_A | 484 | Calmodulin-domain protein kinase 1; serine/threoni | 92.86 | |
| 1q8y_A | 373 | SR protein kinase; transferase; HET: ADP ADE; 2.05 | 92.84 | |
| 2vgo_A | 284 | Serine/threonine-protein kinase 12-A; nucleotide-b | 92.82 | |
| 2a2a_A | 321 | Death-associated protein kinase 2; autoinhibition, | 92.81 | |
| 2pvf_A | 334 | Fibroblast growth factor receptor 2; kinase domain | 92.74 | |
| 1z57_A | 339 | Dual specificity protein kinase CLK1; protein tyro | 92.72 | |
| 3sxs_A | 268 | Cytoplasmic tyrosine-protein kinase BMX; transfera | 92.69 | |
| 3kex_A | 325 | Receptor tyrosine-protein kinase ERBB-3; kinase do | 92.63 | |
| 3f66_A | 298 | Hepatocyte growth factor receptor; C-Met, protein | 92.61 | |
| 3tt0_A | 382 | Basic fibroblast growth factor receptor 1; kinase | 92.58 | |
| 1mp8_A | 281 | Focal adhesion kinase 1; tyrosine protein kinase, | 92.54 | |
| 1zar_A | 282 | RIO2 kinase; serine kinase, winged-helix, RIO doma | 92.53 | |
| 4fr4_A | 384 | YANK1, serine/threonine-protein kinase 32A; struct | 92.51 | |
| 3c4z_A | 543 | Rhodopsin kinase; Ser/Thr kinase, RGS homology dom | 92.51 | |
| 3fhr_A | 336 | MAP kinase-activated protein kinase 3; kinase-inhi | 92.5 | |
| 3h4j_B | 336 | AMPK kdaid, SNF1-like protein kinase SSP2; ATP-bin | 92.49 | |
| 2owb_A | 335 | Serine/threonine-protein kinase PLK1; catalytic do | 92.48 | |
| 2h6d_A | 276 | 5'-AMP-activated protein kinase catalytic subunit | 92.46 | |
| 1rdq_E | 350 | PKA C-alpha, CAMP-dependent protein kinase, alpha- | 92.4 | |
| 3c0i_A | 351 | Peripheral plasma membrane protein CASK; neurexin, | 92.39 | |
| 3og7_A | 289 | AKAP9-BRAF fusion protein; proto-oncogene, V600E, | 92.36 | |
| 2pml_X | 348 | PFPK7, Ser/Thr protein kinase; phosphorylati trans | 92.28 | |
| 4euu_A | 319 | Serine/threonine-protein kinase TBK1; ATP binding, | 92.27 | |
| 2yfx_A | 327 | Tyrosine-protein kinase receptor; nucleotide-bindi | 92.21 | |
| 2izr_A | 330 | Casein kinase I isoform gamma-3; serine/threonine- | 92.19 | |
| 2acx_A | 576 | G protein-coupled receptor kinase 6; GRK, G transf | 92.17 | |
| 3v5w_A | 689 | G-protein coupled receptor kinase 2; inhibitor com | 92.11 | |
| 3mwu_A | 486 | Calmodulin-domain protein kinase 1; serine/threoni | 92.09 | |
| 2dyl_A | 318 | Dual specificity mitogen-activated protein kinase | 92.09 | |
| 3txo_A | 353 | PKC-L, NPKC-ETA, protein kinase C ETA type; phosph | 92.08 | |
| 3q5i_A | 504 | Protein kinase; CDPK, malaria, phosphotransferase, | 92.07 | |
| 3g2f_A | 336 | Bone morphogenetic protein receptor type-2; kinase | 92.06 | |
| 3s95_A | 310 | LIMK-1, LIM domain kinase 1; structural genomics, | 92.03 | |
| 2eu9_A | 355 | Dual specificity protein kinase CLK3; kinase domai | 92.02 | |
| 2y4i_B | 319 | KSR2, HKSR2, kinase suppressor of RAS 2; transfera | 92.01 | |
| 2qr7_A | 342 | Ribosomal protein S6 kinase alpha-3; kinase domain | 92.01 | |
| 3lzb_A | 327 | Epidermal growth factor receptor; epidermal growth | 91.92 | |
| 3dls_A | 335 | PAS domain-containing serine/threonine-protein KI; | 91.89 | |
| 3lij_A | 494 | Calcium/calmodulin dependent protein kinase with A | 91.83 | |
| 4e7w_A | 394 | Glycogen synthase kinase 3; GSK3, PTyr195, transfe | 91.73 | |
| 2rio_A | 434 | Serine/threonine-protein kinase/endoribonuclease I | 91.72 | |
| 1fvr_A | 327 | Tyrosine-protein kinase TIE-2; tyrosine kinase, tr | 91.71 | |
| 3hko_A | 345 | Calcium/calmodulin-dependent protein kinase with d | 91.7 | |
| 3i6u_A | 419 | CDS1, serine/threonine-protein kinase CHK2; Ser/Th | 91.69 | |
| 4hgt_A | 296 | Casein kinase I isoform delta; CK1D, inhibitor, tr | 91.64 | |
| 3uzp_A | 296 | CKI-delta, CKID, casein kinase I isoform delta; CK | 91.61 | |
| 1vzo_A | 355 | Ribosomal protein S6 kinase alpha 5; protein kinas | 91.52 | |
| 4eut_A | 396 | Serine/threonine-protein kinase TBK1; ATP binding, | 91.51 | |
| 1csn_A | 298 | Casein kinase-1; phosphotransferase; HET: ATP; 2.0 | 91.44 | |
| 3tki_A | 323 | Serine/threonine-protein kinase CHK1; cell checkpo | 91.38 | |
| 2i0e_A | 353 | Protein kinase C-beta II; serine/threonine protein | 91.37 | |
| 2a19_B | 284 | Interferon-induced, double-stranded RNA-activated | 91.32 | |
| 1ua2_A | 346 | CAK, cell division protein kinase 7; cell cycle, p | 91.3 | |
| 2ycf_A | 322 | Serine/threonine-protein kinase CHK2; transferase, | 91.28 | |
| 3soa_A | 444 | Calcium/calmodulin-dependent protein kinase type a | 91.15 | |
| 3t9t_A | 267 | Tyrosine-protein kinase ITK/TSK; kinase domain, al | 91.11 | |
| 4gyi_A | 397 | RIO2 kinase; protein kinase, ADP complex, phosphoa | 91.02 | |
| 2i6l_A | 320 | Mitogen-activated protein kinase 6; MAPK6, ERK3, e | 90.99 | |
| 3mdy_A | 337 | Bone morphogenetic protein receptor type-1B; compl | 90.93 | |
| 3kmu_A | 271 | ILK, integrin-linked kinase; cell adhesion, ANK re | 90.88 | |
| 3sv0_A | 483 | Casein kinase I-like; typical kinase domain fold, | 90.84 | |
| 1u46_A | 291 | ACK-1, activated CDC42 kinase 1; tyrosine kinase, | 90.78 | |
| 2y94_A | 476 | 5'-AMP-activated protein kinase catalytic subunit; | 90.77 | |
| 3lb7_A | 307 | RAF proto-oncogene serine/threonine-protein kinas; | 90.73 | |
| 3gni_B | 389 | Strad alpha; kinase fold, pseudokinase, alpha heli | 90.65 | |
| 2y7j_A | 365 | Phosphorylase B kinase gamma catalytic chain, test | 90.61 | |
| 1nxk_A | 400 | MAP kinase-activated protein kinase 2; MK2, phosph | 90.59 | |
| 3a62_A | 327 | Ribosomal protein S6 kinase beta-1; kinase domain, | 90.44 | |
| 3f3z_A | 277 | Calcium/calmodulin-dependent protein kinase with d | 90.44 | |
| 3oz6_A | 388 | Mitogen-activated protein kinase 1, serine/threon | 90.38 | |
| 1b6c_B | 342 | TGF-B superfamily receptor type I; complex (isomer | 90.37 | |
| 2ks1_B | 44 | Epidermal growth factor receptor; ERBB1, ERBB2, tr | 90.3 | |
| 3m2w_A | 299 | MAP kinase-activated protein kinase 2; small molec | 90.3 | |
| 3pfq_A | 674 | PKC-B, PKC-beta, protein kinase C beta type; phosp | 90.07 | |
| 2yex_A | 276 | Serine/threonine-protein kinase CHK1; transferase, | 89.8 | |
| 1zth_A | 258 | RIO1 serine protein kinase; ribosome biogenesis, r | 89.25 | |
| 2jam_A | 304 | Calcium/calmodulin-dependent protein kinase type 1 | 88.95 | |
| 2jii_A | 352 | Serine/threonine-protein kinase VRK3 molecule: VA | 88.92 | |
| 2pzi_A | 681 | Probable serine/threonine-protein kinase PKNG; ATP | 88.73 | |
| 3p23_A | 432 | Serine/threonine-protein kinase/endoribonuclease; | 88.73 | |
| 2l2t_A | 44 | Receptor tyrosine-protein kinase ERBB-4; transmemb | 88.7 | |
| 2v62_A | 345 | Serine/threonine-protein kinase VRK2; transferase, | 88.57 | |
| 2j0j_A | 656 | Focal adhesion kinase 1; cell migration, FERM, tra | 87.97 | |
| 3qa8_A | 676 | MGC80376 protein; kinase ubiquitin-like domain, ph | 86.78 | |
| 3en9_A | 540 | Glycoprotease, O-sialoglycoprotein endopeptidase/p | 81.72 |
| >3ujo_A Legume lectin; carbohydrate-binding, galactose, adenine binding protein; HET: ADE GAL; 2.00A {Dolichos lablab} PDB: 3ujq_A* 3uk9_A* 3ul2_A* 1fat_A* 1g8w_A* | Back alignment and structure |
|---|
Probab=100.00 E-value=1.5e-57 Score=430.28 Aligned_cols=235 Identities=27% Similarity=0.428 Sum_probs=188.6
Q ss_pred HHHHHHHHHHHHHhccCCCCCCcceeEEcCCCCCCCCcCcccCeEEecceEEeCCCCeEEcCCCCCC-cCCCCceEEEEe
Q 042239 8 CFFLLVSIEVFSILVDSSPEISARKHVFFPDFSLHNNSKILHDLKLLGSAKLSNEKRVIQIPDDSQA-TDLRHQAGRAIY 86 (413)
Q Consensus 8 ~~~~l~~~~~~~~~~~~~~~~~~~~~f~~~~f~~~~~~~~~~~l~l~G~A~~~~~~~~i~LT~~~~~-~~~~~~~G~~~y 86 (413)
..|+||++.+||+|+.+.+ .+..++|+|+.|.. .+|+|+|+|.+. +|.|+||++... .+..+++|||+|
T Consensus 4 ~~~~~~~~~~fl~l~~~~~-sa~~~sF~f~~F~~-------~nL~l~GdA~i~--~g~L~LT~~~~~~~p~~~s~Gra~Y 73 (281)
T 3ujo_A 4 ISFTMKRIVLFLILLTKAA-SANLISFTFKKFNE-------TNLILQRDATVS--SGKLRITKAAENGVPTAGSLGRAFY 73 (281)
T ss_dssp ---------------------CEEEEEEESSCCS-------TTEEECSSCCCB--TTBEECSCCCSSCCCCSSCEEEEEE
T ss_pred hhHHHHHHHHHHHHHcccC-cCCcceEEcCCCCc-------cCEEEecceEEe--CCEEEeCCCCCCCcccCCceEEEEE
Confidence 3466777778888888644 34578999999986 799999999998 899999998641 112359999999
Q ss_pred cCceeecCCCCCCccceEEEEEEEEecCCCCCCCCCCCCcEEEEEecCCCCCCCCCCccccccCCCC-CCCceEEEEeee
Q 042239 87 SSPVRLLDPVTKTPTSFETTFSFQFNTSNNTRTSRDGGSSLTFIIVPDEFTVGRAGPWLGVLNDACK-DDYKAVAVKFDT 165 (413)
Q Consensus 87 ~~pv~l~~~~~~~~~sF~t~F~f~i~~~~~~~~~~~~gdGlaF~l~~~~~~~~~~g~~lGl~~~~~~-g~~~~vAVEfDT 165 (413)
++||+|||+.+|+++||+|+|+|.|...+ ...+||||||+|+|.+..++..||+|||+|.+++ +.+|.|||||||
T Consensus 74 ~~Pi~l~d~~tg~vaSFsTsFsF~I~~~~----~~~~gdGlAF~laP~~~~p~~~gg~LGL~n~~~~~~~n~~vAVEFDT 149 (281)
T 3ujo_A 74 STPIQIWDNTTGTVASWATSFTFNLQAPN----AASPADGLAFALVPVGSQPKDKGGFLGLFDSKNYASSNQTVAVEFDT 149 (281)
T ss_dssp SSCEECBCSSSCCBEEEEEEEEEECCCSS----TTSCCEEEEEEEEETTCCCCCCGGGTTTCSCSSCCTTSCCEEEEECC
T ss_pred CCCEEcccCCCCCceeEEEEEEEEEecCC----CCCCCCceEEEEecCCCCCCCCcceeeeccccCCCccCcEEEEEEec
Confidence 99999999999999999999999998765 6778999999999998666788999999987653 458999999999
Q ss_pred cccCccCCCCCCceeEecCCCcccccccCCCCccccCCCCeEEEEEEEeCCCcEEEEEEEecCCCCCCCCCeee------
Q 042239 166 CRDLEFGGPNDNHVGINLGSIVSTRAINASDVGIFLNDGSVHRAWIAYDGTRGWMDVRIGSDGRDYPSTKPTFS------ 239 (413)
Q Consensus 166 ~~n~~~~dp~~~Hvgi~~ns~~s~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~~l~------ 239 (413)
++|.+| ||++||||||+|++.|.++.+| ++.+|+.++|||+||+.+++|+|+|. +.. .+.+|+|+
T Consensus 150 ~~N~e~-Dp~~nHVGIDvNSi~S~~t~~~-----~l~~G~~~~vwI~Yd~~tk~L~V~l~-~~~--~~~~~~lS~~vDL~ 220 (281)
T 3ujo_A 150 FYNGGW-DPTERHIGIDVNSIKSIKTTSW-----DFANGENAEVLITYDSSTNLLVASLV-HPS--QKTSFIVSERVDLT 220 (281)
T ss_dssp SCCCSS-CCSSSEEEEEESSSCCSCEEEC-----CCCSSCCEEEEEEECTTTCEEEEEEE-CTT--TCCCEEEEEECCST
T ss_pred cccccC-CCCCCeEEEEcCCCCccccccc-----cccCCCEEEEEEEEeCCCCEEEEEEe-cCC--CCCCceEEEEechH
Confidence 999887 9999999999999999998887 57899999999999999999999999 443 24466666
Q ss_pred ---------eeeeecCC---ccceEeEEeeEEeeCCCC
Q 042239 240 ---------GFSASTGN---MTQIHNLLSWNFSSISQP 265 (413)
Q Consensus 240 ---------GFsasTG~---~~~~h~I~sWsf~~~~~~ 265 (413)
|||||||. ..|.|+|++|+|+++...
