Citrus Sinensis ID: 042284


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430
MALSSSSSAAAALLNGSGSISSSFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR
cccccccHHHHHcccccccccccccccccccccccccccccccccHHHHHHHHHHHccccHHHHHHHHHHHHcccEEEEcccHHHHHHHHHHHHHcccccEEEEccccccHHHHHHHHHHHHHHcccEEEEccccHHHHHHHHHccccccccccHHHHHcccccHHHHHHHccccEEEEccccccccccccccccEEEcccccccccccccEEEEEccccccHHHHHHHHHHccccccccccccccccccccccccccccccccccccccccccccccccccccccHHHHHHHHccccccccccccccccccccccccccccccHHHHHHHHHHccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEccccHHHHHHHHcccccccEEEEEccccccccccccccccHHHHHHHHHHHc
ccccccccHHHHHHcccccccccEEEEccccccccccccccccccHHHHHHHHHHHHcccHHHHHHHHHHHccccEEEEcccHHHHHHHHHHHHcccccEEEEEccccccHHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHcccHHHHHccHHHHHccccccHHHHHHHcccEEEEcccccccccccccccEEEEcccccccccccccEEEEcccccccHHHHHHHHHHccccccHHHHcccccccccccccccccccccccccEEEccccccccccccccccccccHHHHHHcccccHccccccccHHHHcccccEEEccHHHHHHHHHcccccccEEEEEEccccHHHHHHHHHHHHHHHHHcccccEEEEEEcccHHHHHHHHHHccccccEEEEEccccccccEcccccccHHHHHHHHHHHc
MALSSSSSAAAALLNgsgsisssfavcyygphhkgvegriestndhEDYEKLARgmesasplEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKltgrpfrvfsldtgrlnpethqFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWitgqrkdqspgtraeipvvqidtsfegidggkgslvkwnplanvkgqDIWNFLRamnipinslhsqgyisigcepctrpvlpgqheregrwwwedakakecglhngnikqEELSQHINingngvaqhtngsapasdlfnsqkLVSFRRTGIENLArlqnredpwlIVLYAPWCHFCQAMEGSYIELAEQLEGmgvkvgkfradgdhKEFAKQKlqlvsfptilffpkhsakpvkypsekrdVDSLMAFVNALR
MALSSSSSAAAALLNGSGSISSSFAVCYYGPHHkgvegriestnDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSfyedghqeccrirkvrplkRALKGLRawitgqrkdqspgtraeIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILffpkhsakpvkypsekrdvdSLMAFVNALR
MalsssssaaaallngsgsisssFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR
*********************SSFAVCYYGPHHKG****************************IMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQ*********AEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIK******HININ*****************FNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKH*************************
**********************************************EDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVL***HEREGRWWWEDAKAKECGLHN*******************************LFNSQKLVSFRRT*********NREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHS***********DVDSLMAFVNALR
***********ALLNGSGSISSSFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITG*********RAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR
*********************SSFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNG**************************PASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSSiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
SSSSSSSSSSSSSSSSSSSSSSSSSooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MALSSSSSAAAALLNGSGSISSSFAVCYYGPHHKGVEGRIESTNDHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query430 2.2.26 [Sep-21-2011]
P92980458 5'-adenylylsulfate reduct yes no 0.874 0.820 0.75 0.0
P92979465 5'-adenylylsulfate reduct no no 0.860 0.795 0.730 1e-175
P92981454 5'-adenylylsulfate reduct no no 0.862 0.817 0.728 1e-174
Q6Z4A7475 Probable 5'-adenylylsulfa yes no 0.888 0.804 0.742 1e-168
O05927267 Phosphoadenosine phosphos yes no 0.546 0.880 0.558 4e-79
Q02KP7267 Phosphoadenosine phosphos yes no 0.546 0.880 0.558 4e-79
B7VBC3267 Phosphoadenosine phosphos yes no 0.546 0.880 0.558 4e-79
Q9JUD5244 Phosphoadenosine phosphos yes no 0.444 0.782 0.433 6e-42
Q9JRT1246 Phosphoadenosine phosphos yes no 0.444 0.776 0.428 8e-41
P56891265 Phosphoadenosine phosphos yes no 0.444 0.720 0.425 6e-39
>sp|P92980|APR3_ARATH 5'-adenylylsulfate reductase 3, chloroplastic OS=Arabidopsis thaliana GN=APR3 PE=2 SV=2 Back     alignment and function desciption
 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/384 (75%), Positives = 338/384 (88%), Gaps = 8/384 (2%)

Query: 47  EDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDT 106
           ED+E+LA+ +E+ASPLEIMDKA +KFGNDIAIAFSGAEDV LIEYA LTGRP+RVFSLDT
Sbjct: 83  EDFEELAKRLENASPLEIMDKALEKFGNDIAIAFSGAEDVALIEYAHLTGRPYRVFSLDT 142

Query: 107 GRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRP 166
           GRLNPET++ FDTVEKHYGIRIEY FP+AVEVQALVR KGLFSFYEDGHQECCRIRKVRP
Sbjct: 143 GRLNPETYRLFDTVEKHYGIRIEYMFPDAVEVQALVRNKGLFSFYEDGHQECCRIRKVRP 202

Query: 167 LKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDI 226
           L+RALKGLRAWITGQRKDQSPGTR+EIPVVQ+D  FEG+DGG GSLVKWNP+ANV+G D+
Sbjct: 203 LRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLDGGVGSLVKWNPVANVEGNDV 262

Query: 227 WNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIK 286
           WNFLR M++P+N+LH+ GY+SIGCEPCTR VLPGQHEREGRWWWEDAKAKECGLH GNIK
Sbjct: 263 WNFLRTMDVPVNTLHAAGYVSIGCEPCTRAVLPGQHEREGRWWWEDAKAKECGLHKGNIK 322

Query: 287 QEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLY 346
           +       N NGN  A + NG+A  +D+FNS+ +V+  R GIENL +L+NR++ W++VLY
Sbjct: 323 E-------NTNGNATA-NVNGTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLY 374

Query: 347 APWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHS 406
           APWC FCQAME S+ ELA++L G GVKV KFRADGD K+FAK++LQL SFPTIL FPK+S
Sbjct: 375 APWCPFCQAMEASFDELADKLGGSGVKVAKFRADGDQKDFAKKELQLGSFPTILVFPKNS 434

Query: 407 AKPVKYPSEKRDVDSLMAFVNALR 430
           ++P+KYPSEKRDVDSL +F+N +R
Sbjct: 435 SRPIKYPSEKRDVDSLTSFLNLVR 458




Reduces sulfate for Cys biosynthesis. Substrate preference is adenosine-5'-phosphosulfate (APS) >> 3'-phosphoadenosine-5'-phosphosulfate (PAPS). Uses glutathione or DTT as source of protons.
Arabidopsis thaliana (taxid: 3702)
EC: 1EC: .EC: 8EC: .EC: 4EC: .EC: 9
>sp|P92979|APR1_ARATH 5'-adenylylsulfate reductase 1, chloroplastic OS=Arabidopsis thaliana GN=APR1 PE=1 SV=2 Back     alignment and function description
>sp|P92981|APR2_ARATH 5'-adenylylsulfate reductase 2, chloroplastic OS=Arabidopsis thaliana GN=APR2 PE=1 SV=2 Back     alignment and function description
>sp|Q6Z4A7|APR1_ORYSJ Probable 5'-adenylylsulfate reductase 1, chloroplastic OS=Oryza sativa subsp. japonica GN=APR1 PE=2 SV=1 Back     alignment and function description
>sp|O05927|CYSH_PSEAE Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=cysH PE=1 SV=2 Back     alignment and function description
>sp|Q02KP7|CYSH_PSEAB Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=cysH PE=3 SV=1 Back     alignment and function description
>sp|B7VBC3|CYSH_PSEA8 Phosphoadenosine phosphosulfate reductase OS=Pseudomonas aeruginosa (strain LESB58) GN=cysH PE=3 SV=1 Back     alignment and function description
>sp|Q9JUD5|CYSH_NEIMA Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=cysH PE=3 SV=1 Back     alignment and function description
>sp|Q9JRT1|CYSH_NEIMB Phosphoadenosine phosphosulfate reductase OS=Neisseria meningitidis serogroup B (strain MC58) GN=cysH1 PE=3 SV=1 Back     alignment and function description
>sp|P56891|CYSH_RHIME Phosphoadenosine phosphosulfate reductase OS=Rhizobium meliloti (strain 1021) GN=cysH PE=3 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
359483358460 PREDICTED: 5'-adenylylsulfate reductase 0.876 0.819 0.815 0.0
359483360454 PREDICTED: 5'-adenylylsulfate reductase 0.888 0.841 0.807 0.0
255554863471 5'-adenylylsulfate reductase 1, chloropl 0.888 0.811 0.791 0.0
359485485467 PREDICTED: 5'-adenylylsulfate reductase 0.888 0.817 0.809 0.0
350538397461 adenylyl-sulfate reductase [Solanum lyco 0.876 0.817 0.777 0.0
356555676472 PREDICTED: 5'-adenylylsulfate reductase 0.897 0.817 0.771 0.0
351727060470 adenosine 5'-phosphosulfate reductase [G 0.874 0.8 0.786 0.0
356521997466 PREDICTED: 5'-adenylylsulfate reductase 0.897 0.828 0.768 0.0
449479487463 PREDICTED: 5'-adenylylsulfate reductase 0.872 0.809 0.783 0.0
449433968463 PREDICTED: 5'-adenylylsulfate reductase 0.872 0.809 0.780 0.0
>gi|359483358|ref|XP_003632943.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information
 Score =  682 bits (1761), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/384 (81%), Positives = 352/384 (91%), Gaps = 7/384 (1%)

Query: 47  EDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDT 106
           EDYE+LAR + +ASPLEIMDKA  KFGNDIAIAFSGAED+ LIEYA+LTGRPFRVFSLDT
Sbjct: 84  EDYEQLARDLANASPLEIMDKALAKFGNDIAIAFSGAEDIALIEYARLTGRPFRVFSLDT 143

Query: 107 GRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRP 166
           GRLNPET+QFFDTVEKHYGIRIEY FP+AVEVQ LVR+KGLFSFYEDGHQECCR+RKVRP
Sbjct: 144 GRLNPETYQFFDTVEKHYGIRIEYMFPDAVEVQGLVRSKGLFSFYEDGHQECCRVRKVRP 203

Query: 167 LKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDI 226
           L+RALKGLRAWITGQRKDQSPGTRAE+PVVQ+D +FEG+DGG GSLVKWNP+ANV+G DI
Sbjct: 204 LRRALKGLRAWITGQRKDQSPGTRAEVPVVQVDPAFEGLDGGVGSLVKWNPVANVQGMDI 263

Query: 227 WNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIK 286
           WNFLRAMN+P+NSLHS+GYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLH GN+K
Sbjct: 264 WNFLRAMNVPVNSLHSKGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNLK 323

Query: 287 QEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLY 346
           QE+     N NGNG   H NG+A  SDLF++Q LV+  RTG+ENLA+L+NR++PWL+VLY
Sbjct: 324 QEDG----NKNGNG---HANGTATVSDLFDTQSLVTLTRTGMENLAKLENRKEPWLVVLY 376

