Citrus Sinensis ID: 042284


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MALSSSSSAAAALLNGSGSISSSFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR
cccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHccccccEEEEccccccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHccccccccccHHHHHcccccHHHHHHHccccEEEEccccccccccccccccEEEcccccccccccccEEEECccccccHHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccccccEEEEEccccccccccccccccHHHHHHHHHHHc
*********************SSFAVCYYGPHHKG***********EDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNG******************************LFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHS***********DVDSLMAFVNALR
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
SSSSSSSSSSSSSSSSSSSSSSSSSxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSSSSSAAAALLNGSGSISSSFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Probable 5'-adenylylsulfate reductase 1, chloroplastic Reduces sulfate for Cys biosynthesis.confidentQ6Z4A7
5'-adenylylsulfate reductase 3, chloroplastic Reduces sulfate for Cys biosynthesis. Substrate preference is adenosine-5'-phosphosulfate (APS) >> 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Uses glutathione or DTT as source of protons.confidentP92980
5'-adenylylsulfate reductase 2, chloroplastic Reduces sulfate for Cys biosynthesis. Substrate preference is adenosine-5'-phosphosulfate (APS) >> 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Uses glutathione or DTT as source of protons.probableP92981

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
1.-.-.-Oxidoreductases.probable
1.8.-.-Acting on a sulfur group of donors.probable
1.8.4.-With a disulfide as acceptor.probable
1.8.4.9Adenylyl-sulfate reductase (glutathione).probable
1.8.4.8Phosphoadenylyl-sulfate reductase (thioredoxin).probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3APO, chain A
Confidence level:very confident
Coverage over the Query: 284-429
View the alignment between query and template
View the model in PyMOL
Template: 2GOY, chain A
Confidence level:very confident
Coverage over the Query: 47-271
View the alignment between query and template
View the model in PyMOL
Template: 2WSI, chain A
Confidence level:very confident
Coverage over the Query: 19-133,148-272
View the alignment between query and template
View the model in PyMOL