T Consensus 221 ~~L~e~v~VGFSAsTG~~~~~~e~H~IlsWSFss~l~~ 258 (281)
T 3ujo_A 221 SVLPEWVSVGFSATTGLSKGYVETNEVLSWSFASKLSI 258 (281)
T ss_dssp TTSCSEEEEEEEEEECSSTTSCCCCEEEEEEEEEEECS
T ss_pred HhccCcEEEEEEeecCCCCcccceeEEEEEEEEEEcCC
Confidence 99999996 689999999999998654
|
| >3ipv_A Lectin alpha chain; galactose binding, SEED lectin, hemagglutinin, legume lectin fungal, sugar binding protein; 2.04A {Spatholobus parviflorus} PDB: 3ipv_B 3usu_B* 3usu_A* | Back alignment and structure |
|---|
| >3zyr_A Lectin; sugar binding protein, N-glycan; HET: NAG BMA MAN GOL; 1.65A {Platypodium elegans} SCOP: b.29.1.1 PDB: 3zvx_A* 1ukg_A* 1q8o_A* 1q8q_A* 1q8s_A* 1q8v_A* 1q8p_A* 2auy_A* 2gme_A 2gmm_A* 2gmp_A* 2gn3_A* 2gn7_A* 2gnb_A* 2gnd_A* 2gnm_A* 2gnt_A 2phf_A* 2phr_A* 2pht_A* ... | Back alignment and structure |
|---|
| >1fny_A BARK lectin, BARK agglutinin I,polypeptide A; legume lectin, jelly roll, sugar binding protein; 1.81A {Robinia pseudoacacia} SCOP: b.29.1.1 PDB: 1fnz_A* | Back alignment and structure |
|---|
| >1dbn_A MAL, protein (leukoagglutinin); plant lectin, carbohydrate binding, sialyllactose, sugar BIN protein; HET: NAG SIA GAL BGC; 2.75A {Maackia amurensis} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1v6i_A Agglutinin, PNA, galactose-binding lectin; open quaternary association, orthorhombic, carbohydrate specificity, protein crystallography; HET: GAL GLC; 2.15A {Arachis hypogaea} SCOP: b.29.1.1 PDB: 1bzw_A* 1v6j_A* 1v6k_A* 1v6l_A* 1v6m_A 1v6n_A 1v6o_A 2dva_A* 1cq9_A 1ciw_A* 1qf3_A* 1rir_A* 1rit_A* 2dh1_A 1cr7_A* 2dv9_A* 2dvb_A* 2dvd_A* 2dvf_A 2dvg_A* ... | Back alignment and structure |
|---|
| >1fx5_A UEA-I, UE-I, anti-H(O) lectin I; legume lectin, HOMO-dimer, fucose specific lectin, SUG binding protein; HET: NAG FUC BMA MAN; 2.20A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1jxn_A* | Back alignment and structure |
|---|
| >1sbf_A Soybean agglutinin; lectin; HET: NAG GAL; 2.43A {Glycine max} SCOP: b.29.1.1 PDB: 1sbd_A* 1sbe_A* 1g9f_A* 2sba_A* | Back alignment and structure |
|---|
| >1g7y_A Stem/LEAF lectin DB58; jelly roll fold, sugar binding protein; HET: NAG FUC FUL; 2.50A {Vigna unguiculata subsp} SCOP: b.29.1.1 PDB: 1lul_A 1lu1_A* 1bjq_A* 1lu2_A* | Back alignment and structure |
|---|
| >1fat_A Phytohemagglutinin-L; glycoprotein, plant defense protein, lectin; HET: NAG; 2.80A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1g8w_A* | Back alignment and structure |
|---|
| >1gzc_A Erythrina crista-galli lectin; carbohydrate, sugar binding protein, saccharide, protein-carbohydrate interactions, lactose, glycoprotein; HET: LAT; 1.58A {Erythrina crista-galli} SCOP: b.29.1.1 PDB: 1gz9_A* 1fyu_A* 1ax0_A* 1ax1_A* 1ax2_A* 1axy_A* 1axz_A* 1lte_A* 1sfy_A* 1v00_A* 1uzz_A 1uzy_A* 3n35_A* 3n36_A* 3n3h_A* | Back alignment and structure |
|---|
| >2eig_A Lectin; L-fucosyl, N-acetyl-D-glucosamine, SUG binding protein; HET: NAG; 2.00A {Lotus tetragonolobus} | Back alignment and structure |
|---|
| >2bqp_A Protein (PEA lectin); D-glucopyranose complex, sugar binding protein; HET: GLC; 1.90A {Pisum sativum} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1f9k_A Acidic lectin; legume lectin, glycosylated protein, H-antigenic specificity agglutinin, sugar binding protein; HET: NAG MAN AMG; 3.00A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 1fay_A* | Back alignment and structure |
|---|
| >1hql_A Lectin; xenograft antigen, sugar BI protein; HET: GLA MBG NAG; 2.20A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1gnz_A* | Back alignment and structure |
|---|
| >1wbf_A Protein (agglutinin); lectin (agglutinin), legume lectin, protein crystallography, group specificity, saccharide free form; HET: NAG; 2.30A {Psophocarpus tetragonolobus} SCOP: b.29.1.1 PDB: 2d3s_A* 2dtw_A* 1wbl_A* 2dty_A* 2du0_A* 2du1_A* 2e51_A* 2e53_A* 2zmk_A* 2zml_A* 2zmn_A* 2e7t_A* 2e7q_A* | Back alignment and structure |
|---|
| >1qnw_A Chitin binding lectin, UEA-II; carbohydrate binding; HET: NAG; 2.35A {Ulex europaeus} SCOP: b.29.1.1 PDB: 1dzq_A* 1qoo_A* 1qos_A* 1qot_A* | Back alignment and structure |
|---|
| >1gsl_A Griffonia simplicifolia lectin 4; glycoprotein, manganese; HET: FUC GAL MAG NAG BMA; 2.00A {Griffonia simplicifolia} SCOP: b.29.1.1 PDB: 1lec_A* 1led_A* | Back alignment and structure |
|---|
| >1n47_A Isolectin B4; cancer antigen, vicia villosa lectin, glycoprotein TN-bindin protein, carbohydrate recognition, sugar binding protein; HET: NAG FUC TNR; 2.70A {Vicia villosa} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >2fmd_A Lectin, agglutinin, BMA; legume lectin, beta sandwich, protein-carbohydrate complex, sugar binding protein; HET: MAN; 1.90A {Bowringia mildbraedii} | Back alignment and structure |
|---|
| >1avb_A Arcelin-1; lectin-like glycoprotein, plant defense, insecticidal activi lectin; HET: NAG; 1.90A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1ioa_A Arcelin-5A, ARC5A; lectin-like proteins, plant defense proteins, lectin; HET: NAG FUC; 2.70A {Phaseolus vulgaris} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >2ltn_A PEA lectin, alpha chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1bqp_A* 1hkd_A 1ofs_A* 1rin_A* 1lof_C* 1len_A 1lem_A 1les_A* 2lal_A 1loe_A 1loa_A* 1loc_A* 1lod_A* 1lob_A 1lof_A* 1log_A* 1lgc_A* 1lgb_A* 2b7y_A* | Back alignment and structure |
|---|
| >1dhk_B Bean lectin-like inhibitor, porcine pancreatic alpha-amylase; CO (hydrolase-inhibitor), complex (hydrolase-inhibitor) comple; HET: NAG; 1.85A {Phaseolus vulgaris} SCOP: b.29.1.1 PDB: 1viw_B* | Back alignment and structure |
|---|
| >2dur_A VIP36;, vesicular integral-membrane protein VIP36; beta sandwich, carbohydrate binding protein, cargo receptor, transport; HET: MAN; 1.65A {Canis lupus familiaris} PDB: 2dup_A 2duq_A* 2duo_A* 2e6v_A* | Back alignment and structure |
|---|
| >1gv9_A P58/ergic-53; lectin, carbohydrate binding; 1.46A {Rattus norvegicus} SCOP: b.29.1.13 PDB: 1r1z_A 3a4u_A 3lcp_A | Back alignment and structure |
|---|
| >1qmo_E Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1qmo_A Mannose binding lectin, FRIL; crosslink, hematopoietic progenitor, sugar complex; HET: MAN; 3.5A {Dolichos lab lab} SCOP: b.29.1.1 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >2a6y_A EMP47P (FORM1); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.42A {Saccharomyces cerevisiae} SCOP: b.29.1.13 | Back alignment and structure |
|---|
| >1nls_A Concanavalin A; lectin, agglutinin; 0.94A {Canavalia ensiformis} SCOP: b.29.1.1 PDB: 1bxh_A* 1apn_A 1ces_A 1cjp_A* 1c57_A 1cvn_A* 1con_A 1dq1_A 1dq2_A 1dq4_A 1dq5_A 1dq6_A 1enq_A 1enr_A 1ens_A 1gic_A* 1dq0_A 1hqw_A 1gkb_A* 1i3h_A ... | Back alignment and structure |
|---|
| >2a6z_A EMP47P (FORM2); beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.00A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a70_A 2a71_A | Back alignment and structure |
|---|
| >2a6v_A EMP46P; beta sandwich, carbohydrate binding protein, cargo receptor, structural genomics, NPPSFA; 1.52A {Saccharomyces cerevisiae} SCOP: b.29.1.13 PDB: 2a6w_A 2a6x_A | Back alignment and structure |
|---|
| >2ltn_B PEA lectin, beta chain; 1.70A {Pisum sativum} SCOP: b.29.1.1 PDB: 1hkd_B 1rin_B* 1ofs_B* 1bqp_B* 1loe_B 1loa_B* 1loc_B* 1lod_B* 1lob_B 1lof_B* 1log_B* 1lof_D* 1les_B* 2b7y_B* 1lgc_B* 1lgb_B* 1len_B 1lem_B 2lal_B | Back alignment and structure |
|---|
| >4gt4_A Tyrosine-protein kinase transmembrane receptor RO; ATP binding, phosphorylation, transferase; 2.41A {Homo sapiens} PDB: 3zzw_A | Back alignment and structure |
|---|
| >2qkw_B Protein kinase; three-helix bundle motif, AVRPTO-PTO duplex, layered beta- sheets, transferas; HET: SEP TPO; 3.20A {Solanum pimpinellifolium} PDB: 3hgk_A* | Back alignment and structure |
|---|
| >4aoj_A High affinity nerve growth factor receptor; transferase, inhibitor; HET: V4Z; 2.75A {Homo sapiens} | Back alignment and structure |
|---|
| >3uim_A Brassinosteroid insensitive 1-associated receptor; kinase, protein kinase, transferase; HET: SEP TPO ANP; 2.20A {Arabidopsis thaliana} PDB: 3ulz_A* 3tl8_A* | Back alignment and structure |
|---|
| >2nru_A Interleukin-1 receptor-associated kinase 4; inhibitor, IRAK, transferase; HET: TPO SEP T12; 2.00A {Homo sapiens} PDB: 2nry_A* 2oib_A* 2oic_A* 2oid_A* 2o8y_A* | Back alignment and structure |
|---|
| >4asz_A BDNF/NT-3 growth factors receptor; transferase, TRKA, TRKB; 1.70A {Homo sapiens} PDB: 4at3_A* 4at4_A* 4at5_A* 3v5q_A* | Back alignment and structure |
|---|
| >3p1a_A MYT1 kinase, membrane-associated tyrosine- and threonine-speci inhibitory kinase; structural genomics, structural genomics consortium, SGC; 1.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2c30_A Serine/threonine-protein kinase PAK 6; CRIB domain, ATP-binding, transferase, nucleotide-binding; HET: SEP; 1.6A {Homo sapiens} PDB: 2f57_A* 2j0i_A* 2cdz_A* 2q0n_A* 2x4z_A* 2bva_A* | Back alignment and structure |
|---|
| >3fpq_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase, ATP-BIND kinase, nucleotide-binding, phosphoprotein; 1.80A {Rattus norvegicus} | Back alignment and structure |
|---|
| >4fih_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP; 1.97A {Homo sapiens} PDB: 4fig_A* 4fif_A* 4fii_A* 4fij_A* | Back alignment and structure |
|---|
| >3omv_A RAF proto-oncogene serine/threonine-protein kinas; serine/threonine-protein kinase, transferase; HET: SM5; 4.00A {Homo sapiens} | Back alignment and structure |
|---|
| >4fie_A Serine/threonine-protein kinase PAK 4; kinase domain, protein ATP binding, phosphorylation, transferase; HET: SEP ANP; 3.11A {Homo sapiens} | Back alignment and structure |
|---|
| >4ase_A Vascular endothelial growth factor receptor 2; transferase, angiogenesis, signaling protein, phosphorylatio receptor, inhibitor; HET: AV9; 1.83A {Homo sapiens} PDB: 4agd_A* 4asd_A* 4agc_A* | Back alignment and structure |
|---|
| >3dzo_A Rhoptry kinase domain; parasitic disease, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3hyh_A Carbon catabolite-derepressing protein kinase; kinase domain, transferase, ATP-binding, carbohydrate metabo kinase, membrane; 2.20A {Saccharomyces cerevisiae} PDB: 3dae_A 2fh9_A 3mn3_A | Back alignment and structure |
|---|
| >1qcf_A Haematopoetic cell kinase (HCK); tyrosine kinase-inhibitor complex, DOWN-regulated kinase, ordered activation loop; HET: PTR PP1; 2.00A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 2c0i_A* 2c0o_A* 2c0t_A* 1ad5_A* 2hck_A* 3nhn_A 3hck_A 1bu1_A 3rea_B 3rbb_B | Back alignment and structure |
|---|
| >4b9d_A Serine/threonine-protein kinase NEK1; transferase, inhibitor; HET: CK7; 1.90A {Homo sapiens} PDB: 4apc_A* | Back alignment and structure |
|---|
| >2x7f_A TRAF2 and NCK-interacting protein kinase; serine/threonine-protein kinase, phosphoprotein; HET: 824; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2clq_A Mitogen-activated protein kinase kinase kinase 5; transferase, metal-binding, apoptosis; HET: STU; 2.3A {Homo sapiens} | Back alignment and structure |
|---|
| >4aw2_A Serine/threonine-protein kinase MRCK alpha; transferase, CDC42BPA; HET: 22E; 1.70A {Rattus norvegicus} PDB: 3tku_A* 3qfv_A* | Back alignment and structure |
|---|
| >3llt_A Serine/threonine kinase-1, pflammer; lammer kinase, malaria, structural GE structural genomics consortium, SGC, transferase; HET: ANP; 2.50A {Plasmodium falciparum 3D7} | Back alignment and structure |
|---|
| >3kul_A Ephrin type-A receptor 8; ATP-binding, kinase, nucleotide-binding, transfera phosphorylation, transmembrane, tyrosine-protein kinase; HET: PTR; 2.15A {Homo sapiens} | Back alignment and structure |
|---|