Query: 347 APWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHS 406
           APWC FCQAMEGSY+ELAE+L G GVKVGKFRADGD KEFA+++LQL SFPTILFFPKHS
Sbjct: 377 APWCPFCQAMEGSYVELAEKLAGSGVKVGKFRADGDEKEFAQRELQLGSFPTILFFPKHS 436

Query: 407 AKPVKYPSEKRDVDSLMAFVNALR 430
           ++P+KY SEKRDVDSLMAFVNALR
Sbjct: 437 SQPIKYTSEKRDVDSLMAFVNALR 460




Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|359483360|ref|XP_003632944.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like isoform 2 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255554863|ref|XP_002518469.1| 5'-adenylylsulfate reductase 1, chloroplast precursor, putative [Ricinus communis] gi|223542314|gb|EEF43856.1| 5'-adenylylsulfate reductase 1, chloroplast precursor, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359485485|ref|XP_002269739.2| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic isoform 1 [Vitis vinifera] gi|297739159|emb|CBI28810.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|350538397|ref|NP_001233829.1| adenylyl-sulfate reductase [Solanum lycopersicum] gi|51457940|gb|AAU03359.1| adenylyl-sulfate reductase [Solanum lycopersicum] Back     alignment and taxonomy information
>gi|356555676|ref|XP_003546156.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|351727060|ref|NP_001235612.1| adenosine 5'-phosphosulfate reductase [Glycine max] gi|18252504|gb|AAL66290.1|AF452450_1 adenosine 5'-phosphosulfate reductase [Glycine max] Back     alignment and taxonomy information
>gi|356521997|ref|XP_003529636.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Glycine max] Back     alignment and taxonomy information
>gi|449479487|ref|XP_004155612.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449433968|ref|XP_004134768.1| PREDICTED: 5'-adenylylsulfate reductase 3, chloroplastic-like [Cucumis sativus] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query430
TAIR|locus:2120628458 APR3 "APS reductase 3" [Arabid 0.874 0.820 0.75 3.9e-163
TAIR|locus:2125786465 APR1 "APS reductase 1" [Arabid 0.872 0.806 0.736 3.6e-160
TAIR|locus:2018097454 APR2 "5'adenylylphosphosulfate 0.879 0.832 0.720 9.9e-158
TIGR_CMR|GSU_1716235 GSU_1716 "phosphoadenosine pho 0.527 0.965 0.432 5.2e-49
TIGR_CMR|SPO_2635253 SPO_2635 "phosophoadenylyl-sul 0.483 0.822 0.358 7.3e-27
UNIPROTKB|P65668254 cysH "Probable phosphoadenosin 0.441 0.748 0.375 4e-26
TIGR_CMR|BA_1440226 BA_1440 "phosphoadenosine phos 0.490 0.933 0.320 4.2e-24
TIGR_CMR|SO_3736245 SO_3736 "phosphoadenosine phos 0.451 0.791 0.292 4.2e-16
UNIPROTKB|Q9KUX2253 cysH "Phosphoadenosine phospho 0.451 0.766 0.273 1.9e-15
TIGR_CMR|VC_0386253 VC_0386 "phosphoadenosine phos 0.451 0.766 0.273 1.9e-15
TAIR|locus:2120628 APR3 "APS reductase 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1588 (564.1 bits), Expect = 3.9e-163, P = 3.9e-163
 Identities = 288/384 (75%), Positives = 338/384 (88%)

Query:    47 EDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDT 106
             ED+E+LA+ +E+ASPLEIMDKA +KFGNDIAIAFSGAEDV LIEYA LTGRP+RVFSLDT
Sbjct:    83 EDFEELAKRLENASPLEIMDKALEKFGNDIAIAFSGAEDVALIEYAHLTGRPYRVFSLDT 142

Query:   107 GRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRP 166
             GRLNPET++ FDTVEKHYGIRIEY FP+AVEVQALVR KGLFSFYEDGHQECCRIRKVRP
Sbjct:   143 GRLNPETYRLFDTVEKHYGIRIEYMFPDAVEVQALVRNKGLFSFYEDGHQECCRIRKVRP 202

Query:   167 LKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDI 226
             L+RALKGLRAWITGQRKDQSPGTR+EIPVVQ+D  FEG+DGG GSLVKWNP+ANV+G D+
Sbjct:   203 LRRALKGLRAWITGQRKDQSPGTRSEIPVVQVDPVFEGLDGGVGSLVKWNPVANVEGNDV 262

Query:   227 WNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIK 286
             WNFLR M++P+N+LH+ GY+SIGCEPCTR VLPGQHEREGRWWWEDAKAKECGLH GNIK
Sbjct:   263 WNFLRTMDVPVNTLHAAGYVSIGCEPCTRAVLPGQHEREGRWWWEDAKAKECGLHKGNIK 322

Query:   287 QEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLY 346
             +       N NGN  A + NG+A  +D+FNS+ +V+  R GIENL +L+NR++ W++VLY
Sbjct:   323 E-------NTNGNATA-NVNGTASVADIFNSENVVNLSRQGIENLMKLENRKEAWIVVLY 374

Query:   347 APWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHS 406
             APWC FCQAME S+ ELA++L G GVKV KFRADGD K+FAK++LQL SFPTIL FPK+S
Sbjct:   375 APWCPFCQAMEASFDELADKLGGSGVKVAKFRADGDQKDFAKKELQLGSFPTILVFPKNS 434

Query:   407 AKPVKYPSEKRDVDSLMAFVNALR 430
             ++P+KYPSEKRDVDSL +F+N +R
Sbjct:   435 SRPIKYPSEKRDVDSLTSFLNLVR 458




GO:0003824 "catalytic activity" evidence=IEA
GO:0008152 "metabolic process" evidence=IEA
GO:0009507 "chloroplast" evidence=ISM;ISS;IDA
GO:0016671 "oxidoreductase activity, acting on a sulfur group of donors, disulfide as acceptor" evidence=IEA
GO:0019419 "sulfate reduction" evidence=IEA
GO:0045454 "cell redox homeostasis" evidence=IEA
GO:0055114 "oxidation-reduction process" evidence=IEA
GO:0000103 "sulfate assimilation" evidence=IGI;IDA
GO:0009973 "adenylyl-sulfate reductase activity" evidence=IDA
TAIR|locus:2125786 APR1 "APS reductase 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2018097 APR2 "5'adenylylphosphosulfate reductase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TIGR_CMR|GSU_1716 GSU_1716 "phosphoadenosine phosphosulfate reductase, putative" [Geobacter sulfurreducens PCA (taxid:243231)] Back     alignment and assigned GO terms
TIGR_CMR|SPO_2635 SPO_2635 "phosophoadenylyl-sulfate reductase" [Ruegeria pomeroyi DSS-3 (taxid:246200)] Back     alignment and assigned GO terms
UNIPROTKB|P65668 cysH "Probable phosphoadenosine phosphosulfate reductase" [Mycobacterium tuberculosis (taxid:1773)] Back     alignment and assigned GO terms
TIGR_CMR|BA_1440 BA_1440 "phosphoadenosine phosphosulfate reductase" [Bacillus anthracis str. Ames (taxid:198094)] Back     alignment and assigned GO terms
TIGR_CMR|SO_3736 SO_3736 "phosphoadenosine phosphosulfate reductase" [Shewanella oneidensis MR-1 (taxid:211586)] Back     alignment and assigned GO terms
UNIPROTKB|Q9KUX2 cysH "Phosphoadenosine phosphosulfate reductase" [Vibrio cholerae O1 biovar El Tor str. N16961 (taxid:243277)] Back     alignment and assigned GO terms
TIGR_CMR|VC_0386 VC_0386 "phosphoadenosine phosphosulfate reductase" [Vibrio cholerae O1 biovar El Tor (taxid:686)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
P92980APR3_ARATH1, ., 8, ., 4, ., 90.750.87440.8209yesno
Q6Z4A7APR1_ORYSJ1, ., 8, ., 4, ., 90.74280.88830.8042yesno
P92981APR2_ARATH1, ., 8, ., 4, ., 90.72840.86270.8171nono

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer1.8.4LOW CONFIDENCE prediction!
3rd Layer2.7.7LOW CONFIDENCE prediction!
4th Layer1.8.4.80.824
4th Layer1.8.4.90.991

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
PLN02309457 PLN02309, PLN02309, 5'-adenylylsulfate reductase 0.0
TIGR00424463 TIGR00424, APS_reduc, 5'-adenylylsulfate reductase 0.0
PRK02090241 PRK02090, PRK02090, phosphoadenosine phosphosulfat 1e-93
TIGR02055191 TIGR02055, APS_reductase, thioredoxin-dependent ad 1e-86
COG0175261 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfa 9e-70
pfam01507173 pfam01507, PAPS_reduct, Phosphoadenosine phosphosu 2e-61
cd02993109 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Aden 1e-55
cd01713173 cd01713, PAPS_reductase, This domain is found in p 4e-53
TIGR00434212 TIGR00434, cysH, phosophoadenylyl-sulfate reductas 4e-46
TIGR02057226 TIGR02057, PAPS_reductase, phosphoadenosine phosph 1e-37
cd02961101 cd02961, PDI_a_family, Protein Disulfide Isomerase 1e-21
cd02998105 cd02998, PDI_a_ERp38, PDIa family, endoplasmic ret 1e-17
cd02995104 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal T 2e-14
cd03004104 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ER 3e-14
TIGR01126102 TIGR01126, pdi_dom, protein disulfide-isomerase do 4e-13
cd03001103 cd03001, PDI_a_P5, PDIa family, P5 subfamily; comp 2e-12
pfam00085104 pfam00085, Thioredoxin, Thioredoxin 1e-11
TIGR01130462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 2e-11
PTZ00102477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 3e-09
cd03000104 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; 2e-08
PRK13794479 PRK13794, PRK13794, hypothetical protein; Provisio 6e-08
cd03002109 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like su 2e-07
PTZ00443224 PTZ00443, PTZ00443, Thioredoxin domain-containing 2e-07
PTZ00102 477 PTZ00102, PTZ00102, disulphide isomerase; Provisio 1e-06
cd03003101 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ER 1e-06
cd02994101 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; co 1e-06
cd0294793 cd02947, TRX_family, TRX family; composed of two g 3e-06
PRK13795636 PRK13795, PRK13795, hypothetical protein; Provisio 4e-06
cd03005102 cd03005, PDI_a_ERp46, PDIa family, endoplasmic ret 4e-06
PRK08557417 PRK08557, PRK08557, hypothetical protein; Provisio 5e-06
cd02997104 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; 6e-06
TIGR01068101 TIGR01068, thioredoxin, thioredoxin 1e-05
COG0526127 COG0526, TrxA, Thiol-disulfide isomerase and thior 2e-05
PRK08576438 PRK08576, PRK08576, hypothetical protein; Provisio 4e-05
cd02963111 cd02963, TRX_DnaJ, TRX domain, DnaJ domain contain 4e-05
cd0165969 cd01659, TRX_superfamily, Thioredoxin (TRX) superf 5e-05
TIGR01130 462 TIGR01130, ER_PDI_fam, protein disulfide isomerase 1e-04
TIGR02039294 TIGR02039, CysD, sulfate adenylyltransferase, smal 8e-04
cd02999100 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmi 0.002
COG4232569 COG4232, COG4232, Thiol:disulfide interchange prot 0.003
PRK05253301 PRK05253, PRK05253, sulfate adenylyltransferase su 0.004
>gnl|CDD|215175 PLN02309, PLN02309, 5'-adenylylsulfate reductase Back     alignment and domain information
 Score =  776 bits (2006), Expect = 0.0
 Identities = 297/384 (77%), Positives = 339/384 (88%), Gaps = 10/384 (2%)

