Citrus Sinensis ID: 042254


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------16
MRTLASFNAPTPAAAAITKATVATQQRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLSDSRDIESGDKGQEGDAANSVKVYEEKILVIMAGDEKPTFLATPVCTKPSSFVDGKQIDKNEQGENFEIGEKVKEVTDHEDNHRENQETQGPQVQNQ
cccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccccccccccccccccccccccEEEEEEcccccccEEccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccc
****************************PWHSPVPYLFGGLAAMLGLIAFALLILACSYWKL**********************VYEEKILVIMAGDEKPTFLATPVC***************************************************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRTLASFNAPTPAAAAITKATVATQQRSPWHSPVPYLFGGLAAMLGLIAFALLILACSYWKLSDSRDIESGDKGQEGDAANSVKVYEEKILVIMAGDEKPTFLATPVCTKPSSFVDGKQIDKNEQGENFEIGEKVKEVTDHEDNHRENQETQGPQVQNQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein GLUTAMINE DUMPER 4 Probable subunit of an amino acid transporter involved in the regulation of the amino acid metabolism. Stimulates amino acid export by activating nonselective amino acid facilitators.probableQ8S8A0

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2KNC, chain A
Confidence level:probable
Coverage over the Query: 33-65
View the alignment between query and template
View the model in PyMOL