| >4b99_A Mitogen-activated protein kinase 7; transferase, inhibitor; HET: R4L; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cek_A Dual specificity protein kinase TTK; HMPS1, PYT, ESK, phosphotyros picked threonine kinase, SGC, structural genomics consortiu binding; HET: 7PE; 2.30A {Homo sapiens} PDB: 3gfw_A* 3h9f_A* 2x9e_A* 3hmp_A* 3hmn_A* 3hmo_A* | Back alignment and structure |
|---|
| >3kfa_A Tyrosine-protein kinase ABL1; CML, drug resistance, inhibitor, ATP-binding, nucleotide-binding, oncogene, TRAN; HET: B91; 1.22A {Mus musculus} SCOP: d.144.1.7 PDB: 2qoh_A* 3kf4_A* 3k5v_A* 1fpu_A* 1m52_A* 1iep_A* 2hzn_A* 1opj_A* 3ms9_A* 3mss_A* 3ik3_A* 2z60_A* 2e2b_A* 3pyy_A* 3oxz_A* 2g1t_A* 3ue4_A* 3oy3_A* 2hiw_A* 2v7a_A* ... | Back alignment and structure |
|---|
| >2w4o_A Calcium/calmodulin-dependent protein kinase type IV; calmodulin-binding, nucleotide-binding, serine/threonine-protein kinase, ATP-binding; HET: DKI; 2.17A {Homo sapiens} | Back alignment and structure |
|---|
| >3gen_A Tyrosine-protein kinase BTK; bruton'S tyrosine kinase, 4-amino-5-(4-phenoxyphenyl)-5H- pyrrolo[3, 2-D]pyrimidin-7-YL-cyclopentane, TEC-family; HET: B43; 1.60A {Homo sapiens} PDB: 3k54_A* 3pj2_A* 3piy_A* 3piz_A* 3pj1_A* 3pix_A* 3pj3_A* 3p08_A 3ocs_A* 3oct_A* 1k2p_A | Back alignment and structure |
|---|
| >1fmk_A C-SRC, P60-SRC, tyrosine-protein kinase SRC; tyrosine kinase, phosphorylation, SH2, SH3, phosphotyrosine, proto-oncogene, phosphotransferase; HET: PTR; 1.50A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1y57_A* 2src_A* 1ksw_A* 2ptk_A* 1yol_A* 2oiq_A* 3d7t_B* 3dqx_A* 3el7_A* 3el8_A* 3en4_A* 3en5_A* 3en6_A* 3en7_A* 3f6x_A* 3g6g_A* 3uqf_A* 3uqg_A* 4agw_A* 3oez_A* ... | Back alignment and structure |
|---|
| >1opk_A P150, C-ABL, proto-oncogene tyrosine-protein kinase ABL1; transferase; HET: MYR P16; 1.80A {Mus musculus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1opl_A* 2fo0_A* 2abl_A | Back alignment and structure |
|---|
| >3pg1_A Mitogen-activated protein kinase, putative (MAP K protein); EPK Ser/Thr protein kinase fold, Ser/Thr protein kinase, TRA; 1.95A {Leishmania major} PDB: 3uib_A* | Back alignment and structure |
|---|
| >4g3f_A NF-kappa-beta-inducing kinase; non-RD kinase, protein serine/threonine kinase, S based drug design, MAP3K14, transferase; HET: 0WB; 1.64A {Mus musculus} PDB: 4g3g_A* 4g3c_A 4dn5_A* | Back alignment and structure |
|---|
| >4aw0_A HPDK1, 3-phosphoinositide-dependent protein kinase 1; transferase, allosteric regulation, allosteric site, phosphorylation, AGC protein kinase; HET: SEP ATP MJF; 1.43A {Homo sapiens} PDB: 3hrc_A* 3hrf_A* 4a06_A* 4a07_A* 3rcj_A* 4aw1_A* 3rwq_A* 3sc1_A* 3qd0_A* 2r7b_A* 3ion_A* 3qcq_A* 3qcs_A* 3qcx_A* 3qcy_A* 3iop_A* 3qd3_A* 3qd4_A* 3h9o_A* 1uu3_A* ... | Back alignment and structure |
|---|
| >2vx3_A Dual specificity tyrosine-phosphorylation- regula kinase 1A; serine/threonine-protein kinase, minibrain homolog, nucleotide-binding, transferase; HET: PTR D15 P6G; 2.40A {Homo sapiens} PDB: 2wo6_A* 3anq_A* 3anr_A* | Back alignment and structure |
|---|
| >3byv_A Rhoptry kinase; malaria, transferase, structural genomics, structural genomics consortium, SGC; 1.80A {Toxoplasma gondii} PDB: 2w1z_A | Back alignment and structure |
|---|
| >3fxz_A Serine/threonine-protein kinase PAK 1; transferase, ATP-binding, phosphorylation, allosteric enzyme, alternative splicing, apoptosis, cell junction; HET: TPO FLL; 1.64A {Homo sapiens} SCOP: d.144.1.7 PDB: 3fy0_A* 4daw_A* 3q52_A* 3q53_A* 1yhw_A 1f3m_C 1yhv_A 2hy8_1* 3q4z_A* | Back alignment and structure |
|---|
| >2h8h_A Proto-oncogene tyrosine-protein kinase SRC; SRC kinase, transferase; HET: PTR H8H; 2.20A {Homo sapiens} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 | Back alignment and structure |
|---|
| >2qol_A Ephrin receptor; receptor tyrosine kinase, juxtamembrane segment, structural genomics, mutant, structural genomics consortium, SGC, ATP- binding; 1.07A {Homo sapiens} PDB: 2qok_A 2qoi_A 2qoo_A 2qof_A 2qod_A 2qo9_A* 2gsf_A 2qo7_A* 2qo2_A* 2qoq_A* 2qon_A* 3fxx_A* 3fy2_A 2qoc_A* 2qob_A* 3dzq_A* 2r2p_A 2hel_A 2rei_A 3dko_A* ... | Back alignment and structure |
|---|
| >2x4f_A Myosin light chain kinase family member 4; LUNG, breast cancer, transferase, serine/threonine-protein kinase, nucleotide-binding; HET: 16X 1PE; 2.67A {Homo sapiens} | Back alignment and structure |
|---|
| >2ac3_A MAP kinase-interacting serine/threonine kinase 2; DFD motif, transferase; 2.10A {Homo sapiens} PDB: 2hw7_A* 2ac5_A* 2hw6_A | Back alignment and structure |
|---|
| >4f9c_A Cell division cycle 7-related protein kinase; Ser/Thr protein kinase, transferase, phosphorylation, cell C cell division, mitosis, S phase; HET: 0SX; 2.08A {Homo sapiens} PDB: 4f99_A* 4f9b_A* 4f9a_A* | Back alignment and structure |
|---|
| >2i1m_A Macrophage colony-stimulating factor 1 receptor; kinase domain, kinase inhibitor complex, transferase; HET: 5CN; 1.80A {Homo sapiens} PDB: 3bea_A* 3lcd_A* 2i0y_A* 2i0v_A* 3dpk_A* 3krj_A* 3krl_A* 2ogv_A 3lco_A* | Back alignment and structure |
|---|
| >3vhe_A Vascular endothelial growth factor receptor 2; kinase domain, kinase, transferase-transferase inhibitor COM; HET: 42Q; 1.55A {Homo sapiens} PDB: 1y6a_A* 1y6b_A* 3vhk_A* 3vid_A* 3hng_A* | Back alignment and structure |
|---|
| >3ll6_A Cyclin G-associated kinase; transferase, protein kinase, serine/threonine kinase, cyclin clathrine, membrane trafficking, structural genomics; 2.10A {Homo sapiens} | Back alignment and structure |
|---|
| >3qyz_A Mitogen-activated protein kinase 1; transferase, serine/threonine-protein kinase, ATP-binding CE phosphorylation; HET: CME Z8B SO4; 1.46A {Rattus norvegicus} PDB: 2fys_B 1erk_A* 3qyi_A* 3erk_A* 3qyw_A* 4erk_A* 4gsb_A* 4gt3_A* 4gva_A* 2z7l_A* 2erk_A* 1gol_A* 2gph_A 3zu7_A 3zuv_A* 3o71_A 3r63_A 3c9w_A* 2y9q_A* 4fmq_A* ... | Back alignment and structure |
|---|
| >3e7e_A HBUB1, BUB1A, mitotic checkpoint serine/threonine-protein kinas; spindle assembly checkpoint, mitosis, kinase, activation, KE CDC20, ATP-binding; HET: ATP; 2.31A {Homo sapiens} | Back alignment and structure |
|---|
| >3ugc_A Tyrosine-protein kinase JAK2; small molecule inhibitor, ATP binding, transferase-transfera inhibitor complex; HET: 046; 1.34A {} PDB: 3krr_A* 3lpb_A* 4aqc_A* 4e4m_A* 4f08_A* 4f09_A* 3q32_A* 3rvg_A* 4hge_A* 3tjc_A* 3tjd_A* 4bbe_A* 4bbf_A* 2b7a_A* 3fup_A* 3e64_A* 3e62_A* 3e63_A* 2xa4_A* 3iok_A* ... | Back alignment and structure |
|---|
| >3niz_A Rhodanese family protein; structural genomics, structural genomics consortium, SGC, phosphotransferase, cyclin dependent kinase; HET: ADP; 2.40A {Cryptosporidium parvum} SCOP: d.144.1.7 PDB: 2qkr_A* | Back alignment and structure |
|---|
| >3v8s_A RHO-associated protein kinase 1; dimerization, myosin, transferase, inhibitor, transf transferase inhibitor complex; HET: 0HD; 2.29A {Homo sapiens} PDB: 3twj_A* 3tv7_A* 2etr_A* 2esm_A* 2eto_A* 2etk_A* 3d9v_A* 3ncz_A* 3ndm_A* 2v55_A* 2f2u_A* 2h9v_A* | Back alignment and structure |
|---|
| >1t4h_A Serine/threonine-protein kinase WNK1; protein serine/threonine kinase, transferase; 1.80A {Rattus norvegicus} PDB: 3fpq_A | Back alignment and structure |
|---|
| >3qup_A Tyrosine-protein kinase receptor TYRO3; protein kinase inhibitor, receptor tyrosine kinase, spirocyc kinase domain, phosphotransfer, GAS6 ligand; HET: LUN; 1.90A {Mus musculus} | Back alignment and structure |
|---|
| >3cbl_A C-FES, proto-oncogene tyrosine-protein kinase FES/FPS; V-FES, fujinami, avian sarcoma, viral, feline virus, SGC; HET: STU; 1.75A {Homo sapiens} PDB: 3bkb_A* 3cd3_A* 4e93_A* | Back alignment and structure |
|---|
| >2zmd_A Dual specificity protein kinase TTK; MPS1, T686A, ATP-binding, nucleotide-bindi phosphoprotein, serine/threonine-protein kinase; HET: 537 7PE; 2.88A {Homo sapiens} PDB: 2zmc_A* | Back alignment and structure |
|---|
| >1mqb_A Ephrin type-A receptor 2; tyrosine protein kinase, transferase; HET: ANP; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2vd5_A DMPK protein; serine/threonine-protein kinase, kinase, transferase, ATP-BI nucleotide-binding, cardiac contractility, muscle different; HET: BI8; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1u5q_A Serine/threonine protein kinase TAO2; transferase; HET: SEP; 2.10A {Rattus norvegicus} SCOP: d.144.1.7 PDB: 1u5r_A* 2gcd_A* | Back alignment and structure |
|---|
| >4f0f_A Serine/threonine-protein kinase ROCO4; LRRK2, ATP-binding, nucleotide serine/threonine-protein kinase, transferase, signaling Pro; HET: ACP; 1.80A {Dictyostelium discoideum} PDB: 4f0g_A 4f1t_A* 4f1m_A* 4f1o_A* | Back alignment and structure |
|---|
| >1p4o_A Insulin-like growth factor I receptor protein; IGF-1R, kinase domain, hormone-growth factor complex; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 1m7n_A 3lvp_A* 3lw0_A* 1jqh_A* 2zm3_A* 3f5p_A* 3i81_A* 2oj9_A* 3nw5_A* 3nw6_A* 3nw7_A* 3o23_A* 3qqu_A* 3d94_A* 1k3a_A* 2z8c_A* 1ir3_A* 1gag_A* 1irk_A 3bu3_A* ... | Back alignment and structure |
|---|
| >3soc_A Activin receptor type-2A; structural genomics consortium, SGC, transferase, protein KI; HET: GVD; 1.95A {Homo sapiens} PDB: 3q4t_A* 4asx_A* 2qlu_A* | Back alignment and structure |
|---|
| >3p86_A Serine/threonine-protein kinase CTR1; ETR1, ERS1, ETR2, phosphorylation, transferase; HET: STU; 2.50A {Arabidopsis thaliana} PDB: 3ppz_A* | Back alignment and structure |
|---|
| >2j7t_A Serine/threonine-protein kinase 10; transferase, ATP-binding, cell cycle progression, phosphorylation, disease mutation, nucleotide- binding; HET: 274; 2.0A {Homo sapiens} PDB: 4aot_A* 3zz2_A* 2j51_A* 2jfl_A* 2jfm_A* 2uv2_A* | Back alignment and structure |
|---|
| >2zv2_A Calcium/calmodulin-dependent protein kinase kinas; beta, camkk2, E.C.2.7.11.17, phosphorylation, AMPKK, metabolism, binding, calmodulin-binding; HET: 609; 2.40A {Homo sapiens} | Back alignment and structure |
|---|
| >3uqc_A Probable conserved transmembrane protein; structural genomics, TB structural genomics consortium, TBSG fold, FHAA, transferase; 2.26A {Mycobacterium tuberculosis} PDB: 3oun_B* 3otv_A 3ouk_A | Back alignment and structure |
|---|
| >1wak_A Serine/threonine-protein kinase SPRK1; SRPK, transferase, alternative splicing, ATP-binding, chromosome partition, differentiation, mRNA processing; 1.73A {Homo sapiens} PDB: 1wbp_A* 3beg_A* 2x7g_A* | Back alignment and structure |
|---|
| >3ubd_A Ribosomal protein S6 kinase alpha-3; kinase-inhibitor complex, induced FIT, transferase-transfera inhibitor complex; HET: SL0; 1.53A {Mus musculus} PDB: 4el9_A* 3g51_A* 2z7q_A* 2z7r_A* 2z7s_A* | Back alignment and structure |
|---|
| >3eb0_A Putative uncharacterized protein; kinase cryptosporidium parvum, ATP-binding, kinase, nucleoti binding; HET: PTR DRK; 2.65A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3aln_A Dual specificity mitogen-activated protein kinase; protein AMP-PNP complex, transferase; HET: ANP; 2.30A {Homo sapiens} PDB: 3alo_A* | Back alignment and structure |
|---|
| >2buj_A Serine/threonine-protein kinase 16; transferase, ATP-binding, lipoprotein, myristate, PA phosphorylation; HET: STU; 2.6A {Homo sapiens} | Back alignment and structure |
|---|
| >3is5_A Calcium-dependent protein kinase; CDPK, structural genomics, parasitology, structural genomics consortium, SGC, ATP-binding, nucleotide-binding; HET: ANP; 2.55A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >2b9h_A MAP kinase FUS3, mitogen-activated protein kinase FUS3; transferase; HET: ADP; 1.55A {Saccharomyces cerevisiae} PDB: 2b9i_A* 2b9j_A* 2f49_A 2fa2_A 2b9f_A* 2f9g_A* | Back alignment and structure |
|---|
| >3lm5_A Serine/threonine-protein kinase 17B; STK17B, serine/threonine kinase 17B, DRAK2, DAP kinase relat apoptosis-inducing protein kinase 2; HET: QUE; 2.29A {Homo sapiens} PDB: 3lm0_A* | Back alignment and structure |