Query: 47  EDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDT 106
           ED+EKLA+ +E+ASPLEIMDKA +KFGNDIAIAFSGAEDV LIEYA LTGRPFRVFSLDT
Sbjct: 84  EDFEKLAKELENASPLEIMDKALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDT 143

Query: 107 GRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRP 166
           GRLNPET++ FD VEKHYGIRIEY FP+AVEVQALVR KGLFSFYEDGHQECCR+RKVRP
Sbjct: 144 GRLNPETYRLFDAVEKHYGIRIEYMFPDAVEVQALVRNKGLFSFYEDGHQECCRVRKVRP 203

Query: 167 LKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDI 226
           L+RALKGLRAWITGQRKDQSPGTRAE+PVVQ+D  FEG+DGG GSLVKWNPLANV G ++
Sbjct: 204 LRRALKGLRAWITGQRKDQSPGTRAEVPVVQVDPVFEGLDGGPGSLVKWNPLANVTGNEV 263

Query: 227 WNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIK 286
           WNFLR M++P+NSLH+QGY+SIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLH GNIK
Sbjct: 264 WNFLRTMDVPVNSLHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNIK 323

Query: 287 QEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLY 346
           +E+            A + NG+A  +D+FNSQ +V+  R GIENL +L+NR++PWL+VLY
Sbjct: 324 EED----------NGAANDNGNAAVADIFNSQNVVALSRAGIENLLKLENRKEPWLVVLY 373

Query: 347 APWCHFCQAMEGSYIELAEQLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHS 406
           APWC FCQAME SY ELAE+L G GVKV KFRADGD KEFAKQ+LQL SFPTIL FPK+S
Sbjct: 374 APWCPFCQAMEASYEELAEKLAGSGVKVAKFRADGDQKEFAKQELQLGSFPTILLFPKNS 433

