Citrus Sinensis ID: 042270


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------
DWILSAPKENLHLPAPNVFVPTDLSLKDTQEAKFPVLLRKSSYSTLWYKPDTMFSTPKAFVNIYFNCPHASSSPESEVLTDIFTRLLHDYLNEYAYYAQVAGLYYGINHTEGGFEVTVVGYNHKLRILLETIFQKIAQFKVQPDRFSVIKEMVTKEYHNNKFLQPYQLAMYYCSLILQDQTWPWTEELEVLPHLEAEDLAKFVPMMLSRTFLECYIAGNIESNEAGSIIQYIEDVFFKGSNPICQPLFPSQHLTNRVVKLEKGKNYVYSNQGLNPSDENSCLVHYIQ
cccccccccccccccccccccccccccccccccccEEEEEcccEEEEEEccccccccccEEEEEECcccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcEEEEEEECccEEEEEEEccccHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHcccccccHHHHHHHcccccHHHHHHHHHHHccccEEEEEEEccccHHHHHHHHHHHHHHHcccccccccccccccccccEEEEcccccCEEEEEcccccccccCEEEEEEc
DWILS*PKENLHLPAPNVFVPTDLSLKDTQEAKFPVLLRKSSYSTLWYKPDTMFSTPKAFVNIYFNCPHASSSPESEVLTDIFTRLLHDYLNEYAYYAQVAGLYYGINHTEGGFEVTVVGYNHKLRILLETIFQKIAQFKVQPDRFSVIKEMVTKEYHNNKFLQPYQLAMYYCSLILQDQTWPWTEELEVLPHLEAEDLAKFVPMMLSRTFLECYIAGNIESNEAGSIIQYIEDVFFKGSNPICQPLFPSQHLTNRVVKLEKGKNYVYSNQGLNPSDENSCLVHYIQ
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DWILSAPKENLHLPAPNVFVPTDLSLKDTQEAKFPVLLRKSSYSTLWYKPDTMFSTPKAFVNIYFNCPHASSSPESEVLTDIFTRLLHDYLNEYAYYAQVAGLYYGINHTEGGFEVTVVGYNHKLRILLETIFQKIAQFKVQPDRFSVIKEMVTKEYHNNKFLQPYQLAMYYCSLILQDQTWPWTEELEVLPHLEAEDLAKFVPMMLSRTFLECYIAGNIESNEAGSIIQYIEDVFFKGSNPICQPLFPSQHLTNRVVKLEKGKNYVYSNQGLNPSDENSCLVHYIQ

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Zinc-metallopeptidase, peroxisomal Peptidase that might be involved in pathogen or wound response. Not required for peroxisome biogenesis, indole-3-butyric acid (IBA) metabolism, fatty acid beta-oxidation or degradation of glyoxylate cycle enzymes during seedling development.probableO22941

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 3CWW, chain A
Confidence level:very confident
Coverage over the Query: 2-287
View the alignment between query and template
View the model in PyMOL