|---|
| >3kvw_A DYRK2, dual specificity tyrosine-phosphorylation-regulat 2; KI-(Y)-phosphorylation REG kinase 2, PSK-H2, kinase, structural genomics consortium; HET: SEP PTR IRB; 2.28A {Homo sapiens} PDB: 3k2l_A* 4azf_A* | Back alignment and structure |
|---|
| >2wqm_A Serine/threonine-protein kinase NEK7; ATP-binding, polymorphism, metal-binding, cell cycle kinase, mitosis, cytoplasm, magnesium, transferase; 2.10A {Homo sapiens} PDB: 2wqn_A* | Back alignment and structure |
|---|
| >3e3p_A Protein kinase, putative glycogen synthase kinase; leishmaniasis, transferase; 2.00A {Leishmania major} | Back alignment and structure |
|---|
| >1blx_A Cyclin-dependent kinase 6; inhibitor protein, cyclin-dependent kinase, cell cycle control, alpha/beta, complex (inhibitor protein/kinase); 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 1bi7_A 1bi8_A 1g3n_A 2f2c_B* 1jow_B* 2euf_B* 1xo2_B* 3nup_A* 3nux_A* 2w9z_B 2w99_B 2w96_B 2w9f_B | Back alignment and structure |
|---|
| >3q60_A ROP5B; pseudokinase, transferase; HET: ATP; 1.72A {Toxoplasma gondii} PDB: 3q5z_A* | Back alignment and structure |
|---|
| >3uto_A Twitchin; kinase, muscle sarcomere, transferase; HET: FLC P33; 2.40A {Caenorhabditis elegans} PDB: 1koa_A | Back alignment and structure |
|---|
| >3ork_A Serine/threonine protein kinase; structural genomics, TB structural genomics consortium, TBSG domain, signal transduction; HET: AGS; 1.60A {Mycobacterium tuberculosis} PDB: 3ori_A* 3orl_A* 3oro_A* 3orp_A* 3ort_A* 3f61_A* 1mru_A* 3f69_A* 3orm_A* 1o6y_A* 2fum_A* | Back alignment and structure |
|---|
| >3fdn_A Serine/threonine-protein kinase 6; aurora kinase inhibitors, virtual screening, X-RAY CO- crystal analysis, structure-based drug design (SBDD); HET: MMH; 1.90A {Homo sapiens} SCOP: d.144.1.7 PDB: 3k5u_A* 3m11_A* 2c6e_A* 1muo_A* 2bmc_A* 2j4z_A* 1ol6_A* 3up2_A* 3unz_A* 3uo5_A* 3uo6_A* 3uod_A* 3uoh_A* 3uoj_A* 3uok_A* 3uo4_A* 3uol_A* 3up7_A* 4dea_A* 4deb_A* ... | Back alignment and structure |
|---|
| >3a7i_A MST3 kinase, serine/threonine kinase 24 (STE20 homolog, yeast); two-LOBE protein kinase fold, ATP-binding, nucleotid binding, transferase; HET: TPO ADE; 1.45A {Homo sapiens} PDB: 3a7g_A* 3a7h_A* 3a7f_A* 3a7j_A* 3ckw_A 3ckx_A* 3ggf_A* 2xik_A* | Back alignment and structure |
|---|
| >1k9a_A Carboxyl-terminal SRC kinase; COOH-terminal SRC kinase, CSK, SFK, signal transduction, SH2, SH3, SRC homology, tyrosine kinase; 2.50A {Rattus norvegicus} SCOP: b.34.2.1 d.93.1.1 d.144.1.7 PDB: 1jeg_A | Back alignment and structure |
|---|
| >2vuw_A Serine/threonine-protein kinase haspin; cell cycle, transferase, CAsp8, nucleotide binding; HET: MSE 5ID MPD; 1.80A {Homo sapiens} PDB: 3f2n_A* 3e7v_A* 3dlz_A* 3fmd_A* 3iq7_A* 2wb8_A | Back alignment and structure |
|---|
| >2w1i_A JAK2; chromosomal rearrangement, nucleotide-binding, tyrosine-protein kinase, proto-oncogene, phosphoprotein, disease mutation, SH2 domain; HET: PTR L0I; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1x8b_A WEE1HU, WEE1-like protein kinase; cell cycle, transferase; HET: 824; 1.81A {Homo sapiens} PDB: 3bi6_A* 3biz_A* 3cqe_A* 3cr0_A* 2in6_A* 2io6_A* 2z2w_A* | Back alignment and structure |
|---|
| >1luf_A Muscle-specific tyrosine kinase receptor MUSK; phosphorylation, signal transduction, MASS spectrometry, transferase; 2.05A {Rattus norvegicus} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3rp9_A Mitogen-activated protein kinase; structural genomics, structural genomics consortium, SGC, TR; 2.40A {Toxoplasma gondii} | Back alignment and structure |
|---|
| >3l9p_A Anaplastic lymphoma kinase; kinase domain, ATP-binding, glycoprotein, membrane, nucleotide-binding, phosphoprotein, proto-oncogene; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3dbq_A Dual specificity protein kinase TTK; MPS1 structure, kinase activation, phosphorylation, ATP- binding, nucleotide-binding, phosphoprotein; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3mi9_A Cell division protein kinase 9; P-TEFB, HIV-1, protein binding; HET: TPO; 2.10A {Homo sapiens} PDB: 3mia_A* 4ec9_A* 4ec8_A* 3blh_A* 3blq_A* 3blr_A* 3lq5_A* 3my1_A* 3tn8_A* 3tnh_A* 3tni_A* 4bch_A* 4bci_A* 4bcj_A* 4bcf_A* | Back alignment and structure |
|---|
| >4exu_A Mitogen-activated protein kinase 13; P38 kinase, transferase; 1.70A {Homo sapiens} PDB: 4eyj_A* 4eym_A* 3coi_A | Back alignment and structure |
|---|
| >3lxl_A Tyrosine-protein kinase JAK3; TYK2, inflammation, cancer, PAN inhibitor, ATP-binding mutation, membrane, nucleotide-binding, phosphoprot SCID; HET: IZA; 1.74A {Homo sapiens} PDB: 3lxk_A* 4hvd_A* 4hvg_A* 4hvh_A* 4hvi_A* 3pjc_A* 1yvj_A* | Back alignment and structure |
|---|
| >1j1b_A Glycogen synthase kinase-3 beta; complex, TAU, AMPPNP, transferase; HET: ANP; 1.80A {Homo sapiens} SCOP: d.144.1.7 PDB: 1i09_A* 1j1c_A* 2jld_A* 3m1s_A* 3pup_A* 3du8_A* 1pyx_A* 1q41_A* 1q3w_A* 1q3d_A* 1q4l_A* 3q3b_A* 1q5k_A* 3i4b_A* 3l1s_A* 1r0e_A* 3zrk_A* 3zrl_A* 3zrm_A* 4dit_A* ... | Back alignment and structure |
|---|
| >4dc2_A Protein kinase C IOTA type; kinase, substrate, cell polarity, atypical PKC, trans transferase substrate complex; HET: TPO ADE; 2.40A {Mus musculus} | Back alignment and structure |
|---|
| >3coi_A Mitogen-activated protein kinase 13; P38D, P38delta, ERK, MAP kinase, PMK, STK26, stress-activated protein kinase, structural genomics, PSI; 2.09A {Homo sapiens} | Back alignment and structure |
|---|
| >3uc3_A Serine/threonine-protein kinase SRK2I; SNRK2, ABA signaling, transferase; 1.90A {Arabidopsis thaliana} PDB: 3zut_A 3zuu_A 3uc4_A 3ujg_A 3udb_A | Back alignment and structure |
|---|
| >2ozo_A Tyrosine-protein kinase ZAP-70; inactive ZAP-70, tandem SH2, autoinhibition, ITAM, hydrogen bonding network, TCR signaling, transferase; HET: ANP; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3fe3_A MAP/microtubule affinity-regulating kinase 3; serine/threonine protein kinase, MARK;PAR-1, UBA domai TAK1;P78;MARK3, ATP-binding; 1.90A {Homo sapiens} PDB: 2qnj_A 1y8g_A* 1zmw_A 1zmu_A 1zmv_A 2wzj_A 2r0i_A 2hak_A 3iec_A | Back alignment and structure |
|---|
| >4fvq_A Tyrosine-protein kinase JAK2; janus protein kinase, pseudokinase, ATP binding, phosphoryla transferase; HET: ATP; 1.75A {Homo sapiens} PDB: 4fvp_A* 4fvr_A* | Back alignment and structure |
|---|
| >3brb_A Proto-oncogene tyrosine-protein kinase MER; ATP-binding, disease mutation, glycoprotein, nucleot binding, phosphorylation, receptor; HET: ADP; 1.90A {Homo sapiens} PDB: 3bpr_A* 2p0c_A* | Back alignment and structure |
|---|
| >4fl3_A Tyrosine-protein kinase SYK; transferase; HET: ANP; 1.90A {Homo sapiens} PDB: 4fl2_A* 1a81_A* 1csy_A* 1csz_A* | Back alignment and structure |
|---|
| >2r5t_A Serine/threonine-protein kinase SGK1; AGC protein kinase, apoptosis, ATP-binding, cytoplasm, endoplasmic reticulum, nucleotide-binding, nucleus; HET: ANP; 1.90A {Homo sapiens} PDB: 3hdm_A* 3hdn_A* | Back alignment and structure |
|---|
| >3pls_A Macrophage-stimulating protein receptor; protein kinase, CIS autophosphorylation conformation, recept tyrosine kinase, AMP-PNP, unphosphorylated; HET: ANP; 2.24A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3rgf_A Cyclin-dependent kinase 8; protein kinase complex, transferase,transcription; HET: BAX; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >3n9x_A Phosphotransferase; malaria kinase, structural genomics, structural genomics CON SGC; 2.05A {Plasmodium berghei} PDB: 3nie_A* | Back alignment and structure |
|---|
| >3gbz_A Kinase, CMGC CDK; ssgcid, ATP-binding, nucleotide-binding, serine/threonine-protein kinase, transferase; 1.85A {Giardia lamblia} PDB: 3gc0_A* | Back alignment and structure |
|---|
| >4aaa_A Cyclin-dependent kinase-like 2; transferase, phospho-mimetic; HET: DKI; 1.53A {Homo sapiens} PDB: 4bbm_A* | Back alignment and structure |
|---|
| >3poz_A Epidermal growth factor receptor; kinase domain, anti-oncogene, ATP-binding, cell cycle, disea mutation, glycoprotein, membrane, nucleotide-binding; HET: 03P; 1.50A {Homo sapiens} SCOP: d.144.1.7 PDB: 2itx_A* 2ity_A* 2j5f_A* 2j6m_A* 2itw_A* 1m14_A 1m17_A* 3vjo_A* 2gs6_A* 2gs2_A* 2rf9_A 4g5j_A* 1xkk_A* 2eb2_A 3gop_A 2eb3_A* 2itn_A* 2ito_A* 2itp_A* 2itq_A* ... | Back alignment and structure |
|---|
| >3a8x_A Protein kinase C IOTA type; transferase; HET: TPO; 2.00A {Homo sapiens} PDB: 3a8w_A* 1zrz_A* | Back alignment and structure |
|---|
| >2fst_X Mitogen-activated protein kinase 14; active mutants, lipids, MAP kinase insertion, autophosphorylation, transferase; HET: BOG; 1.45A {Homo sapiens} PDB: 2fso_X* 2fsl_X* 2fsm_X* 2npq_A* 2bal_A* 2baj_A* 2bak_A* 2baq_A* 2qd9_A* 1ian_A* 2rg5_A* 2rg6_A* 3bv2_A* 3bv3_A* 3bx5_A* 3c5u_A* 3cg2_A* 3l8x_A* 3mvl_A* 3mvm_A* ... | Back alignment and structure |
|---|
| >3nsz_A CK II alpha, casein kinase II subunit alpha; inhibitor, transferase-transferase inhibitor CO; HET: ANP; 1.30A {Homo sapiens} SCOP: d.144.1.7 PDB: 2r7i_A 3pe1_A* 1jwh_A* 3pe2_A* 3r0t_A* 3h30_A* 3q9w_A* 3q9x_A* 3q9y_A* 3q9z_A* 3qa0_A 3bqc_A* 2rkp_A* 3c13_A* 3fwq_A 3rps_A* 3u9c_A* 4fbx_A* 3mb7_A* 3mb6_A* ... | Back alignment and structure |
|---|
| >4e5w_A Tyrosine-protein kinase JAK1; kinase domain, transferase-transferase inhibit complex; HET: PTR 0NT; 1.86A {Homo sapiens} PDB: 4e4l_A* 4e4n_A* 4ehz_A* 4ei4_A* 4fk6_A* 3eyg_A* 3eyh_A* | Back alignment and structure |
|---|
| >2psq_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xr0_A | Back alignment and structure |
|---|
| >1cm8_A Phosphorylated MAP kinase P38-gamma; phosphorylation, transferase; HET: TPO PTR ANP; 2.40A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1kob_A Twitchin; kinase, intrasteric regulation; 2.30A {Aplysia californica} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1u59_A Tyrosine-protein kinase ZAP-70; transferase; HET: STU; 2.30A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >1xbb_A Tyrosine-protein kinase SYK; gleevec, STI-571, imatinib, spleen typrosine kinase, active conformation, structural genomics, structural genomix; HET: STI; 1.57A {Homo sapiens} SCOP: d.144.1.7 PDB: 1xba_A* 1xbc_A* 3fqe_A* 3fqh_A* 3fqs_A* 3emg_A* 3srv_A* 4dfl_A* 4dfn_A* 3vf8_A* 3vf9_A* | Back alignment and structure |
|---|
| >2vwi_A Serine/threonine-protein kinase OSR1; STE kinase, hypertension, transferase; HET: ANP; 2.15A {Homo sapiens} PDB: 3dak_A* | Back alignment and structure |
|---|
| >3g33_A Cell division protein kinase 4; Ser/Thr protein kinase, cell cycle, phosphorylation, ATP-BIN cell division, disease mutation, kinase; 3.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2y0a_A Death-associated protein kinase 1; transferase, calmodulin, esprit; HET: MES; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >3com_A Serine/threonine-protein kinase 4; MST1, STE20-like kinase, PSI, structural genomics, protein structure initiative; HET: TPO; 2.20A {Homo sapiens} | Back alignment and structure |
|---|
| >2rku_A Serine/threonine-protein kinase PLK1; structure of PLK1, selectivity residues, POLO-like K structure based drug design, ATP-binding; HET: R78 TLA SRT TAR; 1.95A {Homo sapiens} PDB: 2v5q_A 2yac_A* 4a4l_A* 4a4o_A* 3kb7_A* 3d5w_A* 3d5u_A* 3d5v_A 3db8_A* 3dbc_A* 3dbd_A* 3d5x_A* 3db6_A* 3dbe_A* 3dbf_A* | Back alignment and structure |
|---|
| >3op5_A Serine/threonine-protein kinase VRK1; adenosine triphosphate, amino acid sequence, binding sites, domain, models, molecular; HET: REB; 2.40A {Homo sapiens} PDB: 2lav_A 2kty_A 2kul_A | Back alignment and structure |
|---|
| >1qpc_A LCK kinase; alpha beta fold, transferase; HET: PTR ANP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1qpe_A* 1qpj_A* 2pl0_A* 3kxz_A* 3ac1_A* 2zm4_A* 2zyb_A* 2zm1_A* 3ac2_A* 3ac3_A* 3ac4_A* 3ac5_A* 3ac8_A* 3acj_A* 3ack_A* 3ad4_A* 3ad5_A* 3ad6_A* 3kmm_A* 1qpd_A* ... | Back alignment and structure |