Query: 407 AKPVKYPSEKRDVDSLMAFVNALR 430
           ++P+KYPSEKRDVDSL++FVN+LR
Sbjct: 434 SRPIKYPSEKRDVDSLLSFVNSLR 457


Length = 457

>gnl|CDD|232970 TIGR00424, APS_reduc, 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
>gnl|CDD|234997 PRK02090, PRK02090, phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>gnl|CDD|233701 TIGR02055, APS_reductase, thioredoxin-dependent adenylylsulfate APS reductase Back     alignment and domain information
>gnl|CDD|223253 COG0175, CysH, 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>gnl|CDD|201832 pfam01507, PAPS_reduct, Phosphoadenosine phosphosulfate reductase family Back     alignment and domain information
>gnl|CDD|239291 cd02993, PDI_a_APS_reductase, PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>gnl|CDD|238846 cd01713, PAPS_reductase, This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>gnl|CDD|129526 TIGR00434, cysH, phosophoadenylyl-sulfate reductase (thioredoxin) Back     alignment and domain information
>gnl|CDD|131112 TIGR02057, PAPS_reductase, phosphoadenosine phosphosulfate reductase, thioredoxin dependent Back     alignment and domain information
>gnl|CDD|239259 cd02961, PDI_a_family, Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>gnl|CDD|239296 cd02998, PDI_a_ERp38, PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>gnl|CDD|239293 cd02995, PDI_a_PDI_a'_C, PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>gnl|CDD|239302 cd03004, PDI_a_ERdj5_C, PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|200074 TIGR01126, pdi_dom, protein disulfide-isomerase domain Back     alignment and domain information
>gnl|CDD|239299 cd03001, PDI_a_P5, PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>gnl|CDD|215704 pfam00085, Thioredoxin, Thioredoxin Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239298 cd03000, PDI_a_TMX3, PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>gnl|CDD|237509 PRK13794, PRK13794, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239300 cd03002, PDI_a_MPD1_like, PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>gnl|CDD|185622 PTZ00443, PTZ00443, Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>gnl|CDD|240266 PTZ00102, PTZ00102, disulphide isomerase; Provisional Back     alignment and domain information
>gnl|CDD|239301 cd03003, PDI_a_ERdj5_N, PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>gnl|CDD|239292 cd02994, PDI_a_TMX, PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>gnl|CDD|239245 cd02947, TRX_family, TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>gnl|CDD|237510 PRK13795, PRK13795, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239303 cd03005, PDI_a_ERp46, PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>gnl|CDD|181465 PRK08557, PRK08557, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239295 cd02997, PDI_a_PDIR, PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>gnl|CDD|200072 TIGR01068, thioredoxin, thioredoxin Back     alignment and domain information
>gnl|CDD|223600 COG0526, TrxA, Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|236300 PRK08576, PRK08576, hypothetical protein; Provisional Back     alignment and domain information
>gnl|CDD|239261 cd02963, TRX_DnaJ, TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>gnl|CDD|238829 cd01659, TRX_superfamily, Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>gnl|CDD|233282 TIGR01130, ER_PDI_fam, protein disulfide isomerase, eukaryotic Back     alignment and domain information
>gnl|CDD|131094 TIGR02039, CysD, sulfate adenylyltransferase, small subunit Back     alignment and domain information
>gnl|CDD|239297 cd02999, PDI_a_ERp44_like, PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>gnl|CDD|226685 COG4232, COG4232, Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>gnl|CDD|235375 PRK05253, PRK05253, sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 430
TIGR00424463 APS_reduc 5'-adenylylsulfate reductase, thioredoxi 100.0
PLN02309457 5'-adenylylsulfate reductase 100.0
TIGR02057226 PAPS_reductase phosphoadenosine phosphosulfate red 100.0
KOG0189261 consensus Phosphoadenosine phosphosulfate reductas 100.0
PRK02090241 phosphoadenosine phosphosulfate reductase; Provisi 100.0
TIGR00434212 cysH phosophoadenylyl-sulfate reductase (thioredox 100.0
COG0175261 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotr 100.0
TIGR02055191 APS_reductase thioredoxin-dependent adenylylsulfat 100.0
PRK12563312 sulfate adenylyltransferase subunit 2; Provisional 100.0
TIGR02039294 CysD sulfate adenylyltransferase, small subunit. I 100.0
PRK08557417 hypothetical protein; Provisional 100.0
PRK13794479 hypothetical protein; Provisional 100.0
PRK05253301 sulfate adenylyltransferase subunit 2; Provisional 100.0
PF01507174 PAPS_reduct: Phosphoadenosine phosphosulfate reduc 100.0
PRK13795636 hypothetical protein; Provisional 100.0
PRK08576438 hypothetical protein; Provisional 100.0
cd01713173 PAPS_reductase This domain is found in phosphoaden 100.0
TIGR03183447 DNA_S_dndC putative sulfurtransferase DndC. Member 99.97
PRK06850507 hypothetical protein; Provisional 99.97
COG3969407 Predicted phosphoadenosine phosphosulfate sulfotra 99.9
cd03006113 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamil 99.87
cd03003101 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfam 99.84
cd03004104 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfam 99.83
KOG0910150 consensus Thioredoxin-like protein [Posttranslatio 99.83
cd02996108 PDI_a_ERp44 PDIa family, endoplasmic reticulum pro 99.83
cd03065120 PDI_b_Calsequestrin_N PDIb family, Calsequestrin s 99.82
PF00085103 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thio 99.81
cd02993109 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfat 99.81
cd02994101 PDI_a_TMX PDIa family, TMX subfamily; composed of 99.81
cd02963111 TRX_DnaJ TRX domain, DnaJ domain containing protei 99.8
COG3118 304 Thioredoxin domain-containing protein [Posttransla 99.8
cd03002109 PDI_a_MPD1_like PDI family, MPD1-like subfamily; c 99.79
cd03001103 PDI_a_P5 PDIa family, P5 subfamily; composed of eu 99.77
PTZ00443224 Thioredoxin domain-containing protein; Provisional 99.77
PHA02278103 thioredoxin-like protein 99.77
cd03005102 PDI_a_ERp46 PDIa family, endoplasmic reticulum pro 99.76
cd02954114 DIM1 Dim1 family; Dim1 is also referred to as U5 s 99.76
cd02999100 PDI_a_ERp44_like PDIa family, endoplasmic reticulu 99.76
cd02948102 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fus 99.76
cd0295696 ybbN ybbN protein family; ybbN is a hypothetical p 99.76
PRK09381109 trxA thioredoxin; Provisional 99.75
PRK10996139 thioredoxin 2; Provisional 99.75
cd02995104 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain 99.74
cd02985103 TRX_CDSP32 TRX family, chloroplastic drought-induc 99.74
cd02962152 TMX2 TMX2 family; composed of proteins similar to 99.74
KOG0907106 consensus Thioredoxin [Posttranslational modificat 99.74
cd02997104 PDI_a_PDIR PDIa family, PDIR subfamily; composed o 99.73
KOG0190 493 consensus Protein disulfide isomerase (prolyl 4-hy 99.73
cd03007116 PDI_a_ERp29_N PDIa family, endoplasmic reticulum p 99.73
cd02998105 PDI_a_ERp38 PDIa family, endoplasmic reticulum pro 99.73
TIGR01126102 pdi_dom protein disulfide-isomerase domain. This m 99.72
cd02965111 HyaE HyaE family; HyaE is also called HupG and Hox 99.71
cd03000104 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed o 99.71
cd02989113 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thior 99.7
PLN00410142 U5 snRNP protein, DIM1 family; Provisional 99.7
cd02957113 Phd_like Phosducin (Phd)-like family; composed of 99.7
KOG0190493 consensus Protein disulfide isomerase (prolyl 4-hy 99.7
cd02986114 DLP Dim1 family, Dim1-like protein (DLP) subfamily 99.68
cd02992114 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidas 99.68
cd02961101 PDI_a_family Protein Disulfide Isomerase (PDIa) fa 99.67
TIGR01068101 thioredoxin thioredoxin. Several proteins, such as 99.67
cd02953104 DsbDgamma DsbD gamma family; DsbD gamma is the C-t 99.65
cd0298497 TRX_PICOT TRX domain, PICOT (for PKC-interacting c 99.65
cd02987175 Phd_like_Phd Phosducin (Phd)-like family, Phd subf 99.64
cd02950142 TxlA TRX-like protein A (TxlA) family; TxlA was or 99.64
PTZ0005198 thioredoxin; Provisional 99.61
cd0294997 TRX_NTR TRX domain, novel NADPH thioredoxin reduct 99.6
cd01992185 PP-ATPase N-terminal domain of predicted ATPase of 99.59
TIGR01130 462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.59
PTZ00102 477 disulphide isomerase; Provisional 99.59
PTZ00102477 disulphide isomerase; Provisional 99.59
KOG4277 468 consensus Uncharacterized conserved protein, conta 99.58
cd02975113 PfPDO_like_N Pyrococcus furiosus protein disulfide 99.57
TIGR01295122 PedC_BrcD bacteriocin transport accessory protein, 99.57
KOG0908 288 consensus Thioredoxin-like protein [Posttranslatio 99.56
cd02951125 SoxW SoxW family; SoxW is a bacterial periplasmic 99.55
cd02988192 Phd_like_VIAF Phosducin (Phd)-like family, Viral i 99.55
KOG0912 375 consensus Thiol-disulfide isomerase and thioredoxi 99.53
TIGR02432189 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-t 99.53
cd02952119 TRP14_like Human TRX-related protein 14 (TRP14)-li 99.51
cd0294793 TRX_family TRX family; composed of two groups: Gro 99.51
KOG2644282 consensus 3'-phosphoadenosine 5'-phosphosulfate su 99.5
cd01993185 Alpha_ANH_like_II This is a subfamily of Adenine n 99.5
cd02982103 PDI_b'_family Protein Disulfide Isomerase (PDIb') 99.49
TIGR01130462 ER_PDI_fam protein disulfide isomerases, eukaryoti 99.47
COG1606269 ATP-utilizing enzymes of the PP-loop superfamily [ 99.4
TIGR0041182 redox_disulf_1 small redox-active disulfide protei 99.39
PRK10696258 tRNA 2-thiocytidine biosynthesis protein TtcA; Pro 99.38
TIGR00268252 conserved hypothetical protein TIGR00268. The N-te 99.34
cd02959117 ERp19 Endoplasmic reticulum protein 19 (ERp19) fam 99.34
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 99.33
TIGR02187 215 GlrX_arch Glutaredoxin-like domain protein. This f 99.33
PTZ00062 204 glutaredoxin; Provisional 99.3
KOG0191 383 consensus Thioredoxin/protein disulfide isomerase 99.3
PF01171182 ATP_bind_3: PP-loop family; InterPro: IPR011063 Th 99.28
PRK00293571 dipZ thiol:disulfide interchange protein precursor 99.26
cd02955124 SSP411 TRX domain, SSP411 protein family; members 99.26
cd01990202 Alpha_ANH_like_I This is a subfamily of Adenine nu 99.26
COG0037298 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle 99.25
PHA0212575 thioredoxin-like protein 99.24
TIGR0041276 redox_disulf_2 small redox-active disulfide protei 99.23
KOG1731 606 consensus FAD-dependent sulfhydryl oxidase/quiesci 99.22
TIGR02187215 GlrX_arch Glutaredoxin-like domain protein. This f 99.22
PRK03147173 thiol-disulfide oxidoreductase; Provisional 99.22
PRK14018 521 trifunctional thioredoxin/methionine sulfoxide red 99.2
TIGR02740271 TraF-like TraF-like protein. This protein is relat 99.17
cd01997295 GMP_synthase_C The C-terminal domain of GMP synthe 99.16
TIGR02738153 TrbB type-F conjugative transfer system pilin asse 99.16
PF13098112 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_ 99.15
PRK00919307 GMP synthase subunit B; Validated 99.14
cd01712177 ThiI ThiI is required for thiazole synthesis in th 99.14
PRK00074511 guaA GMP synthase; Reviewed 99.14
TIGR00884311 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C 99.12
cd01995169 ExsB ExsB is a transcription regulator related pro 99.11
cd03008146 TryX_like_RdCVF Tryparedoxin (TryX)-like family, R 99.11
PF1390595 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_ 99.09
cd03009131 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family 99.08
PRK00143346 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed 99.08
cd02964132 TryX_like_family Tryparedoxin (TryX)-like family; 99.07
cd0297367 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)- 99.07
PRK15412185 thiol:disulfide interchange protein DsbE; Provisio 99.06
PRK11509132 hydrogenase-1 operon protein HyaE; Provisional 99.04
PRK14561194 hypothetical protein; Provisional 99.03
cd03010127 TlpA_like_DsbE TlpA-like family, DsbE (also known 99.03
cd03011123 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppresso 99.02
TIGR00385173 dsbE periplasmic protein thiol:disulfide oxidoredu 99.0
cd02958114 UAS UAS family; UAS is a domain of unknown functio 98.98
TIGR00420352 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-me 98.98
PRK14665360 mnmA tRNA-specific 2-thiouridylase MnmA; Provision 98.97
COG4232569 Thiol:disulfide interchange protein [Posttranslati 98.97
cd01998349 tRNA_Me_trans tRNA methyl transferase. This family 98.96
cd02966116 TlpA_like_family TlpA-like family; composed of Tlp 98.93
PRK10660436 tilS tRNA(Ile)-lysidine synthetase; Provisional 98.92
cd0302689 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxid 98.92
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 98.92
PRK08349198 hypothetical protein; Validated 98.91
PLN02347536 GMP synthetase 98.89
KOG0913 248 consensus Thiol-disulfide isomerase and thioredoxi 98.85
cd02967114 mauD Methylamine utilization (mau) D family; mauD 98.85
KOG0914265 consensus Thioredoxin-like protein [Posttranslatio 98.85
TIGR00552250 nadE NAD+ synthetase. NAD+ synthetase is a nearly 98.85
cd03012126 TlpA_like_DipZ_like TlpA-like family, DipZ-like su 98.84
PRK13728181 conjugal transfer protein TrbB; Provisional 98.84
TIGR00364201 exsB protein. This protein family is represented b 98.84
cd01996154 Alpha_ANH_like_III This is a subfamily of Adenine 98.82
PF1389982 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_ 98.82
PRK11106231 queuosine biosynthesis protein QueC; Provisional 98.81
cd00553248 NAD_synthase NAD+ synthase is a homodimer, which c 98.81
cd02960130 AGR Anterior Gradient (AGR) family; members of thi 98.81
cd01999385 Argininosuccinate_Synthase Argininosuccinate synth 98.8
PLN00200404 argininosuccinate synthase; Provisional 98.79
smart00594122 UAS UAS domain. 98.79
TIGR00032394 argG argininosuccinate synthase. argG in bacteria, 98.78
TIGR02661189 MauD methylamine dehydrogenase accessory protein M 98.77
TIGR00342371 thiazole biosynthesis/tRNA modification protein Th 98.77
PF08534146 Redoxin: Redoxin; InterPro: IPR013740 This redoxin 98.76
PRK13820394 argininosuccinate synthase; Provisional 98.75
PRK00509399 argininosuccinate synthase; Provisional 98.75
PRK08384381 thiamine biosynthesis protein ThiI; Provisional 98.73
PRK04527400 argininosuccinate synthase; Provisional 98.71
PRK13980265 NAD synthetase; Provisional 98.71
PTZ00056199 glutathione peroxidase; Provisional 98.7
PLN02399236 phospholipid hydroperoxide glutathione peroxidase 98.65
PRK14664362 tRNA-specific 2-thiouridylase MnmA; Provisional 98.62
PF02114265 Phosducin: Phosducin; InterPro: IPR024253 The oute 98.62
PRK01565394 thiamine biosynthesis protein ThiI; Provisional 98.61
COG2143182 Thioredoxin-related protein [Posttranslational mod 98.57
TIGR02540153 gpx7 putative glutathione peroxidase Gpx7. This mo 98.57
TIGR03573343 WbuX N-acetyl sugar amidotransferase. This enzyme 98.56
PLN02412167 probable glutathione peroxidase 98.56
PF06508209 QueC: Queuosine biosynthesis protein QueC; InterPr 98.56
cd02969171 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypot 98.56
COG0526127 TrxA Thiol-disulfide isomerase and thioredoxins [P 98.5
PF13728215 TraF: F plasmid transfer operon protein 98.47
cd00340152 GSH_Peroxidase Glutathione (GSH) peroxidase family 98.47
TIGR01626184 ytfJ_HI0045 conserved hypothetical protein YtfJ-fa 98.45
TIGR0219674 GlrX_YruB Glutaredoxin-like protein, YruB-family. 98.44
cd01994194 Alpha_ANH_like_IV This is a subfamily of Adenine n 98.43
cd0165969 TRX_superfamily Thioredoxin (TRX) superfamily; a l 98.4
PRK01269482 tRNA s(4)U8 sulfurtransferase; Provisional 98.39
KOG2501157 consensus Thioredoxin, nucleoredoxin and related p 98.33
PF01216 383 Calsequestrin: Calsequestrin; InterPro: IPR001393 98.31
COG2117198 Predicted subunit of tRNA(5-methylaminomethyl-2-th 98.3
PF00578124 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Per 98.27
TIGR0220077 GlrX_actino Glutaredoxin-like protein. This family 98.26
cd03017140 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferrit 98.25
PF03190163 Thioredox_DsbH: Protein of unknown function, DUF25 98.24
PF03054356 tRNA_Me_trans: tRNA methyl transferase; InterPro: 98.23
TIGR03137187 AhpC peroxiredoxin. This gene contains two invaria 98.23
PF02540242 NAD_synthase: NAD synthase; InterPro: IPR022310 NA 98.22
PTZ00323294 NAD+ synthase; Provisional 98.21
PF13848184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 98.21
PTZ00256183 glutathione peroxidase; Provisional 98.2
PF06110119 DUF953: Eukaryotic protein of unknown function (DU 98.2
cd03015173 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2- 98.19
TIGR02739256 TraF type-F conjugative transfer system pilin asse 98.17
cd01986103 Alpha_ANH_like Adenine nucleotide alpha hydrolases 98.17
COG0603222 Predicted PP-loop superfamily ATPase [General func 98.16
PRK09437154 bcp thioredoxin-dependent thiol peroxidase; Review 98.15
cd02970149 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypot 98.09
COG0482356 TrmU Predicted tRNA(5-methylaminomethyl-2-thiourid 98.09
KOG1672211 consensus ATP binding protein [Posttranslational m 98.08
cd02991116 UAS_ETEA UAS family, ETEA subfamily; composed of p 98.07
PRK13703248 conjugal pilus assembly protein TraF; Provisional 98.06
PF02568197 ThiI: Thiamine biosynthesis protein (ThiI); InterP 98.06
KOG3425128 consensus Uncharacterized conserved protein [Funct 98.06
PF07912126 ERp29_N: ERp29, N-terminal domain; InterPro: IPR01 98.04
KOG2603 331 consensus Oligosaccharyltransferase, gamma subunit 98.03
PRK10382187 alkyl hydroperoxide reductase subunit C; Provision 98.02
PRK00522167 tpx lipid hydroperoxide peroxidase; Provisional 98.0
TIGR0218084 GRX_euk Glutaredoxin. This model represents eukary 98.0
KOG3414142 consensus Component of the U4/U6.U5 snRNP/mitosis 97.99
PF14595129 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A. 97.98
PRK13190202 putative peroxiredoxin; Provisional 97.96
TIGR03679218 arCOG00187 arCOG00187 universal archaeal metal-bin 97.96
cd03018149 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-lik 97.95
PF1319276 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZY 97.92
cd03014143 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 97.89
PRK15000200 peroxidase; Provisional 97.88
cd03072111 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second 97.87
KOG2805377 consensus tRNA (5-methylaminomethyl-2-thiouridylat 97.85
PRK00876326 nadE NAD synthetase; Reviewed 97.83
cd02983130 P5_C P5 family, C-terminal redox inactive TRX-like 97.82
PTZ00137261 2-Cys peroxiredoxin; Provisional 97.76
cd03016203 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX sub 97.72
cd02971140 PRX_family Peroxiredoxin (PRX) family; composed of 97.68
cd01991269 Asn_Synthase_B_C The C-terminal domain of Asparagi 97.66
PRK1120085 grxA glutaredoxin 1; Provisional 97.65
cd0297673 NrdH NrdH-redoxin (NrdH) family; NrdH is a small m 97.65
cd03073111 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 s 97.64
PF02966133 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Th 97.63
KOG0911 227 consensus Glutaredoxin-related protein [Posttransl 97.62
cd02968142 SCO SCO (an acronym for Synthesis of Cytochrome c 97.61
cd0298197 PDI_b_family Protein Disulfide Isomerase (PDIb) fa 97.6
PRK13599215 putative peroxiredoxin; Provisional 97.6
PRK00768268 nadE NAD synthetase; Reviewed 97.58
PRK10877232 protein disulfide isomerase II DsbC; Provisional 97.57
PRK05370447 argininosuccinate synthase; Validated 97.54
PRK13981540 NAD synthetase; Provisional 97.54
PRK13189222 peroxiredoxin; Provisional 97.53
PRK02628679 nadE NAD synthetase; Reviewed 97.53
PRK13191215 putative peroxiredoxin; Provisional 97.52
TIGR03143555 AhpF_homolog putative alkyl hydroperoxide reductas 97.51
PRK15317 517 alkyl hydroperoxide reductase subunit F; Provision 97.49
PRK10606183 btuE putative glutathione peroxidase; Provisional 97.47
TIGR0218386 GRXA Glutaredoxin, GrxA family. This model include 97.46
COG0519315 GuaA GMP synthase, PP-ATPase domain/subunit [Nucle 97.4
KOG3170240 consensus Conserved phosducin-like protein [Signal 97.36
PTZ00253199 tryparedoxin peroxidase; Provisional 97.34
PF0046260 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Gl 97.29
PF0576881 DUF836: Glutaredoxin-like domain (DUF836); InterPr 97.24
PF11009105 DUF2847: Protein of unknown function (DUF2847); In 97.24
PF00764388 Arginosuc_synth: Arginosuccinate synthase; InterPr 97.23
TIGR00290223 MJ0570_dom MJ0570-related uncharacterized domain. 97.22
cd03020197 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamil 97.2
cd0341982 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX h 97.18
TIGR03140 515 AhpF alkyl hydroperoxide reductase, F subunit. Thi 97.16
KOG3171273 consensus Conserved phosducin-like protein [Signal 97.07
PF00837237 T4_deiodinase: Iodothyronine deiodinase; InterPro: 97.01
PF00733255 Asn_synthase: Asparagine synthase; InterPro: IPR00 97.01
COG0301383 ThiI Thiamine biosynthesis ATP pyrophosphatase [Co 96.98
cd03067112 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-termin 96.94
PRK1032981 glutaredoxin-like protein; Provisional 96.91
COG0171268 NadE NAD synthase [Coenzyme metabolism] 96.9
PF07449107 HyaE: Hydrogenase-1 expression protein HyaE; Inter 96.85
TIGR0219472 GlrX_NrdH Glutaredoxin-like protein NrdH. NrdH-red 96.8
cd0206672 GRX_family Glutaredoxin (GRX) family; composed of 96.78
KOG2840347 consensus Uncharacterized conserved protein with s 96.76
COG0137403 ArgG Argininosuccinate synthase [Amino acid transp 96.68
TIGR00289222 conserved hypothetical protein TIGR00289. Homologo 96.67
TIGR01536467 asn_synth_AEB asparagine synthase (glutamine-hydro 96.67
TIGR0219079 GlrX-dom Glutaredoxin-family domain. This C-termin 96.65
PRK11657251 dsbG disulfide isomerase/thiol-disulfide oxidase; 96.62
TIGR0218179 GRX_bact Glutaredoxin, GrxC family. This family of 96.57
cd0198486 AANH_like Adenine nucleotide alpha hydrolases supe 96.55
cd0341875 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX b 96.49
TIGR0218999 GlrX-like_plant Glutaredoxin-like family. This fam 96.48
cd0302773 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Eg 96.45
PF13848 184 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_ 96.41
PHA03050108 glutaredoxin; Provisional 96.36
cd0297298 DsbA_family DsbA family; consists of DsbA and DsbA 96.3
COG1365255 Predicted ATPase (PP-loop superfamily) [General fu 96.24
TIGR03143 555 AhpF_homolog putative alkyl hydroperoxide reductas 96.23
cd0302972 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hyb 96.17
COG2102223 Predicted ATPases of PP-loop superfamily [General 95.83
COG069580 GrxC Glutaredoxin and related proteins [Posttransl 95.79
TIGR0036597 monothiol glutaredoxin, Grx4 family. The gene for 95.71
KOG1622552 consensus GMP synthase [Nucleotide transport and m 95.59
cd0302890 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-inte 95.56
PRK1063883 glutaredoxin 3; Provisional 95.5
cd03069104 PDI_b_ERp57 PDIb family, ERp57 subfamily, first re 95.25
PF01902218 ATP_bind_4: ATP-binding region; InterPro: IPR00276 95.24
cd03066102 PDI_b_Calsequestrin_middle PDIb family, Calsequest 95.2
KOG1752104 consensus Glutaredoxin and related proteins [Postt 95.19
cd03023154 DsbA_Com1_like DsbA family, Com1-like subfamily; c 95.09
COG1331 667 Highly conserved protein containing a thioredoxin 94.9
PRK10824115 glutaredoxin-4; Provisional 94.33
COG1225157 Bcp Peroxiredoxin [Posttranslational modification, 94.22
KOG2640 319 consensus Thioredoxin [Function unknown] 94.09
PF13462162 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DV 93.49
cd03019178 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a m 93.03
COG0367542 AsnB Asparagine synthase (glutamine-hydrolyzing) [ 92.96
TIGR03108628 eps_aminotran_1 exosortase 1 system-associated ami 92.93
PRK12759 410 bifunctional gluaredoxin/ribonucleoside-diphosphat 92.92
PTZ00062204 glutaredoxin; Provisional 92.72
PLN02549578 asparagine synthase (glutamine-hydrolyzing) 92.4
cd03013155 PRX5_like Peroxiredoxin (PRX) family, PRX5-like su 92.18
TIGR03104589 trio_amidotrans asparagine synthase family amidotr 92.04
PTZ00077586 asparagine synthetase-like protein; Provisional 91.2
PRK10954207 periplasmic protein disulfide isomerase I; Provisi 90.16
cd0297872 KaiB_like KaiB-like family; composed of the circad 89.51
PRK09431554 asnB asparagine synthetase B; Provisional 89.32
cd03068107 PDI_b_ERp72 PDIb family, ERp72 subfamily, first re 88.8
PLN02339700 NAD+ synthase (glutamine-hydrolysing) 88.54
cd03031147 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like d 87.83
KOG1706412 consensus Argininosuccinate synthase [Amino acid t 85.16
KOG0573520 consensus Asparagine synthase [Amino acid transpor 84.13
PHA03075123 glutaredoxin-like protein; Provisional 84.11
PRK09301103 circadian clock protein KaiB; Provisional 83.31
cd0306071 GST_N_Omega_like GST_N family, Omega-like subfamil 82.32
TIGR0265487 circ_KaiB circadian clock protein KaiB. Members of 82.03
KOG2507 506 consensus Ubiquitin regulatory protein UBXD2, cont 81.79
>TIGR00424 APS_reduc 5'-adenylylsulfate reductase, thioredoxin-independent Back     alignment and domain information
Probab=100.00  E-value=3.1e-91  Score=697.24  Aligned_cols=376  Identities=79%  Similarity=1.356  Sum_probs=336.8

