Citrus Sinensis ID: 042255

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280

MELKASSSLVVLTALVLLFSSSSVSVNGFDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNILSVHVILDYYDMNKLKKLPKTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNSPPVAKFVKSVFSQPFNISVLQVSQPIVAPGLGDVILPPPPPPYTPPPAMPPKASRKKSNASAPVAEGDDDEFAPSDSPIEAPVEAPAPEPVEAPAQSPPEPKDEAEAPAPSSASRLYLASGVALAGFTAMAFI

cccccHHHHHHHHHHHHHHHccccccccccHHHHHcccccHHHHHHHHHHHHHHHHHHccccEEEEEEccccccccccccHHHHHHHHHHHcccccccHHHccccccccccccccccccccccccEEEEEEEccccEEEEcccccccccccEEEccccccccEEEEEEEccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHcc

********LVVLTALVLLFSSSSVSVNGFDIIKILSNHPNLLAFSDLLSQTKLNEAINKRKTITVLAVDNSSIGGLNDRPVDEIKNILSVHVILDYYDMNKLKKLPKTSSWTTMFQSTGNANDKQGYINCTRLPGEQFVFGSSVKNSPPVAKFVKSVFSQPFNISVLQVSQPIVAPGLGDV*********************************************************************************LYLASGVALAGFTAMAFI

xxxxxxHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxHHHHHHHHHHHHHHHxxx

SSSSSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Fasciclin-like arabinogalactan protein 3	May be a cell surface adhesion protein.	probable	Q9ZQ23

Prediction of Enzyme Commission Number

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1NYO, chain A
Confidence level:confident
Coverage over the Query: 28-177
View the alignment between query and template
View the model in PyMOL

Templates for Structure Prediction

ID	Alignment Graph	Confidence Level	View Alignment and Template
Query
3gdb, chain A		probable	Alignment \| Template Structure