|---|
| >3lxp_A Non-receptor tyrosine-protein kinase TYK2; JAK3, inflammation, cancer, PAN inhibitor, ATP-binding nucleotide-binding, phosphoprotein, SH2 domain; HET: PTR IZA; 1.65A {Homo sapiens} PDB: 3lxn_A* 3nz0_A* 3nyx_A* 4e20_A* 4e1z_A* | Back alignment and structure |
|---|
| >4eqm_A Protein kinase; transferase; HET: ANP; 3.00A {Staphylococcus aureus subsp} | Back alignment and structure |
|---|
| >2xir_A Vascular endothelial growth factor receptor 2; angiogenesis, nucleotide-binding, inhibitor, phosphorylation receptor, transferase, transmembrane; HET: 00J; 1.50A {Homo sapiens} PDB: 1vr2_A* 1ywn_A* 3vnt_A* 3c7q_A* 2oh4_A* 3u6j_A* 3efl_A* 2p2i_A* 3cjf_A* 3cjg_A* 3ewh_A* 2qu5_A* 2qu6_A* 2rl5_A* 3b8q_A* 3b8r_A* 2p2h_A* 3cp9_A* 3cpb_A* 3cpc_A* ... | Back alignment and structure |
|---|
| >2xrw_A Mitogen-activated protein kinase 8; transcription, MAPK signaling pathways, linear binding motif; HET: ANP; 1.33A {Homo sapiens} PDB: 1ukh_A 1uki_A* 2xs0_A* 3elj_A* 2h96_A* 2gmx_A* 2g01_A* 2no3_A* 3o2m_A* 3o17_A* 3pze_A* 3g9l_X* 2p33_A* 3cgf_A* 3cgo_A* 3g90_X* 2ok1_A* 3g9n_A* 1pmn_A* 1pmq_A* ... | Back alignment and structure |
|---|
| >3fme_A Dual specificity mitogen-activated protein kinase; active mutant, structural genomics consortium, SCG, binding, nucleotide-binding, phosphoprotein; HET: STU; 2.26A {Homo sapiens} PDB: 3enm_A | Back alignment and structure |
|---|
| >2ivs_A Proto-oncogene tyrosine-protein kinase receptor RET; nucleotide-binding, hirschsprung disease, phosphorylation, disease mutation; HET: ACK; 2.00A {Homo sapiens} PDB: 2ivt_A* 2ivu_A* 2x2k_A* 2x2l_A* 2x2m_A* 2ivv_A* | Back alignment and structure |
|---|
| >2iwi_A Serine/threonine-protein kinase PIM-2; nucleotide-binding, cancer, leukemia, transferase, ATP-binding, proto- oncogene, phosphorylation; HET: HB1; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >3cok_A Serine/threonine-protein kinase PLK4; POLO-like kinase 4, SAK, STK18, PSI, structural genomics, protein structure initiative; HET: ANP; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >2h34_A Serine/threonine-protein kinase PKNE; apoenzyme, transferase; 2.80A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3eqc_A Dual specificity mitogen-activated protein kinase; MEK1 kinase, ATP-binding, disease mutation, nucleoti binding, phosphoprotein; HET: 3BM AGS; 1.80A {Homo sapiens} PDB: 3eqd_A* 3eqf_A* 3eqg_A* 3eqh_A* 3eqi_A* 2y4i_C* 3eqb_A* 2p55_A* 1s9j_A* 3dy7_A* 3e8n_A* 3v01_A* 3v04_A* 3dv3_A* 3mbl_A* 3pp1_A* 3orn_A* 3os3_A* 3sls_A* 1s9i_A* ... | Back alignment and structure |
|---|
| >3kn6_A Ribosomal protein S6 kinase alpha-5; AMP-PNP, MSK1, MSK, ATP-binding, metal-binding, NUCL binding, serine/threonine-protein kinase, transferase; 2.00A {Homo sapiens} PDB: 3kn5_A | Back alignment and structure |
|---|
| >4ejn_A RAC-alpha serine/threonine-protein kinase; AKT1, autoinhibition, allosteric inhibitor, kinase inhibitor hydrophobic collapase, ATPase; HET: 0R4; 2.19A {Homo sapiens} PDB: 3o96_A* | Back alignment and structure |
|---|
| >1phk_A Phosphorylase kinase; glycogen metabolism, transferase, serine/threonine-protein, ATP-binding, calmodulin-binding; HET: ATP; 2.20A {Oryctolagus cuniculus} SCOP: d.144.1.7 PDB: 1ql6_A* 2phk_A* | Back alignment and structure |
|---|
| >1t46_A HOMO sapiens V-KIT hardy-zuckerman 4 feline sarcoma viral oncogene homolog; kinase, structure, inhibitor, STI-571, gleevec, transferase activator; HET: STI; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1pkg_A* 1t45_A 3g0e_A* 3g0f_A* | Back alignment and structure |
|---|
| >1rjb_A FL cytokine receptor; kinase, structure, autoinhibition, juxtamembrane domain, transferase; 2.10A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3ttj_A Mitogen-activated protein kinase 10; JNK3, protein kinase in transferase-transferase inhibitor complex; HET: JBI; 2.10A {Homo sapiens} PDB: 3tti_A* 1jnk_A* | Back alignment and structure |
|---|
| >2wei_A Calmodulin-domain protein kinase 1, putative; nucleotide-binding, serine/threonine-protein kinase, CGD3_920, transferase; HET: VGG; 1.65A {Cryptosporidium parvum iowa II} PDB: 3dfa_A 3ma6_A* | Back alignment and structure |
|---|
| >3c1x_A Hepatocyte growth factor receptor; receptor tyrosine kinase, signal transduction, GRB2, SHC, ATP-binding, glycoprotein, membrane; HET: CKK; 2.17A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4hcu_A Tyrosine-protein kinase ITK/TSK; transferase-transferase inhibitor complex; HET: 13L; 1.43A {Homo sapiens} PDB: 4hct_A* 4hcv_A* 3t9t_A* 1sm2_A* 1snu_A* 1snx_A 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >1xjd_A Protein kinase C, theta type; PKC-theta, ATP, AMP,, transferase; HET: TPO SEP STU; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 2jed_A* | Back alignment and structure |
|---|
| >3a99_A Proto-oncogene serine/threonine-protein kinase PI; PIM-1, P27KIP1, peptide drug, prostate cancer, transferase; HET: ANP; 1.60A {Homo sapiens} PDB: 3bgq_A* 3bgp_A* 2obj_A* 3bgz_A* 3t9i_A* 3dcv_A* 1xws_A* 2xj1_A* 2xix_A* 2xiz_A* 2xj0_A* 2xiy_A* 2xj2_A* 3f2a_A* 1xr1_A* 1xqz_A* 3cy2_A* 3cxw_A* 3cy3_A* 2bik_B* ... | Back alignment and structure |
|---|
| >2bdw_A Hypothetical protein K11E8.1D; kinase, calmodulin activated, transferase; 1.80A {Caenorhabditis elegans} PDB: 2wel_A* 2v7o_A* 2vz6_A* 1cdm_B 1cm1_B 1cm4_B | Back alignment and structure |
|---|
| >2yab_A Death-associated protein kinase 2; apoptosis, transferase; HET: AMP; 1.90A {Mus musculus} PDB: 2yaa_A* 2ya9_A* | Back alignment and structure |
|---|
| >1byg_A CSK, protein (C-terminal SRC kinase); protein kinase, phosphorylation, staurosporine, transferase; HET: STU; 2.40A {Homo sapiens} SCOP: d.144.1.7 PDB: 3d7u_A 3d7t_A* | Back alignment and structure |
|---|
| >3cc6_A Protein tyrosine kinase 2 beta; focal adhesion kinase, structural genomics, structural genom consortium, SGC, ATP-binding, membrane; 1.60A {Homo sapiens} PDB: 3fzs_A* 3et7_A 3fzo_A* 3fzr_A* 3fzp_A* 3fzt_A* 3h3c_A* | Back alignment and structure |
|---|
| >3nyv_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, EF hand, bumped kinase inhibitor; HET: MSE DTQ; 1.88A {Toxoplasma gondii} PDB: 3i79_A* 3i7b_A* 3n51_A* 3i7c_A* 3sx9_A* 3sxf_A* 3t3u_A* 3t3v_A* 3upx_A* 3upz_A* 3v51_A* 3v5p_A* 3v5t_A* 3ku2_A* 3hx4_A* | Back alignment and structure |
|---|
| >1q8y_A SR protein kinase; transferase; HET: ADP ADE; 2.05A {Saccharomyces cerevisiae} SCOP: d.144.1.7 PDB: 1q8z_A 1q97_A* 1q99_A* 1how_A 2jd5_A | Back alignment and structure |
|---|
| >2vgo_A Serine/threonine-protein kinase 12-A; nucleotide-binding, serine/threonine-protein kinase, ATP-binding, transferase, coiled coil, cell division, kinase; HET: TPO AD5; 1.7A {Xenopus laevis} PDB: 2bfx_A* 2vgp_A* 3ztx_A* 2vrx_A* 2bfy_A* 4af3_A* 3dj6_A* 3d15_A* 3d2i_A* 3d2k_A* 3d14_A* 3dj5_A* 3dj7_A* 3daj_A* 1ol5_A* 1ol7_A* 2x6d_A* 2x6e_A* 2xng_A* 2dwb_A* ... | Back alignment and structure |
|---|
| >2a2a_A Death-associated protein kinase 2; autoinhibition, transferase; 1.47A {Homo sapiens} PDB: 2cke_A* 1wmk_A 1z9x_A 2a27_A 2x0g_A 2xuu_A* 2w4k_A* 2xzs_A | Back alignment and structure |
|---|
| >2pvf_A Fibroblast growth factor receptor 2; kinase domain fold consisting of N- and C-lobes, transferase; HET: PTR ACP; 1.80A {Homo sapiens} PDB: 3cly_A* 2pzr_A* 2pzp_A* 2pvy_A* 2pz5_A* 2q0b_A* 2pwl_A* 2py3_A* 3ri1_A* 1gjo_A 1oec_A* 3b2t_A* 3gql_A* 3gqi_A* 1fgk_A 1fgi_A* 1agw_A 2fgi_A* 3js2_A* 3ky2_A ... | Back alignment and structure |
|---|
| >1z57_A Dual specificity protein kinase CLK1; protein tyrosine kinase, splicing, human, 10Z-hymendialdisine, structural genomics; HET: DBQ; 1.70A {Homo sapiens} PDB: 2vag_A* | Back alignment and structure |
|---|
| >3sxs_A Cytoplasmic tyrosine-protein kinase BMX; transferase-transferase inhibitor complex; HET: PP2; 1.89A {Homo sapiens} SCOP: d.144.1.7 PDB: 3sxr_A* | Back alignment and structure |
|---|
| >3kex_A Receptor tyrosine-protein kinase ERBB-3; kinase domain, inactive kinase, HER3, ATP-binding, cell membrane, membrane, nucleotide-binding; HET: ANP; 2.80A {Homo sapiens} PDB: 3lmg_A* | Back alignment and structure |
|---|
| >3f66_A Hepatocyte growth factor receptor; C-Met, protein kinase, quinoxaline, alternative splicing, ATP-binding, chromosomal rearrangement; HET: IHX; 1.40A {Homo sapiens} PDB: 3i5n_A* 3u6h_A* 3u6i_A* 4deg_A* 4deh_A* 4dei_A* 3ccn_A* 2rfn_A* 2rfs_A* 3cd8_A* 3efj_A* 3efk_A* 3lq8_A* 3zxz_A* 2wkm_A* 2wgj_A* 3zze_A* 4aoi_A* 4ap7_A* 3q6w_A* ... | Back alignment and structure |
|---|
| >3tt0_A Basic fibroblast growth factor receptor 1; kinase domain, transferase, transferase-transferase inhibito; HET: 07J; 2.80A {Homo sapiens} | Back alignment and structure |
|---|
| >1mp8_A Focal adhesion kinase 1; tyrosine protein kinase, transferase; HET: ADP; 1.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 2ijm_A* 2etm_A* 3pxk_A* 2jkq_A* 2j0m_B* 2jkm_A* 2j0l_A* 3bz3_A* 2jko_A* 2jkk_A* | Back alignment and structure |
|---|
| >1zar_A RIO2 kinase; serine kinase, winged-helix, RIO domain, ADP-Mn complex, rRNA processing, transferase; HET: ADP; 1.75A {Archaeoglobus fulgidus} SCOP: a.4.5.56 d.144.1.9 PDB: 1tqi_A* 1tqp_A* 1tqm_A* 1zao_A* | Back alignment and structure |
|---|
| >4fr4_A YANK1, serine/threonine-protein kinase 32A; structural genomics, structural genomics consortium, SGC, TR; HET: STU; 2.29A {Homo sapiens} | Back alignment and structure |
|---|
| >3c4z_A Rhodopsin kinase; Ser/Thr kinase, RGS homology domain, G protein coupled recep kinase, GRK, GRK1, P-loop, autophosphoryl ADP, ATP-binding; HET: ADP; 1.84A {Bos taurus} PDB: 3c4x_A* 3c4y_A 3c4w_A* 3c50_A* 3c51_A* 3qc9_A* 2i94_B | Back alignment and structure |
|---|
| >3fhr_A MAP kinase-activated protein kinase 3; kinase-inhibitor complex, ATP-binding, cytoplasm, nucleotide-binding, nucleus, phosphoprotein, polymorphism; HET: P4O; 1.90A {Homo sapiens} PDB: 3fxw_A* 3r1n_A* 3she_A* 2oza_A 3fyk_X* 3fyj_X* 2p3g_X* 3ka0_A* 3fpm_A* 2pzy_A* 3a2c_A* 3kc3_A* 3gok_A* 2jbo_A* 2jbp_A* 3r2y_A* 3r30_A* 3r2b_A* | Back alignment and structure |
|---|
| >3h4j_B AMPK kdaid, SNF1-like protein kinase SSP2; ATP-binding, nucleotide-binding, phosphoprotei serine/threonine-protein kinase, transferase; 2.80A {Schizosaccharomyces pombe} | Back alignment and structure |
|---|
| >2owb_A Serine/threonine-protein kinase PLK1; catalytic domain, POLO-like kinase1, transfera; HET: 626; 2.10A {Homo sapiens} PDB: 2ou7_A* 3fc2_A* 3thb_A* | Back alignment and structure |
|---|
| >2h6d_A 5'-AMP-activated protein kinase catalytic subunit alpha-2; ATP-binding, cholesterol biosynthesis, fatty acid biosynthesis;kinase, lipid synthesis; 1.85A {Homo sapiens} PDB: 3aqv_A* 2yza_A* | Back alignment and structure |
|---|
| >1rdq_E PKA C-alpha, CAMP-dependent protein kinase, alpha-catalytic SU; CAMP-dependent protein kinase,catalytic mechanism, ATP hydro two nucleotide states; HET: TPO SEP ADP ATP; 1.26A {Mus musculus} SCOP: d.144.1.7 PDB: 2erz_E* 3fjq_E* 1bkx_A* 1atp_E* 1fmo_E* 1j3h_A* 1jlu_E* 1bx6_A* 1re8_A* 1rej_A* 1rek_A* 2cpk_E* 2qcs_A* 2qvs_E* 1l3r_E* 3idb_A* 3idc_A* 3o7l_D* 3ow3_A* 3tnp_C* ... | Back alignment and structure |
|---|
| >3c0i_A Peripheral plasma membrane protein CASK; neurexin, Ca2+/calmodulin dependent protein kinase, Mg synaptic plasticity, pseudokinase, maguk; HET: 3AM; 1.85A {Homo sapiens} PDB: 3c0h_A* 3c0g_A* 3mfr_A* 3mfs_A* 3mft_A 3mfu_A* 3tac_A | Back alignment and structure |
|---|
| >3og7_A AKAP9-BRAF fusion protein; proto-oncogene, V600E, kinase, transferase; HET: 032; 2.45A {Homo sapiens} SCOP: d.144.1.7 PDB: 4fk3_A* 3c4c_A* 3c4d_A* 3idp_A* 4g9r_A* 3ii5_A* 4e26_A* 3ppj_A* 3ppk_A* 3prf_A* 3pri_A* 3psb_A* 3psd_A* 3q4c_A* 3skc_A* 3tv4_A* 3tv6_A* 3d4q_A* 4e4x_A* 4g9c_A* ... | Back alignment and structure |