Q ss_pred             hhhHHHHHHhccCCCHHHHHHHHHHHcCCcEEEEechhHHHHHHHHHHhcCCCcEEEEecCCCCCHHHHHHHHHHHHHhC
Q 042284           46 HEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKHYG  125 (430)
Q Consensus        46 ~~~~~~l~~~l~~~~~~~~i~~~~~~~~~~i~vs~SGGKDS~vl~l~~~~~~~i~vi~~DTg~~fpet~~~~~~~~~~~g  125 (430)
                      ..+++.++++|+.++|+++|+|+++.|++++++++|||+|+++|||+.+.+++++|||+|||++|||||+|++++.++||
T Consensus        88 ~~~l~~l~~~l~~~~~~eil~~a~~~f~~~iavasSG~edsvLlhl~~~~~~~ipV~flDTG~lFpETy~~~d~v~~~yg  167 (463)
T TIGR00424        88 VEDFEKLAKKLENASPLEIMDKALEKFGNDIAIAFSGAEDVALIEYAHLTGRPFRVFSLDTGRLNPETYRFFDAVEKQYG  167 (463)
T ss_pred             HHHHHHHHHHhhcCCHHHHHHHHHHhcCCCEEEEeccHHHHHHHHHHHHhCCCCcEEEecCCCCCHHHHHHHHHHHHHhC
Confidence            55789999999999999999999999998899999999999999999999999999999999999999999999999999


Q ss_pred             CcEEEEccCchHHHHHHHhcCCCCCCccchhhhhhhhchHHHHHHHhcCceEEEeeeccCCcccccCCCeeeecCCCCcc
Q 042284          126 IRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGI  205 (430)
Q Consensus       126 l~i~~~~p~~~~~~~~~~~~g~~~~~~~~~~~cc~~~K~~pl~~~~~~~~~~i~G~R~~Es~~~R~~~~~~~~d~~~~~~  205 (430)
                      ++++++.|+....+++...+|.+.|+.+++++||.++|++||+++++++++||+|+||+||+++|+.++++++|+.+++.
T Consensus       168 l~l~~~~p~~~~~~~~~~~~G~~~~~~~~~~~CC~irKVePL~raL~~~~awitG~Rr~Qs~~tRa~~~~ve~d~~~~~~  247 (463)
T TIGR00424       168 IRIEYMFPDAVEVQALVRSKGLFSFYEDGHQECCRVRKVRPLRRALKGLKAWITGQRKDQSPGTRSEIPVVQVDPVFEGL  247 (463)
T ss_pred             CceEEECCCcchHHHHHHhcCcccCCcCChHHHhhHHhHHHHHHHHHhCCcEEeeeccccCccccccCCccccccccccc
Confidence            99999999877677777888998888888999999999999999999999999999999995479999999999876655