|---|
| >2pml_X PFPK7, Ser/Thr protein kinase; phosphorylati transferase, transferase; HET: ANP; 2.60A {Plasmodium falciparum} PDB: 2pmn_X* 2pmo_X* | Back alignment and structure |
|---|
| >4euu_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: SEP BX7; 1.80A {Homo sapiens} | Back alignment and structure |
|---|
| >2yfx_A Tyrosine-protein kinase receptor; nucleotide-binding, transferase; HET: VGH; 1.70A {Homo sapiens} PDB: 2xp2_A* 3aox_A* 2yhv_A 3lcs_A* 3lct_A* 4dce_A* 2xba_A* 2xb7_A* | Back alignment and structure |
|---|
| >2izr_A Casein kinase I isoform gamma-3; serine/threonine-protein kinase, transferase, ATP- binding, phosphorylation, nucleotide-binding; HET: BRK; 1.3A {Homo sapiens} PDB: 2izs_A* 2izt_A* 2izu_A* 2chl_A* 2c47_A* 2cmw_A* | Back alignment and structure |
|---|
| >2acx_A G protein-coupled receptor kinase 6; GRK, G transferase; HET: ANP; 2.60A {Homo sapiens} PDB: 3nyn_A* 3nyo_A* | Back alignment and structure |
|---|
| >3v5w_A G-protein coupled receptor kinase 2; inhibitor complex, protein kinase, beta propeller, RGS homol domain; HET: 8PR; 2.07A {Homo sapiens} PDB: 3cik_A* 3krw_A* 3krx_A* 1omw_A 1ym7_A 2bcj_A* 3uzs_A 3uzt_A 3pvu_A* 3psc_A* 3pvw_A* 1bak_A | Back alignment and structure |
|---|
| >3mwu_A Calmodulin-domain protein kinase 1; serine/threonine protein kinase, transferase, calcium-bindin binding, bumped kinase inhibitor, BKI; HET: BK3; 1.98A {Cryptosporidium parvum} PDB: 3igo_A* 3ncg_A* | Back alignment and structure |
|---|
| >2dyl_A Dual specificity mitogen-activated protein kinase kinase 7; MKK7, activated mutant, ATP-binding, structural genomics, NPPSFA; 2.45A {Homo sapiens} | Back alignment and structure |
|---|
| >3txo_A PKC-L, NPKC-ETA, protein kinase C ETA type; phosphotransferase, transferase-transferase inhibito; HET: TPO 07U; 2.05A {Homo sapiens} | Back alignment and structure |
|---|
| >3q5i_A Protein kinase; CDPK, malaria, phosphotransferase, structural genomics, structural genomic consortium, SGC, transferase; HET: ANP; 2.10A {Plasmodium berghei} | Back alignment and structure |
|---|
| >3g2f_A Bone morphogenetic protein receptor type-2; kinase, structural genomics, structural genomics consortium, ATP-binding, disease mutation; HET: ADP; 2.35A {Homo sapiens} | Back alignment and structure |
|---|
| >3s95_A LIMK-1, LIM domain kinase 1; structural genomics, structural genomics consortium, SGC, PR kinase, transferase-antibiotic complex; HET: STU GOL; 1.65A {Homo sapiens} | Back alignment and structure |
|---|
| >2eu9_A Dual specificity protein kinase CLK3; kinase domain, transferase; 1.53A {Homo sapiens} PDB: 2wu6_A* 2wu7_A* 3raw_A* 2exe_A 3nr9_A* | Back alignment and structure |
|---|
| >2y4i_B KSR2, HKSR2, kinase suppressor of RAS 2; transferase, KSR1; HET: ATP; 3.46A {Homo sapiens} | Back alignment and structure |
|---|
| >2qr7_A Ribosomal protein S6 kinase alpha-3; kinase domain, RSK2, autoinhibitory, ATP-binding, nucleotide phosphorylation, serine/threonine-protein kinase; 2.00A {Mus musculus} PDB: 2qr8_A 4d9t_A* 4d9u_A* 3rny_A 2wnt_A | Back alignment and structure |
|---|
| >3lzb_A Epidermal growth factor receptor; epidermal growth factor kinase domain, multitargeted small M kinase inhibitor; HET: ITI; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >3dls_A PAS domain-containing serine/threonine-protein KI; PAS kinase, PASK, protein kinase, drug discovery, ATP-bindin kinase, nucleotide-binding; HET: ADP; 2.30A {Homo sapiens} | Back alignment and structure |
|---|
| >3lij_A Calcium/calmodulin dependent protein kinase with A kinase domain and 4 calmodulin...; transferase, calcium dependent protein kinase; HET: ANP; 1.90A {Cryptosporidium parvum} PDB: 3hzt_A* 3dxn_A 3l19_A* | Back alignment and structure |
|---|
| >4e7w_A Glycogen synthase kinase 3; GSK3, PTyr195, transferase; HET: PTR; 3.30A {Ustilago maydis} | Back alignment and structure |
|---|
| >2rio_A Serine/threonine-protein kinase/endoribonuclease IRE1; protein-nucleotide complex, ATP-binding, endoplasmic reticulum, glycoprotein; HET: ADP; 2.40A {Saccharomyces cerevisiae} PDB: 3lj0_A* 3lj1_A* 3lj2_A* 3fbv_A* 3sdm_A* 3sdj_A* | Back alignment and structure |
|---|
| >1fvr_A Tyrosine-protein kinase TIE-2; tyrosine kinase, transferase; 2.20A {Homo sapiens} SCOP: d.144.1.7 PDB: 2oo8_X* 2osc_A* 2p4i_A* 3l8p_A* 2wqb_A* | Back alignment and structure |
|---|
| >3hko_A Calcium/calmodulin-dependent protein kinase with domain and 2 calmodulin-like EF...; structural genomics, protist parasite; HET: ANP; 1.80A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >3i6u_A CDS1, serine/threonine-protein kinase CHK2; Ser/Thr protein kinase, FHA domain, ATP-binding, cell cycle, mutation, LI-fraumeni syndrome, magnesium; 3.00A {Homo sapiens} PDB: 3i6w_A | Back alignment and structure |
|---|
| >4hgt_A Casein kinase I isoform delta; CK1D, inhibitor, transferase-transferase inhibitor C; HET: 15G; 1.80A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 3uzp_A* 4hnf_A* 1cki_A 1ckj_A 4hni_A* 4hok_A | Back alignment and structure |
|---|
| >3uzp_A CKI-delta, CKID, casein kinase I isoform delta; CK1D, inhibitor, PF670462, transferase-transferase I complex; HET: 0CK; 1.94A {Homo sapiens} PDB: 3uys_A* 3uyt_A* 1cki_A 1ckj_A | Back alignment and structure |
|---|
| >1vzo_A Ribosomal protein S6 kinase alpha 5; protein kinase, transferase, phosphorylation, serine/threonine protein kinase; 1.8A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} | Back alignment and structure |
|---|
| >1csn_A Casein kinase-1; phosphotransferase; HET: ATP; 2.00A {Schizosaccharomyces pombe} SCOP: d.144.1.7 PDB: 1eh4_A* 2csn_A* | Back alignment and structure |
|---|
| >3tki_A Serine/threonine-protein kinase CHK1; cell checkpoint, transferase-transferase inhib complex; HET: S25; 1.60A {Homo sapiens} PDB: 2qhm_A* 2r0u_A* 3tkh_A* 2qhn_A* 2hy0_A* 2hog_A* 2hxq_A* 2hxl_A* 3f9n_A* | Back alignment and structure |
|---|
| >2i0e_A Protein kinase C-beta II; serine/threonine protein kinase, transferase; HET: TPO SEP PDS; 2.60A {Homo sapiens} PDB: 3iw4_A* | Back alignment and structure |
|---|
| >2a19_B Interferon-induced, double-stranded RNA-activated kinase; transferase, protein biosynthesis, protein synthesis transferase complex; HET: TPO ANP; 2.50A {Homo sapiens} PDB: 2a1a_B* | Back alignment and structure |
|---|
| >1ua2_A CAK, cell division protein kinase 7; cell cycle, phosphorylation, protein-protein interaction, PR kinase, cell cycle, transferase; HET: TPO ATP; 3.02A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >2ycf_A Serine/threonine-protein kinase CHK2; transferase, anticancer, anticancer drug design; HET: YCF; 1.77A {Homo sapiens} PDB: 2yiq_A* 2w7x_A* 2ycq_A* 2ycs_A* 2w0j_A* 2yir_A* 2yit_A* 2wtj_A* 2cn8_A* 2wtc_A* 2wtd_A* 2wti_A* 2cn5_A* 2xbj_A* 2xm8_A* 2xm9_A* 2xk9_A* 2ycr_A* | Back alignment and structure |
|---|
| >3soa_A Calcium/calmodulin-dependent protein kinase type alpha with A beta 7 linker; phosphorylation, cytosolic, transferase-transferase inhibitor complex; HET: DB8; 3.55A {Homo sapiens} | Back alignment and structure |
|---|
| >3t9t_A Tyrosine-protein kinase ITK/TSK; kinase domain, alpha/beta, ATP binding, phosphorylation, intracellular, transferase-transferase inhibitor complex; HET: IAQ; 1.65A {Homo sapiens} PDB: 3v5l_A* 3v5j_A* 3v8t_A* 3v8w_A* 1sm2_A* 1snu_A* 1snx_A 3qgw_A* 3qgy_A* 3miy_A* 3mj1_A* 3mj2_A* | Back alignment and structure |
|---|
| >4gyi_A RIO2 kinase; protein kinase, ADP complex, phosphoaspartate, acyl-phosphat ribosome biogenesis, Ser/Thr protein kinase; HET: PHD ADP; 2.20A {Chaetomium thermophilum} PDB: 4gyg_A | Back alignment and structure |
|---|
| >2i6l_A Mitogen-activated protein kinase 6; MAPK6, ERK3, extracellular signal regulated kinase 3, serine phosphorylation, threonine phosphorylation; 2.25A {Homo sapiens} | Back alignment and structure |
|---|
| >3mdy_A Bone morphogenetic protein receptor type-1B; complex (isomerase-protein kinase), receptor serine/threonin structural genomics consortium, SGC; HET: LDN; 2.05A {Homo sapiens} SCOP: d.144.1.7 | Back alignment and structure |
|---|
| >3kmu_A ILK, integrin-linked kinase; cell adhesion, ANK repeat, ATP-binding, cell junction, cell membrane, integrin-binding protein, membrane, nucleotide- binding; 1.80A {Homo sapiens} SCOP: d.144.1.0 PDB: 3kmw_A* 3rep_A* | Back alignment and structure |
|---|
| >3sv0_A Casein kinase I-like; typical kinase domain fold, cytosol, transferase; 2.00A {Oryza sativa japonica group} | Back alignment and structure |
|---|
| >1u46_A ACK-1, activated CDC42 kinase 1; tyrosine kinase, transferase; 2.00A {Homo sapiens} SCOP: d.144.1.7 PDB: 1u4d_A* 1u54_A* 3eqr_A* 3eqp_B* | Back alignment and structure |
|---|
| >2y94_A 5'-AMP-activated protein kinase catalytic subunit; transferase, nucleotide-binding, staurosporine-binding, serine/threonine-protein kinase; HET: TPO STU AMP; 3.24A {Rattus norvegicus} | Back alignment and structure |
|---|
| >3gni_B Strad alpha; kinase fold, pseudokinase, alpha helical repeat protein, ADA protein, ATP-binding, cell cycle, kinase, nucleotide-bindin nucleus; HET: ATP CIT; 2.35A {Homo sapiens} PDB: 2wtk_B* | Back alignment and structure |
|---|
| >2y7j_A Phosphorylase B kinase gamma catalytic chain, testis/liver isoform; transferase; HET: B49; 2.50A {Homo sapiens} PDB: 1h0t_A 1lp1_B 1q2n_A 2spz_A 3mzw_B* 1ss1_A 2jwd_A 1bdc_A 1bdd_A 1fc2_C* 2b87_A 2b88_A 1h0t_B 1lp1_A 2b87_B 2b89_A 3s1k_A | Back alignment and structure |
|---|
| >1nxk_A MAP kinase-activated protein kinase 2; MK2, phosphorylation, staurosporine, transfe; HET: STU; 2.70A {Homo sapiens} SCOP: d.144.1.7 PDB: 1kwp_A* 1ny3_A* 2onl_C | Back alignment and structure |
|---|
| >3a62_A Ribosomal protein S6 kinase beta-1; kinase domain, inactive, active, ribosomal S6 kinase, activation, alternative initiation, ATP-binding; HET: TPO STU; 2.35A {Homo sapiens} PDB: 3a61_A* 3a60_A* | Back alignment and structure |
|---|
| >3f3z_A Calcium/calmodulin-dependent protein kinase with domain and 4 calmodulin like EF...; calcium dependent protein kinase; HET: SEP DRK; 1.84A {Cryptosporidium parvum iowa II} PDB: 2qg5_A* | Back alignment and structure |
|---|
| >3oz6_A Mitogen-activated protein kinase 1, serine/threon protein kinase; structural genomics consortium, SGC, transferase; 2.37A {Cryptosporidium parvum iowa II} | Back alignment and structure |
|---|
| >1b6c_B TGF-B superfamily receptor type I; complex (isomerase/protein kinase), receptor serine/threonine kinase; 2.60A {Homo sapiens} SCOP: d.144.1.7 PDB: 1ias_A 2x7o_A* 3faa_A* 3kcf_A* | Back alignment and structure |
|---|
| >2ks1_B Epidermal growth factor receptor; ERBB1, ERBB2, transmembrane, heterodimer, complex, tyrosine receptor, bicelles, transferase; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >3m2w_A MAP kinase-activated protein kinase 2; small molecule inhibitor, spiroazetidine-tetracycle, ATP-SIT inhibitor, novartis compound NVP-BXS169; HET: L8I; 2.41A {Homo sapiens} PDB: 3kga_A* 3m42_A* | Back alignment and structure |
|---|
| >3pfq_A PKC-B, PKC-beta, protein kinase C beta type; phosphorylation, transferase; HET: TPO SEP ANP; 4.00A {Rattus norvegicus} PDB: 1tbn_A 1tbo_A 2e73_A | Back alignment and structure |
|---|
| >2yex_A Serine/threonine-protein kinase CHK1; transferase, cell cycle; HET: YEX; 1.30A {Homo sapiens} PDB: 2x8e_A* 2ydk_A* 2ydj_A* 2yer_A* 2ydi_A* 1nvq_A* 1nvr_A* 1nvs_A* 2wmq_A* 2wmr_A* 2wms_A* 2wmt_A* 2wmu_A* 2wmv_A* 2wmw_A* 2wmx_A* 2x8d_A* 2x8i_A* 2xey_A* 2xez_A* ... | Back alignment and structure |
|---|
| >1zth_A RIO1 serine protein kinase; ribosome biogenesis, rRNA, ADP, manganese, transferase; HET: ADP; 1.89A {Archaeoglobus fulgidus} PDB: 1zp9_A* 1ztf_A* | Back alignment and structure |
|---|
| >2jam_A Calcium/calmodulin-dependent protein kinase type 1G; transferase, kinase, membrane, ATP-binding, prenylation, serine/threonine-protein kinase, alternative splicing; HET: J60; 1.7A {Homo sapiens} PDB: 2jc6_A* 1a06_A | Back alignment and structure |
|---|
| >2jii_A Serine/threonine-protein kinase VRK3 molecule: VA related kinase 3; transferase, pseudo kinase domain, vaccinia related kinase, ATP-binding; 2.00A {Homo sapiens} | Back alignment and structure |
|---|
| >2pzi_A Probable serine/threonine-protein kinase PKNG; ATP-recognition, kinase-INH complex, rubredoxin fold, TPR domain, transferase; HET: AXX; 2.40A {Mycobacterium tuberculosis} | Back alignment and structure |
|---|
| >3p23_A Serine/threonine-protein kinase/endoribonuclease; kinase domain, kinase and RNAse function, ATP binding ssRNA dephosphorylated, hydrolase; HET: ADP; 2.70A {Homo sapiens} | Back alignment and structure |
|---|
| >2l2t_A Receptor tyrosine-protein kinase ERBB-4; transmembrane dimer, membrane domain, membrane protei; NMR {Homo sapiens} | Back alignment and structure |
|---|
| >2v62_A Serine/threonine-protein kinase VRK2; transferase, ATP-binding, membrane, nucleotide-binding, TRAN; 1.7A {Homo sapiens} | Back alignment and structure |
|---|
| >2j0j_A Focal adhesion kinase 1; cell migration, FERM, transferase, integrin signaling; HET: 4ST; 2.80A {Gallus gallus} PDB: 2j0k_A* | Back alignment and structure |
|---|
| >3qa8_A MGC80376 protein; kinase ubiquitin-like domain, phosphorylation, kinase domain ubiquitin-like domain, kinase, substrate binding; 3.60A {Xenopus laevis} PDB: 3qad_A* 3rzf_A* | Back alignment and structure |
|---|
| >3en9_A Glycoprotease, O-sialoglycoprotein endopeptidase/protein kinase; endopeptidase activity, protein kinase activity; HET: TBR; 2.67A {Methanocaldococcus jannaschii} PDB: 3enh_A* 2vwb_A* | Back alignment and structure |
|---|
Homologous Structure Domains
Structure Domains Detected by RPS-BLAST
Original result of RPS-BLAST against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
E-value |
| 413 | ||||
| d1hqla_ | 236 | b.29.1.1 (A:) Legume lectin {Griffonia simplicifol | 2e-41 | |
| d1leda_ | 243 | b.29.1.1 (A:) Legume lectin {West-central african | 1e-38 | |
| d1gzca_ | 239 | b.29.1.1 (A:) Legume lectin {Cockspur coral tree ( | 2e-38 | |
| d2d3sa1 | 237 | b.29.1.1 (A:1-237) Legume lectin {Winged bean (Pso | 3e-38 | |
| g1qmo.1 | 230 | b.29.1.1 (A:,E:) Legume lectin {Field bean (Dolich | 2e-36 | |
| d1g8wa_ | 233 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 4e-36 | |
| d1f9ka_ | 234 | b.29.1.1 (A:) Legume lectin {Winged bean (Psophoca | 5e-36 | |
| d1fnya_ | 237 | b.29.1.1 (A:) Legume lectin {Black locust (Robinia | 3e-35 | |
| d1g9fa_ | 251 | b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) | 3e-35 | |
| d1v6ia_ | 232 | b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypog | 8e-35 | |
| d1fx5a_ | 240 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 1e-34 | |
| d1ukga_ | 241 | b.29.1.1 (A:) Legume lectin {Bloodwood tree (Ptero | 2e-34 | |
| d1g7ya_ | 253 | b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos | 8e-34 | |
| d1avba_ | 226 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 1e-33 | |
| d1qnwa_ | 237 | b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus | 1e-33 | |
| g2ltn.1 | 229 | b.29.1.1 (A:,B:) Legume lectin {Garden pea (Pisum | 1e-32 | |
| d1n47a_ | 233 | b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia vi | 2e-32 | |
| d1dbna_ | 239 | b.29.1.1 (A:) Legume lectin {Maackia amurensis, le | 4e-31 | |
| d1ioaa_ | 228 | b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also ar | 1e-28 | |
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 5e-22 | |
| d1nlsa_ | 237 | b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia | 7e-16 | |
| d1dhkb_ | 204 | b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also ar | 2e-21 | |
| d1gv9a_ | 228 | b.29.1.13 (A:) Carbohydrate-recognition domain of | 3e-19 | |
| d2a6va1 | 218 | b.29.1.13 (A:9-226) Emp46p N-terminal domain {Bake | 5e-12 | |
| d2a6za1 | 221 | b.29.1.13 (A:7-227) Emp47p N-terminal domain {Bake | 2e-10 |
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} Length = 236 | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Legume lectin species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]
Score = 144 bits (364), Expect = 2e-41
Identities = 74/246 (30%), Positives = 104/246 (42%), Gaps = 37/246 (15%)
Query: 36 FPDFSLHNNSKILHDLKLLGSAKLSNEKRVIQI-PDDSQATDLRHQAGRAIYSSPVRLLD 94
FP+F + G A + +Q+ + T L+ AGRA+YS PV+L D
Sbjct: 6 FPNFWSDVED----SIIFQGDANTTA--GTLQLCKTNQYGTPLQWSAGRALYSDPVQLWD 59
Query: 95 PVTKTPTSFETTFSFQFNTSNNTRTSRDGGSSLTFIIVPDEFTVGRAGPWLGVLNDACKD 154
T++ SF T F+F + N L F + P + V AG +LG+ N +
Sbjct: 60 NKTESVASFYTEFTFFLKITGNG-----PADGLAFFLAPPDSDVKDAGEYLGLFNKSTAT 114
Query: 155 DYKA---VAVKFDTCRDLEFGGPNDNHVGINLGSIVSTRAINASDVGIFLNDGSVHRAWI 211
VAV+FDT + F P+ H+GIN+ SIVS D IF G + A I
Sbjct: 115 QPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSIVSVATKRWEDSDIF--SGKIATARI 172
Query: 212 AYDGTRGWMDVRIGSDGRDYPSTKPTFS---------------GFSASTGNMT-QIHNLL 255
+YDG+ + V + + S G SASTGN +L
Sbjct: 173 SYDGSAEILTVVLSYPD----GSDYILSHSVDMRQNLPESVRVGISASTGNNQFLTVYIL 228
Query: 256 SWNFSS 261
SW FSS
Sbjct: 229 SWRFSS 234
|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} Length = 243 | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} Length = 239 | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} Length = 237 | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 233 | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} Length = 234 | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} Length = 237 | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} Length = 251 | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} Length = 232 | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} Length = 240 | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} Length = 241 | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} Length = 253 | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 226 | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} Length = 237 | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} Length = 233 | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} Length = 239 | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} Length = 228 | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} Length = 237 | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} Length = 204 | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 228 | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 218 | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 221 | Back information, alignment and structure |
|---|
Homologous Domains Detected by HHsearch
Original result of HHsearch against SCOP70(version1.75) database
| ID | Alignment Graph | Length |
Definition |
Probability |
| Query | 413 | |||
| d1hqla_ | 236 | Legume lectin {Griffonia simplicifolia, lectin I-b | 100.0 | |
| d1leda_ | 243 | Legume lectin {West-central african legume (Griffo | 100.0 | |
| d1gzca_ | 239 | Legume lectin {Cockspur coral tree (Erythrina cris | 100.0 | |
| d2d3sa1 | 237 | Legume lectin {Winged bean (Psophocarpus tetragono | 100.0 | |
| d1fx5a_ | 240 | Legume lectin {Furze (Ulex europaeus), UEA-I [TaxI | 100.0 | |
| d1qnwa_ | 237 | Legume lectin {Furze (Ulex europaeus), UEA-II [Tax | 100.0 | |
| d1g9fa_ | 251 | Legume lectin {Soybean (Glycine max) [TaxId: 3847] | 100.0 | |
| d1f9ka_ | 234 | Legume lectin {Winged bean (Psophocarpus tetragono | 100.0 | |
| d1g8wa_ | 233 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1g7ya_ | 253 | Legume lectin {Horse gram (Dolichos biflorus), dif | 100.0 | |
| d1v6ia_ | 232 | Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3 | 100.0 | |
| d1fnya_ | 237 | Legume lectin {Black locust (Robinia pseudoacacia) | 100.0 | |
| g1qmo.1 | 230 | Legume lectin {Field bean (Dolichos lablab), Fril | 100.0 | |
| d1dbna_ | 239 | Legume lectin {Maackia amurensis, leukoagglutinin | 100.0 | |
| d1n47a_ | 233 | Legume lectin {Hairy vetch (Vicia villosa), isolec | 100.0 | |
| g2ltn.1 | 229 | Legume lectin {Garden pea (Pisum sativum) [TaxId: | 100.0 | |
| d1ukga_ | 241 | Legume lectin {Bloodwood tree (Pterocarpus angolen | 100.0 | |
| d1avba_ | 226 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1ioaa_ | 228 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1dhkb_ | 204 | Phytohemagglutinin-L, PHA-L, also arcelin {Kidney | 100.0 | |
| d1gv9a_ | 228 | Carbohydrate-recognition domain of P58/ERGIC-53 {R | 99.95 | |
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 99.93 | |
| d1nlsa_ | 237 | Concanavalin A {Jack bean (Canavalia ensiformis) [ | 99.89 | |
| d2a6za1 | 221 | Emp47p N-terminal domain {Baker's yeast (Saccharom | 99.89 | |
| d2a6va1 | 218 | Emp46p N-terminal domain {Baker's yeast (Saccharom | 99.87 | |
| d1jpaa_ | 299 | ephb2 receptor tyrosine kinase {Mouse (Mus musculu | 97.81 | |
| d1opja_ | 287 | Abelsone tyrosine kinase (abl) {Mouse (Mus musculu | 97.45 | |
| d1mqba_ | 283 | epha2 receptor tyrosine kinase {Human (Homo sapien | 97.34 | |
| d1fmka3 | 285 | c-src tyrosine kinase {Human (Homo sapiens) [TaxId | 97.18 | |
| d1lufa_ | 301 | Musk tyrosine kinase {Rat (Rattus norvegicus) [Tax | 97.12 | |
| d1r0pa_ | 311 | Hepatocyte growth factor receptor, c-MET {Human (H | 97.05 | |
| d1u59a_ | 285 | Tyrosine-protein kinase ZAP-70 {Human (Homo sapien | 97.03 | |
| d2jfla1 | 288 | STE20-like serine/threonine-protein kinase, SLK {H | 96.88 | |
| d1u5ra_ | 309 | Serine/threonine protein kinase TAO2 {Rat (Rattus | 96.73 | |
| d1xkka_ | 317 | EGF receptor tyrosine kinase, Erbb-1 {Human (Homo | 96.72 | |
| d1qpca_ | 272 | Lymphocyte kinase (lck) {Human (Homo sapiens) [Tax | 96.69 | |
| d1yhwa1 | 293 | pak1 {Human (Homo sapiens) [TaxId: 9606]} | 96.68 | |
| d1fvra_ | 309 | Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | 96.62 | |
| d1p4oa_ | 308 | Insulin-like growth factor 1 receptor {Human (Homo | 96.52 | |
| d1t46a_ | 311 | c-KIT receptor {Human (Homo sapiens) [TaxId: 9606] | 96.4 | |
| d3blha1 | 318 | Cell division protein kinase 9, CDK9 {Human (Homo | 96.32 | |
| d1koaa2 | 350 | Twitchin, kinase domain {Caenorhabditis elegans, p | 96.24 | |
| d1xbba_ | 277 | Tyrosine-protein kinase SYK {Human (Homo sapiens) | 96.19 | |
| d1u46a_ | 273 | Activated CDC42 kinase 1, ACK1 {Human (Homo sapien | 96.16 | |
| d1q5ka_ | 350 | Glycogen synthase kinase-3 beta (Gsk3b) {Human (Ho | 96.14 | |
| d1jksa_ | 293 | Death-associated protein kinase, Dap {Human (Homo | 96.1 | |
| d1q8ya_ | 362 | Sky1p {Baker's yeast (Saccharomyces cerevisiae) [T | 96.01 | |
| d2b1pa1 | 355 | c-jun N-terminal kinase (jnk3s) {Human (Homo sapie | 95.98 | |
| d2gfsa1 | 348 | MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606] | 95.91 | |
| d3bqca1 | 328 | Protein kinase CK2, alpha subunit {Rattus norvegic | 95.91 | |
| d1koba_ | 352 | Twitchin, kinase domain {California sea hare (Aply | 95.88 | |
| d1cm8a_ | 346 | MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: | 95.77 | |
| d1ywna1 | 299 | Vascular endothelial growth factor receptor 2 (kdr | 95.58 | |
| d1t4ha_ | 270 | Protein kinase wnk1 {Human (Homo sapiens) [TaxId: | 95.58 | |
| d1rjba_ | 325 | Fl cytokine receptor {Human (Homo sapiens) [TaxId: | 95.55 | |
| d1a06a_ | 307 | Calmodulin-dependent protein kinase {Rat (Rattus n | 95.48 | |
| d1rdqe_ | 350 | cAMP-dependent PK, catalytic subunit {Mouse (Mus m | 95.46 | |