Q ss_pred             cCCCCCeEEEecccccchHHHHHHHHHcCCCCccccccCCcccCCcCCCCCCCCCCccccCCCcCCCCCcccccCCCCCc
Q 042284          206 DGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNI  285 (430)
Q Consensus       206 ~~~~~~~~~~~Pi~dWt~~dVw~yi~~~~lp~~pLY~~Gy~siGC~~Ct~~~~~~~~~r~grw~~~~~~~~e~g~~~~~i  285 (430)
                      ++++++++|+|||++||.+|||.||++|+|||||||++||+||||++||+|+.+|+++|+|||||++..|+|||||..++
T Consensus       248 ~~~~~~~iKvnPLa~Wt~~dVw~Yi~~~~LP~npL~~~GY~SIGC~pCT~pv~~ged~RaGRW~w~~~~k~ECGlH~~~~  327 (463)
T TIGR00424       248 DGGVGSLVKWNPVANVEGKDVWNFLRTMDVPVNTLHAQGYVSIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHKGNI  327 (463)
T ss_pred             ccCCCceEEEeecccCCHHHHHHHHHHcCCCCCchhhcCCCCCCCCCCCCCCCCCCCcccccccCCCCCCccCCCCCCCc
Confidence            55556699999999999999999999999999999999999999999999999999999999999999999999998766


Q ss_pred             ccccchhhhccCCCccccccCCCCCCCCCCCCCCceEcccchHHHHHHhcCCCCcEEEEEeCCCCHhHHHHHHHHHHHHH
Q 042284          286 KQEELSQHININGNGVAQHTNGSAPASDLFNSQKLVSFRRTGIENLARLQNREDPWLIVLYAPWCHFCQAMEGSYIELAE  365 (430)
Q Consensus       286 ~~~~~~~~~n~~~~~~~~~~~~~~~~~~~~~~~~v~~lt~~~f~~~i~~~~~~k~vlV~Fya~wC~~C~~~~p~~~~la~  365 (430)
                      .....         +............+++.+..|++|+.+||+.+++..+.+++|||+||||||++|+.|.|.|+++++
T Consensus       328 ~~~~~---------~~~~~~~~~~~~~dl~~~~~Vv~L~~~nf~~~v~~~~~~k~VLV~FyApWC~~Ck~m~P~~eelA~  398 (463)
T TIGR00424       328 KEETL---------DGAVNGNGSDAVADIFDSNNVVSLSRPGIENLLKLEERKEAWLVVLYAPWCPFCQAMEASYLELAE  398 (463)
T ss_pred             ccccc---------chhhhhccccccccccCCCCeEECCHHHHHHHHhhhcCCCeEEEEEECCCChHHHHHHHHHHHHHH
Confidence            43321         111233456678899988999999999999998656789999999999999999999999999999


Q ss_pred             HHcCCCeEEEEEEcCCCchHHHHHhCCCCCCCEEEEEeCCCcceeecCCCCCCHHHHHHHHHHhC
Q 042284          366 QLEGMGVKVGKFRADGDHKEFAKQKLQLVSFPTILFFPKHSAKPVKYPSEKRDVDSLMAFVNALR  430 (430)
Q Consensus       366 ~~~~~~v~~~~Vd~~~~~~~l~~~~~~V~~~Ptl~~~~~g~~~~~~~~gg~~~~~~l~~~i~~~~  430 (430)
                      ++++..+.|++||++.+...++.++|+|.++||+++|++|......|.++.++.+.|..||+.++
T Consensus       399 ~~~~~~v~~~kVdvD~~~~~~~~~~~~I~~~PTii~Fk~g~~~~~~Y~~g~R~~e~L~~Fv~~~~  463 (463)
T TIGR00424       399 KLAGSGVKVAKFRADGDQKEFAKQELQLGSFPTILFFPKHSSRPIKYPSEKRDVDSLMSFVNLLR  463 (463)
T ss_pred             HhccCCcEEEEEECCCCccHHHHHHcCCCccceEEEEECCCCCceeCCCCCCCHHHHHHHHHhhC
Confidence            99874589999999976234542689999999999999997667889865799999999999874



This enzyme, involved in the assimilation of inorganic sulfate, is closely related to the thioredoxin-dependent PAPS reductase of Bacteria (CysH) and Saccharomyces cerevisiae. However, it has its own C-terminal thioredoxin-like domain and is not thioredoxin-dependent. Also, it has a substrate preference for 5'-adenylylsulfate (APS) over 3'-phosphoadenylylsulfate (PAPS) so the pathway does not require an APS kinase (CysC) to convert APS to PAPS. Arabidopsis thaliana appears to have three isozymes, all able to complement E. coli CysH mutants (even in backgrounds lacking thioredoxin or APS kinase) but likely localized to different compartments in Arabidopsis.