| d1ckia_ | 299 | Casein kinase-1, CK1 {Rat (Rattus norvegicus) [Tax | 95.39 | |
| d1fgka_ | 299 | Fibroblast growth factor receptor 1 {Human (Homo s | 95.38 | |
| d1pmea_ | 345 | MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606 | 95.27 | |
| d1o6ya_ | 277 | Mycobacterial protein kinase PknB, catalytic domai | 94.94 | |
| d1uu3a_ | 288 | 3-phosphoinositide dependent protein kinase-1 Pdk1 | 94.69 | |
| d1blxa_ | 305 | Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [T | 94.68 | |
| d1vzoa_ | 322 | Ribosomal protein S6 kinase alpha 5, Msk1 {Human ( | 94.35 | |
| d2ozaa1 | 335 | MAP kinase activated protein kinase 2, mapkap2 {Hu | 94.35 | |
| d1mp8a_ | 273 | Focal adhesion kinase 1 (fak) {Human (Homo sapiens | 93.67 | |
| d1uwha_ | 276 | B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | 84.91 |
| >d1hqla_ b.29.1.1 (A:) Legume lectin {Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]} | Back information, alignment and structure |
|---|
class: All beta proteins fold: Concanavalin A-like lectins/glucanases superfamily: Concanavalin A-like lectins/glucanases family: Legume lectins domain: Legume lectin species: Griffonia simplicifolia, lectin I-b4 [TaxId: 3850]
Probab=100.00 E-value=5.1e-52 Score=385.35 Aligned_cols=216 Identities=32% Similarity=0.485 Sum_probs=186.5
Q ss_pred ceeEEcCCCCCCCCcCcccCeEEecceEEeCCCCeEEcCCCCCCc-CCCCceEEEEecCceeecCCCCCCccceEEEEEE
Q 042239 31 RKHVFFPDFSLHNNSKILHDLKLLGSAKLSNEKRVIQIPDDSQAT-DLRHQAGRAIYSSPVRLLDPVTKTPTSFETTFSF 109 (413)
Q Consensus 31 ~~~f~~~~f~~~~~~~~~~~l~l~G~A~~~~~~~~i~LT~~~~~~-~~~~~~G~~~y~~pv~l~~~~~~~~~sF~t~F~f 109 (413)
+++|+|++|..+ +. ++|+|+|+|.+. ++.|+||+..... +...++|||+|++||+||++.+++++||+|+|+|
T Consensus 1 ~~sF~f~~F~~~-~~---~~l~l~G~A~~~--~~~l~LT~~~~~~~~~~~s~Gra~y~~Pv~l~~~~t~~~asFsT~F~F 74 (236)
T d1hqla_ 1 SVSFTFPNFWSD-VE---DSIIFQGDANTT--AGTLQLCKTNQYGTPLQWSAGRALYSDPVQLWDNKTESVASFYTEFTF 74 (236)
T ss_dssp CCEEEESCSCSC-GG---GTEEEEETCEEE--TTEEECSCBCTTSCBCSSCEEEEEESSCEECCCSTTCCCCEEEEEEEE
T ss_pred CEEEEeCCCCCC-Cc---CCEEEeccEEec--CCEEEEecCCCCCcccccceEEEEECCCEEeecCCCCceeEEEEEEEE
Confidence 479999999873 32 789999999998 8999999865321 2357899999999999999999999999999999
Q ss_pred EEecCCCCCCCCCCCCcEEEEEecCCCCCCCCCCccccccCCCCC---CCceEEEEeeecccCccCCCCCCceeEecCCC
Q 042239 110 QFNTSNNTRTSRDGGSSLTFIIVPDEFTVGRAGPWLGVLNDACKD---DYKAVAVKFDTCRDLEFGGPNDNHVGINLGSI 186 (413)
Q Consensus 110 ~i~~~~~~~~~~~~gdGlaF~l~~~~~~~~~~g~~lGl~~~~~~g---~~~~vAVEfDT~~n~~~~dp~~~Hvgi~~ns~ 186 (413)
+|... ...+||||||+|+|....++..|++||+++..+.+ .++.||||||||+|.+++||+++|||||+|++
T Consensus 75 ~i~~~-----~~~~gDGlAFvl~p~~~~~~~~G~~lGl~~~~~~~~~~~~~~vAVEFDT~~n~~~~D~~~nHIgIdvns~ 149 (236)
T d1hqla_ 75 FLKIT-----GNGPADGLAFFLAPPDSDVKDAGEYLGLFNKSTATQPSKNQVVAVEFDTWTNPNFPEPSYRHIGINVNSI 149 (236)
T ss_dssp EEEEC-----SSCCCCEEEEEEECTTCCCCCCGGGTTTSCTTTTTCGGGCCCEEEEEECSCCSSSCCCSSCEEEEEESSS
T ss_pred EEeCC-----CCCCCceEEEEEeCCCCCCCCCccccccccccccCCcccCceEEEEeeCccCCCCCCCCCCEEEEEcCCc
Confidence 99875 46789999999999888888999999999876543 48999999999999988999999999999999
Q ss_pred cccccccCCCCccccCCCCeEEEEEEEeCCCcEEEEEEEecCCCCCCCCCeee---------------eeeeecCCc-cc
Q 042239 187 VSTRAINASDVGIFLNDGSVHRAWIAYDGTRGWMDVRIGSDGRDYPSTKPTFS---------------GFSASTGNM-TQ 250 (413)
Q Consensus 187 ~s~~~~~~~~~~~~l~~g~~~~v~I~Y~~~~~~L~V~l~~~~~~~~~~~~~l~---------------GFsasTG~~-~~ 250 (413)
.|..+.++. ..+|.+|+.++|||+||+.+++|+|+|+ .. ++.+|+|+ |||||||.. .+
T Consensus 150 ~s~~~~~~~--~~~l~~G~~~~v~I~Yd~~~~~L~V~l~-~~---~~~~~~ls~~vdL~~~l~~~v~vGFSasTG~~~~~ 223 (236)
T d1hqla_ 150 VSVATKRWE--DSDIFSGKIATARISYDGSAEILTVVLS-YP---DGSDYILSHSVDMRQNLPESVRVGISASTGNNQFL 223 (236)
T ss_dssp SCSEEEECC--HHHHTSCSCEEEEEEEETTTTEEEEEEE-ET---TTEEEEEEEECCGGGTSCSEEEEEEEEECCSCCCE
T ss_pred ccccccccc--cccccCCCEEEEEEEEeCCCcEEEEEEe-cC---CCCCeeEEEEeCHHHhCCCcEEEEEEeECCCCCce
Confidence 988887764 3578999999999999999999999998 33 34455555 999999975 67
Q ss_pred eEeEEeeEEeeCC
Q 042239 251 IHNLLSWNFSSIS 263 (413)
Q Consensus 251 ~h~I~sWsf~~~~ 263 (413)
.|+|++|+|++++
T Consensus 224 ~h~I~sWsF~s~l 236 (236)
T d1hqla_ 224 TVYILSWRFSSNL 236 (236)
T ss_dssp EEEEEEEEEEEEC
T ss_pred EEEEEEeEeEecC
Confidence 8999999999863
|
| >d1leda_ b.29.1.1 (A:) Legume lectin {West-central african legume (Griffonia simplicifolia) [TaxId: 3850]} | Back information, alignment and structure |
|---|
| >d1gzca_ b.29.1.1 (A:) Legume lectin {Cockspur coral tree (Erythrina crista-galli) [TaxId: 49817]} | Back information, alignment and structure |
|---|
| >d2d3sa1 b.29.1.1 (A:1-237) Legume lectin {Winged bean (Psophocarpus tetragonolobus), basic agglutinin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1fx5a_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-I [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1qnwa_ b.29.1.1 (A:) Legume lectin {Furze (Ulex europaeus), UEA-II [TaxId: 3902]} | Back information, alignment and structure |
|---|
| >d1g9fa_ b.29.1.1 (A:) Legume lectin {Soybean (Glycine max) [TaxId: 3847]} | Back information, alignment and structure |
|---|
| >d1f9ka_ b.29.1.1 (A:) Legume lectin {Winged bean (Psophocarpus tetragonolobus), acidic lectin [TaxId: 3891]} | Back information, alignment and structure |
|---|
| >d1g8wa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1g7ya_ b.29.1.1 (A:) Legume lectin {Horse gram (Dolichos biflorus), different isoforms [TaxId: 3840]} | Back information, alignment and structure |
|---|
| >d1v6ia_ b.29.1.1 (A:) Legume lectin {Peanut (Arachis hypogaea) [TaxId: 3818]} | Back information, alignment and structure |
|---|
| >d1fnya_ b.29.1.1 (A:) Legume lectin {Black locust (Robinia pseudoacacia) [TaxId: 35938]} | Back information, alignment and structure |
|---|
| >d1dbna_ b.29.1.1 (A:) Legume lectin {Maackia amurensis, leukoagglutinin [TaxId: 37501]} | Back information, alignment and structure |
|---|
| >d1n47a_ b.29.1.1 (A:) Legume lectin {Hairy vetch (Vicia villosa), isolectin b4 [TaxId: 3911]} | Back information, alignment and structure |
|---|
| >d1ukga_ b.29.1.1 (A:) Legume lectin {Bloodwood tree (Pterocarpus angolensis) [TaxId: 182271]} | Back information, alignment and structure |
|---|
| >d1avba_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1ioaa_ b.29.1.1 (A:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris), G02771, arcelin-5a [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1dhkb_ b.29.1.1 (B:) Phytohemagglutinin-L, PHA-L, also arcelin {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]} | Back information, alignment and structure |
|---|
| >d1gv9a_ b.29.1.13 (A:) Carbohydrate-recognition domain of P58/ERGIC-53 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d1nlsa_ b.29.1.1 (A:) Concanavalin A {Jack bean (Canavalia ensiformis) [TaxId: 3823]} | Back information, alignment and structure |
|---|
| >d2a6za1 b.29.1.13 (A:7-227) Emp47p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2a6va1 b.29.1.13 (A:9-226) Emp46p N-terminal domain {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d1jpaa_ d.144.1.7 (A:) ephb2 receptor tyrosine kinase {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1opja_ d.144.1.7 (A:) Abelsone tyrosine kinase (abl) {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1mqba_ d.144.1.7 (A:) epha2 receptor tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fmka3 d.144.1.7 (A:249-533) c-src tyrosine kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1lufa_ d.144.1.7 (A:) Musk tyrosine kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1r0pa_ d.144.1.7 (A:) Hepatocyte growth factor receptor, c-MET {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u59a_ d.144.1.7 (A:) Tyrosine-protein kinase ZAP-70 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2jfla1 d.144.1.7 (A:21-308) STE20-like serine/threonine-protein kinase, SLK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u5ra_ d.144.1.7 (A:) Serine/threonine protein kinase TAO2 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1xkka_ d.144.1.7 (A:) EGF receptor tyrosine kinase, Erbb-1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1qpca_ d.144.1.7 (A:) Lymphocyte kinase (lck) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1yhwa1 d.144.1.7 (A:249-541) pak1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1fvra_ d.144.1.7 (A:) Tie2 kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1p4oa_ d.144.1.7 (A:) Insulin-like growth factor 1 receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t46a_ d.144.1.7 (A:) c-KIT receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3blha1 d.144.1.7 (A:8-325) Cell division protein kinase 9, CDK9 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1koaa2 d.144.1.7 (A:5915-6264) Twitchin, kinase domain {Caenorhabditis elegans, pjk4 [TaxId: 6239]} | Back information, alignment and structure |
|---|
| >d1xbba_ d.144.1.7 (A:) Tyrosine-protein kinase SYK {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1u46a_ d.144.1.7 (A:) Activated CDC42 kinase 1, ACK1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q5ka_ d.144.1.7 (A:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1jksa_ d.144.1.7 (A:) Death-associated protein kinase, Dap {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1q8ya_ d.144.1.7 (A:) Sky1p {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} | Back information, alignment and structure |
|---|
| >d2b1pa1 d.144.1.7 (A:46-400) c-jun N-terminal kinase (jnk3s) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2gfsa1 d.144.1.7 (A:5-352) MAP kinase p38 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d3bqca1 d.144.1.7 (A:3-330) Protein kinase CK2, alpha subunit {Rattus norvegicus [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1koba_ d.144.1.7 (A:) Twitchin, kinase domain {California sea hare (Aplysia californica), twk43 [TaxId: 6500]} | Back information, alignment and structure |
|---|
| >d1cm8a_ d.144.1.7 (A:) MAP kinase p38-gamma {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1ywna1 d.144.1.7 (A:818-1166) Vascular endothelial growth factor receptor 2 (kdr) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1t4ha_ d.144.1.7 (A:) Protein kinase wnk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1rjba_ d.144.1.7 (A:) Fl cytokine receptor {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1a06a_ d.144.1.7 (A:) Calmodulin-dependent protein kinase {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1rdqe_ d.144.1.7 (E:) cAMP-dependent PK, catalytic subunit {Mouse (Mus musculus) [TaxId: 10090]} | Back information, alignment and structure |
|---|
| >d1ckia_ d.144.1.7 (A:) Casein kinase-1, CK1 {Rat (Rattus norvegicus) [TaxId: 10116]} | Back information, alignment and structure |
|---|
| >d1fgka_ d.144.1.7 (A:) Fibroblast growth factor receptor 1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1pmea_ d.144.1.7 (A:) MAP kinase Erk2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1o6ya_ d.144.1.7 (A:) Mycobacterial protein kinase PknB, catalytic domain {Mycobacterium tuberculosis [TaxId: 1773]} | Back information, alignment and structure |
|---|
| >d1uu3a_ d.144.1.7 (A:) 3-phosphoinositide dependent protein kinase-1 Pdk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1blxa_ d.144.1.7 (A:) Cyclin-dependent PK, CDK6 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1vzoa_ d.144.1.7 (A:) Ribosomal protein S6 kinase alpha 5, Msk1 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d2ozaa1 d.144.1.7 (A:51-385) MAP kinase activated protein kinase 2, mapkap2 {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1mp8a_ d.144.1.7 (A:) Focal adhesion kinase 1 (fak) {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|
| >d1uwha_ d.144.1.7 (A:) B-Raf kinase {Human (Homo sapiens) [TaxId: 9606]} | Back information, alignment and structure |
|---|