>PLN02309 5'-adenylylsulfate reductase Back     alignment and domain information
>TIGR02057 PAPS_reductase phosphoadenosine phosphosulfate reductase, thioredoxin dependent Back     alignment and domain information
>KOG0189 consensus Phosphoadenosine phosphosulfate reductase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK02090 phosphoadenosine phosphosulfate reductase; Provisional Back     alignment and domain information
>TIGR00434 cysH phosophoadenylyl-sulfate reductase (thioredoxin) Back     alignment and domain information
>COG0175 CysH 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism / Coenzyme metabolism] Back     alignment and domain information
>TIGR02055 APS_reductase thioredoxin-dependent adenylylsulfate APS reductase Back     alignment and domain information
>PRK12563 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>TIGR02039 CysD sulfate adenylyltransferase, small subunit Back     alignment and domain information
>PRK08557 hypothetical protein; Provisional Back     alignment and domain information
>PRK13794 hypothetical protein; Provisional Back     alignment and domain information
>PRK05253 sulfate adenylyltransferase subunit 2; Provisional Back     alignment and domain information
>PF01507 PAPS_reduct: Phosphoadenosine phosphosulfate reductase family; InterPro: IPR002500 This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>PRK13795 hypothetical protein; Provisional Back     alignment and domain information
>PRK08576 hypothetical protein; Provisional Back     alignment and domain information
>cd01713 PAPS_reductase This domain is found in phosphoadenosine phosphosulphate (PAPS) reductase enzymes or PAPS sulphotransferase Back     alignment and domain information
>TIGR03183 DNA_S_dndC putative sulfurtransferase DndC Back     alignment and domain information
>PRK06850 hypothetical protein; Provisional Back     alignment and domain information
>COG3969 Predicted phosphoadenosine phosphosulfate sulfotransferase [General function prediction only] Back     alignment and domain information
>cd03006 PDI_a_EFP1_N PDIa family, N-terminal EFP1 subfamily; EFP1 is a binding partner protein of thyroid oxidase (ThOX), also called Duox Back     alignment and domain information
>cd03003 PDI_a_ERdj5_N PDIa family, N-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>cd03004 PDI_a_ERdj5_C PDIa family, C-terminal ERdj5 subfamily; ERdj5, also known as JPDI and macrothioredoxin, is a protein containing an N-terminal DnaJ domain and four redox active TRX domains Back     alignment and domain information
>KOG0910 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02996 PDI_a_ERp44 PDIa family, endoplasmic reticulum protein 44 (ERp44) subfamily; ERp44 is an ER-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>cd03065 PDI_b_Calsequestrin_N PDIb family, Calsequestrin subfamily, N-terminal TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>PF00085 Thioredoxin: Thioredoxin; InterPro: IPR013766 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>cd02993 PDI_a_APS_reductase PDIa family, 5'-Adenylylsulfate (APS) reductase subfamily; composed of plant-type APS reductases containing a C-terminal redox active TRX domain and an N-terminal reductase domain which is part of a superfamily that includes N type ATP PPases Back     alignment and domain information
>cd02994 PDI_a_TMX PDIa family, TMX subfamily; composed of proteins similar to the TRX-related human transmembrane protein, TMX Back     alignment and domain information
>cd02963 TRX_DnaJ TRX domain, DnaJ domain containing protein family; composed of uncharacterized proteins of about 500-800 amino acids, containing an N-terminal DnaJ domain followed by one redox active TRX domain Back     alignment and domain information
>COG3118 Thioredoxin domain-containing protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03002 PDI_a_MPD1_like PDI family, MPD1-like subfamily; composed of eukaryotic proteins similar to Saccharomyces cerevisiae MPD1 protein, which contains a single redox active TRX domain located at the N-terminus, and an ER retention signal at the C-terminus indicative of an ER-resident protein Back     alignment and domain information
>cd03001 PDI_a_P5 PDIa family, P5 subfamily; composed of eukaryotic proteins similar to human P5, a PDI-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PTZ00443 Thioredoxin domain-containing protein; Provisional Back     alignment and domain information
>PHA02278 thioredoxin-like protein Back     alignment and domain information
>cd03005 PDI_a_ERp46 PDIa family, endoplasmic reticulum protein 46 (ERp46) subfamily; ERp46 is an ER-resident protein containing three redox active TRX domains Back     alignment and domain information
>cd02954 DIM1 Dim1 family; Dim1 is also referred to as U5 small nuclear ribonucleoprotein particle (snRNP)-specific 15kD protein Back     alignment and domain information
>cd02999 PDI_a_ERp44_like PDIa family, endoplasmic reticulum protein 44 (ERp44)-like subfamily; composed of uncharacterized PDI-like eukaryotic proteins containing only one redox active TRX (a) domain with a CXXS motif, similar to ERp44 Back     alignment and domain information
>cd02948 TRX_NDPK TRX domain, TRX and NDP-kinase (NDPK) fusion protein family; most members of this group are fusion proteins which contain one redox active TRX domain containing a CXXC motif and three NDPK domains, and are characterized as intermediate chains (ICs) of axonemal outer arm dynein Back     alignment and domain information
>cd02956 ybbN ybbN protein family; ybbN is a hypothetical protein containing a redox-inactive TRX-like domain Back     alignment and domain information
>PRK09381 trxA thioredoxin; Provisional Back     alignment and domain information
>PRK10996 thioredoxin 2; Provisional Back     alignment and domain information
>cd02995 PDI_a_PDI_a'_C PDIa family, C-terminal TRX domain (a') subfamily; composed of the C-terminal redox active a' domains of PDI, ERp72, ERp57 (or ERp60) and EFP1 Back     alignment and domain information
>cd02985 TRX_CDSP32 TRX family, chloroplastic drought-induced stress protein of 32 kD (CDSP32); CDSP32 is composed of two TRX domains, a C-terminal TRX domain which contains a redox active CXXC motif and an N-terminal TRX-like domain which contains an SXXS sequence instead of the redox active motif Back     alignment and domain information
>cd02962 TMX2 TMX2 family; composed of proteins similar to human TMX2, a 372-amino acid TRX-related transmembrane protein, identified and characterized through the cloning of its cDNA from a human fetal library Back     alignment and domain information
>KOG0907 consensus Thioredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02997 PDI_a_PDIR PDIa family, PDIR subfamily; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03007 PDI_a_ERp29_N PDIa family, endoplasmic reticulum protein 29 (ERp29) subfamily; ERp29 is a ubiquitous ER-resident protein expressed in high levels in secretory cells Back     alignment and domain information
>cd02998 PDI_a_ERp38 PDIa family, endoplasmic reticulum protein 38 (ERp38) subfamily; composed of proteins similar to the P5-like protein first isolated from alfalfa, which contains two redox active TRX (a) domains at the N-terminus, like human P5, and a C-terminal domain with homology to the C-terminal domain of ERp29, unlike human P5 Back     alignment and domain information
>TIGR01126 pdi_dom protein disulfide-isomerase domain Back     alignment and domain information
>cd02965 HyaE HyaE family; HyaE is also called HupG and HoxO Back     alignment and domain information
>cd03000 PDI_a_TMX3 PDIa family, TMX3 subfamily; composed of eukaryotic proteins similar to human TMX3, a TRX related transmembrane protein containing one redox active TRX domain at the N-terminus and a classical ER retrieval sequence for type I transmembrane proteins at the C-terminus Back     alignment and domain information
>cd02989 Phd_like_TxnDC9 Phosducin (Phd)-like family, Thioredoxin (TRX) domain containing protein 9 (TxnDC9) subfamily; composed of predominantly uncharacterized eukaryotic proteins, containing a TRX-like domain without the redox active CXXC motif Back     alignment and domain information
>PLN00410 U5 snRNP protein, DIM1 family; Provisional Back     alignment and domain information
>cd02957 Phd_like Phosducin (Phd)-like family; composed of Phd and Phd-like proteins (PhLP), characterized as cytosolic regulators of G protein functions Back     alignment and domain information
>KOG0190 consensus Protein disulfide isomerase (prolyl 4-hydroxylase beta subunit) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02986 DLP Dim1 family, Dim1-like protein (DLP) subfamily; DLP is a novel protein which shares 38% sequence identity to Dim1 Back     alignment and domain information
>cd02992 PDI_a_QSOX PDIa family, Quiescin-sulfhydryl oxidase (QSOX) subfamily; QSOX is a eukaryotic protein containing an N-terminal redox active TRX domain, similar to that of PDI, and a small C-terminal flavin adenine dinucleotide (FAD)-binding domain homologous to the yeast ERV1p protein Back     alignment and domain information
>cd02961 PDI_a_family Protein Disulfide Isomerase (PDIa) family, redox active TRX domains; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR01068 thioredoxin thioredoxin Back     alignment and domain information
>cd02953 DsbDgamma DsbD gamma family; DsbD gamma is the C-terminal periplasmic domain of the bacterial protein DsbD Back     alignment and domain information
>cd02984 TRX_PICOT TRX domain, PICOT (for PKC-interacting cousin of TRX) subfamily; PICOT is a protein that interacts with protein kinase C (PKC) theta, a calcium independent PKC isoform selectively expressed in skeletal muscle and T lymphocytes Back     alignment and domain information
>cd02987 Phd_like_Phd Phosducin (Phd)-like family, Phd subfamily; Phd is a cytosolic regulator of G protein functions Back     alignment and domain information
>cd02950 TxlA TRX-like protein A (TxlA) family; TxlA was originally isolated from the cyanobacterium Synechococcus Back     alignment and domain information
>PTZ00051 thioredoxin; Provisional Back     alignment and domain information
>cd02949 TRX_NTR TRX domain, novel NADPH thioredoxin reductase (NTR) family; composed of fusion proteins found only in oxygenic photosynthetic organisms containing both TRX and NTR domains Back     alignment and domain information
>cd01992 PP-ATPase N-terminal domain of predicted ATPase of the PP-loop faimly implicated in cell cycle control [Cell division and chromosome partitioning] Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>PTZ00102 disulphide isomerase; Provisional Back     alignment and domain information
>KOG4277 consensus Uncharacterized conserved protein, contains thioredoxin domain [General function prediction only] Back     alignment and domain information
>cd02975 PfPDO_like_N Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO)-like family, N-terminal TRX-fold subdomain; composed of proteins with similarity to PfPDO, a redox active thermostable protein believed to be the archaeal counterpart of bacterial DsbA and eukaryotic protein disulfide isomerase (PDI), which are both involved in oxidative protein folding Back     alignment and domain information
>TIGR01295 PedC_BrcD bacteriocin transport accessory protein, putative Back     alignment and domain information
>KOG0908 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02951 SoxW SoxW family; SoxW is a bacterial periplasmic TRX, containing a redox active CXXC motif, encoded by a genetic locus (sox operon) involved in thiosulfate oxidation Back     alignment and domain information
>cd02988 Phd_like_VIAF Phosducin (Phd)-like family, Viral inhibitor of apoptosis (IAP)-associated factor (VIAF) subfamily; VIAF is a Phd-like protein that functions in caspase activation during apoptosis Back     alignment and domain information
>KOG0912 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>TIGR02432 lysidine_TilS_N tRNA(Ile)-lysidine synthetase, N-terminal domain Back     alignment and domain information
>cd02952 TRP14_like Human TRX-related protein 14 (TRP14)-like family; composed of proteins similar to TRP14, a 14kD cytosolic protein that shows disulfide reductase activity in vitro with a different substrate specificity compared with another human cytosolic protein, TRX1 Back     alignment and domain information
>cd02947 TRX_family TRX family; composed of two groups: Group I, which includes proteins that exclusively encode a TRX domain; and Group II, which are composed of fusion proteins of TRX and additional domains Back     alignment and domain information
>KOG2644 consensus 3'-phosphoadenosine 5'-phosphosulfate sulfotransferase (PAPS reductase)/FAD synthetase and related enzymes [Amino acid transport and metabolism; Coenzyme transport and metabolism] Back     alignment and domain information
>cd01993 Alpha_ANH_like_II This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd02982 PDI_b'_family Protein Disulfide Isomerase (PDIb') family, redox inactive TRX-like domain b'; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>TIGR01130 ER_PDI_fam protein disulfide isomerases, eukaryotic Back     alignment and domain information
>COG1606 ATP-utilizing enzymes of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>TIGR00411 redox_disulf_1 small redox-active disulfide protein 1 Back     alignment and domain information
>PRK10696 tRNA 2-thiocytidine biosynthesis protein TtcA; Provisional Back     alignment and domain information
>TIGR00268 conserved hypothetical protein TIGR00268 Back     alignment and domain information
>cd02959 ERp19 Endoplasmic reticulum protein 19 (ERp19) family; ERp19 is also known as ERp18, a protein located in the ER containing one redox active TRX domain Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>KOG0191 consensus Thioredoxin/protein disulfide isomerase [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PF01171 ATP_bind_3: PP-loop family; InterPro: IPR011063 This entry represents the PP-loop motif superfamily [,] Back     alignment and domain information
>PRK00293 dipZ thiol:disulfide interchange protein precursor; Provisional Back     alignment and domain information
>cd02955 SSP411 TRX domain, SSP411 protein family; members of this family are highly conserved proteins present in eukaryotes, bacteria and archaea, about 600-800 amino acids in length, which contain a TRX domain with a redox active CXXC motif Back     alignment and domain information
>cd01990 Alpha_ANH_like_I This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>COG0037 MesJ tRNA(Ile)-lysidine synthase MesJ [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>PHA02125 thioredoxin-like protein Back     alignment and domain information
>TIGR00412 redox_disulf_2 small redox-active disulfide protein 2 Back     alignment and domain information
>KOG1731 consensus FAD-dependent sulfhydryl oxidase/quiescin and related proteins [Cell cycle control, cell division, chromosome partitioning] Back     alignment and domain information
>TIGR02187 GlrX_arch Glutaredoxin-like domain protein Back     alignment and domain information
>PRK03147 thiol-disulfide oxidoreductase; Provisional Back     alignment and domain information
>PRK14018 trifunctional thioredoxin/methionine sulfoxide reductase A/B protein; Provisional Back     alignment and domain information
>TIGR02740 TraF-like TraF-like protein Back     alignment and domain information
>cd01997 GMP_synthase_C The C-terminal domain of GMP synthetase Back     alignment and domain information
>TIGR02738 TrbB type-F conjugative transfer system pilin assembly thiol-disulfide isomerase TrbB Back     alignment and domain information
>PF13098 Thioredoxin_2: Thioredoxin-like domain; PDB: 1T3B_A 2L57_A 1EEJ_B 1TJD_A 1JZD_B 1JZO_A 1G0T_B 3GV1_A 1V58_A 2H0H_A Back     alignment and domain information
>PRK00919 GMP synthase subunit B; Validated Back     alignment and domain information
>cd01712 ThiI ThiI is required for thiazole synthesis in the thiamine biosynthesis pathway Back     alignment and domain information
>PRK00074 guaA GMP synthase; Reviewed Back     alignment and domain information
>TIGR00884 guaA_Cterm GMP synthase (glutamine-hydrolyzing), C-terminal domain or B subunit Back     alignment and domain information
>cd01995 ExsB ExsB is a transcription regulator related protein Back     alignment and domain information
>cd03008 TryX_like_RdCVF Tryparedoxin (TryX)-like family, Rod-derived cone viability factor (RdCVF) subfamily; RdCVF is a thioredoxin (TRX)-like protein specifically expressed in photoreceptors Back     alignment and domain information
>PF13905 Thioredoxin_8: Thioredoxin-like; PDB: 1FG4_A 1I5G_A 1OC8_B 1O6J_A 1OC9_B 1O81_A 3FKF_A 1O85_A 1O7U_A 1O8W_A Back     alignment and domain information
>cd03009 TryX_like_TryX_NRX Tryparedoxin (TryX)-like family, TryX and nucleoredoxin (NRX) subfamily; TryX and NRX are thioredoxin (TRX)-like protein disulfide oxidoreductases that alter the redox state of target proteins via the reversible oxidation of an active center CXXC motif Back     alignment and domain information
>PRK00143 mnmA tRNA-specific 2-thiouridylase MnmA; Reviewed Back     alignment and domain information
>cd02964 TryX_like_family Tryparedoxin (TryX)-like family; composed of TryX and related proteins including nucleoredoxin (NRX), rod-derived cone viability factor (RdCVF) and the nematode homolog described as a 16-kD class of TRX Back     alignment and domain information
>cd02973 TRX_GRX_like Thioredoxin (TRX)-Glutaredoxin (GRX)-like family; composed of archaeal and bacterial proteins that show similarity to both TRX and GRX, including the C-terminal TRX-fold subdomain of Pyrococcus furiosus protein disulfide oxidoreductase (PfPDO) Back     alignment and domain information
>PRK15412 thiol:disulfide interchange protein DsbE; Provisional Back     alignment and domain information
>PRK11509 hydrogenase-1 operon protein HyaE; Provisional Back     alignment and domain information
>PRK14561 hypothetical protein; Provisional Back     alignment and domain information
>cd03010 TlpA_like_DsbE TlpA-like family, DsbE (also known as CcmG and CycY) subfamily; DsbE is a membrane-anchored, periplasmic TRX-like reductase containing a CXXC motif that specifically donates reducing equivalents to apocytochrome c via CcmH, another cytochrome c maturation (Ccm) factor with a redox active CXXC motif Back     alignment and domain information
>cd03011 TlpA_like_ScsD_MtbDsbE TlpA-like family, suppressor for copper sensitivity D protein (ScsD) and actinobacterial DsbE homolog subfamily; composed of ScsD, the DsbE homolog of Mycobacterium tuberculosis (MtbDsbE) and similar proteins, all containing a redox-active CXXC motif Back     alignment and domain information
>TIGR00385 dsbE periplasmic protein thiol:disulfide oxidoreductases, DsbE subfamily Back     alignment and domain information
>cd02958 UAS UAS family; UAS is a domain of unknown function Back     alignment and domain information
>TIGR00420 trmU tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase Back     alignment and domain information
>PRK14665 mnmA tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>COG4232 Thiol:disulfide interchange protein [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>cd01998 tRNA_Me_trans tRNA methyl transferase Back     alignment and domain information
>cd02966 TlpA_like_family TlpA-like family; composed of TlpA, ResA, DsbE and similar proteins Back     alignment and domain information
>PRK10660 tilS tRNA(Ile)-lysidine synthetase; Provisional Back     alignment and domain information
>cd03026 AhpF_NTD_C TRX-GRX-like family, Alkyl hydroperoxide reductase F subunit (AhpF) N-terminal domain (NTD) subfamily, C-terminal TRX-fold subdomain; AhpF is a homodimeric flavoenzyme which catalyzes the NADH-dependent reduction of the peroxiredoxin AhpC, which then reduces hydrogen peroxide and organic hydroperoxides Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK08349 hypothetical protein; Validated Back     alignment and domain information
>PLN02347 GMP synthetase Back     alignment and domain information
>KOG0913 consensus Thiol-disulfide isomerase and thioredoxin [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>cd02967 mauD Methylamine utilization (mau) D family; mauD protein is the translation product of the mauD gene found in methylotrophic bacteria, which are able to use methylamine as a sole carbon source and a nitrogen source Back     alignment and domain information
>KOG0914 consensus Thioredoxin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00552 nadE NAD+ synthetase Back     alignment and domain information
>cd03012 TlpA_like_DipZ_like TlpA-like family, DipZ-like subfamily; composed uncharacterized proteins containing a TlpA-like TRX domain Back     alignment and domain information
>PRK13728 conjugal transfer protein TrbB; Provisional Back     alignment and domain information
>TIGR00364 exsB protein Back     alignment and domain information
>cd01996 Alpha_ANH_like_III This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>PF13899 Thioredoxin_7: Thioredoxin-like; PDB: 2LST_A 3PH9_A 1UC7_A 2JU5_A 1VRS_D 2FWG_A 2FWF_A 2FWH_A 2FWE_A 3FK8_A Back     alignment and domain information
>PRK11106 queuosine biosynthesis protein QueC; Provisional Back     alignment and domain information
>cd00553 NAD_synthase NAD+ synthase is a homodimer, which catalyzes the final step in de novo nicotinamide adenine dinucleotide (NAD+) biosynthesis, an amide transfer from either ammonia or glutamine to nicotinic acid adenine dinucleotide (NaAD) Back     alignment and domain information
>cd02960 AGR Anterior Gradient (AGR) family; members of this family are similar to secreted proteins encoded by the cement gland-specific genes XAG-1 and XAG-2, expressed in the anterior region of dorsal ectoderm of Xenopus Back     alignment and domain information
>cd01999 Argininosuccinate_Synthase Argininosuccinate synthase Back     alignment and domain information
>PLN00200 argininosuccinate synthase; Provisional Back     alignment and domain information
>smart00594 UAS UAS domain Back     alignment and domain information
>TIGR00032 argG argininosuccinate synthase Back     alignment and domain information
>TIGR02661 MauD methylamine dehydrogenase accessory protein MauD Back     alignment and domain information
>TIGR00342 thiazole biosynthesis/tRNA modification protein ThiI Back     alignment and domain information
>PF08534 Redoxin: Redoxin; InterPro: IPR013740 This redoxin domain is found in peroxiredoxin, thioredoxin and glutaredoxin proteins Back     alignment and domain information
>PRK13820 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK00509 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK08384 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>PRK04527 argininosuccinate synthase; Provisional Back     alignment and domain information
>PRK13980 NAD synthetase; Provisional Back     alignment and domain information
>PTZ00056 glutathione peroxidase; Provisional Back     alignment and domain information
>PLN02399 phospholipid hydroperoxide glutathione peroxidase Back     alignment and domain information
>PRK14664 tRNA-specific 2-thiouridylase MnmA; Provisional Back     alignment and domain information
>PF02114 Phosducin: Phosducin; InterPro: IPR024253 The outer and inner segments of vertebrate rod photoreceptor cells contain phosducin, a soluble phosphoprotein that complexes with the beta/gamma-subunits of the GTP-binding protein, transducin Back     alignment and domain information
>PRK01565 thiamine biosynthesis protein ThiI; Provisional Back     alignment and domain information
>COG2143 Thioredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR02540 gpx7 putative glutathione peroxidase Gpx7 Back     alignment and domain information
>TIGR03573 WbuX N-acetyl sugar amidotransferase Back     alignment and domain information
>PLN02412 probable glutathione peroxidase Back     alignment and domain information
>PF06508 QueC: Queuosine biosynthesis protein QueC; InterPro: IPR018317 This protein family is represented by a single member in nearly every completed large (> 1000 genes) prokaryotic genome Back     alignment and domain information
>cd02969 PRX_like1 Peroxiredoxin (PRX)-like 1 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>COG0526 TrxA Thiol-disulfide isomerase and thioredoxins [Posttranslational modification, protein turnover, chaperones / Energy production and conversion] Back     alignment and domain information
>PF13728 TraF: F plasmid transfer operon protein Back     alignment and domain information
>cd00340 GSH_Peroxidase Glutathione (GSH) peroxidase family; tetrameric selenoenzymes that catalyze the reduction of a variety of hydroperoxides including lipid peroxidases, using GSH as a specific electron donor substrate Back     alignment and domain information
>TIGR01626 ytfJ_HI0045 conserved hypothetical protein YtfJ-family, TIGR01626 Back     alignment and domain information
>TIGR02196 GlrX_YruB Glutaredoxin-like protein, YruB-family Back     alignment and domain information
>cd01994 Alpha_ANH_like_IV This is a subfamily of Adenine nucleotide alpha hydrolases superfamily Back     alignment and domain information
>cd01659 TRX_superfamily Thioredoxin (TRX) superfamily; a large, diverse group of proteins containing a TRX-fold Back     alignment and domain information
>PRK01269 tRNA s(4)U8 sulfurtransferase; Provisional Back     alignment and domain information
>KOG2501 consensus Thioredoxin, nucleoredoxin and related proteins [General function prediction only] Back     alignment and domain information
>PF01216 Calsequestrin: Calsequestrin; InterPro: IPR001393 Calsequestrin is the principal calcium-binding protein present in the sarcoplasmic reticulum of cardiac and skeletal muscle [] Back     alignment and domain information
>COG2117 Predicted subunit of tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF00578 AhpC-TSA: AhpC/TSA family; InterPro: IPR000866 Peroxiredoxins (Prxs) are a ubiquitous family of antioxidant enzymes that also control cytokine-induced peroxide levels which mediate signal transduction in mammalian cells Back     alignment and domain information
>TIGR02200 GlrX_actino Glutaredoxin-like protein Back     alignment and domain information
>cd03017 PRX_BCP Peroxiredoxin (PRX) family, Bacterioferritin comigratory protein (BCP) subfamily; composed of thioredoxin-dependent thiol peroxidases, widely expressed in pathogenic bacteria, that protect cells against toxicity from reactive oxygen species by reducing and detoxifying hydroperoxides Back     alignment and domain information
>PF03190 Thioredox_DsbH: Protein of unknown function, DUF255; InterPro: IPR004879 This is a group of uncharacterised proteins Back     alignment and domain information
>PF03054 tRNA_Me_trans: tRNA methyl transferase; InterPro: IPR004506 tRNA-specific 2-thiouridylase catalyzes the 2-thiolation of uridine at the wobble position (U34) of tRNA, leading to the formation of s(2)U34 Back     alignment and domain information
>TIGR03137 AhpC peroxiredoxin Back     alignment and domain information
>PF02540 NAD_synthase: NAD synthase; InterPro: IPR022310 NAD+ synthase (6 Back     alignment and domain information
>PTZ00323 NAD+ synthase; Provisional Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>PTZ00256 glutathione peroxidase; Provisional Back     alignment and domain information
>PF06110 DUF953: Eukaryotic protein of unknown function (DUF953); InterPro: IPR010357 This family consists of several hypothetical eukaryotic proteins of unknown function that are thioredoxin-like Back     alignment and domain information
>cd03015 PRX_Typ2cys Peroxiredoxin (PRX) family, Typical 2-Cys PRX subfamily; PRXs are thiol-specific antioxidant (TSA) proteins, which confer a protective role in cells through its peroxidase activity by reducing hydrogen peroxide, peroxynitrite, and organic hydroperoxides Back     alignment and domain information
>TIGR02739 TraF type-F conjugative transfer system pilin assembly protein TraF Back     alignment and domain information
>cd01986 Alpha_ANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases and ATP sulphurylases Back     alignment and domain information
>COG0603 Predicted PP-loop superfamily ATPase [General function prediction only] Back     alignment and domain information
>PRK09437 bcp thioredoxin-dependent thiol peroxidase; Reviewed Back     alignment and domain information
>cd02970 PRX_like2 Peroxiredoxin (PRX)-like 2 family; hypothetical proteins that show sequence similarity to PRXs Back     alignment and domain information
>COG0482 TrmU Predicted tRNA(5-methylaminomethyl-2-thiouridylate) methyltransferase, contains the PP-loop ATPase domain [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>KOG1672 consensus ATP binding protein [Posttranslational modification, protein turnover, chaperones; Energy production and conversion] Back     alignment and domain information
>cd02991 UAS_ETEA UAS family, ETEA subfamily; composed of proteins similar to human ETEA protein, the translation product of a highly expressed gene in the T-cells and eosinophils of atopic dermatitis patients compared with those of normal individuals Back     alignment and domain information
>PRK13703 conjugal pilus assembly protein TraF; Provisional Back     alignment and domain information
>PF02568 ThiI: Thiamine biosynthesis protein (ThiI); InterPro: IPR020536 Thiamine pyrophosphate (TPP) is synthesized de novo in many bacteria and is a required cofactor for many enzymes in the cell Back     alignment and domain information
>KOG3425 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF07912 ERp29_N: ERp29, N-terminal domain; InterPro: IPR012883 ERp29 (P52555 from SWISSPROT) is a ubiquitously expressed endoplasmic reticulum protein, and is involved in the processes of protein maturation and protein secretion in this organelle [, ] Back     alignment and domain information
>KOG2603 consensus Oligosaccharyltransferase, gamma subunit [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10382 alkyl hydroperoxide reductase subunit C; Provisional Back     alignment and domain information
>PRK00522 tpx lipid hydroperoxide peroxidase; Provisional Back     alignment and domain information
>TIGR02180 GRX_euk Glutaredoxin Back     alignment and domain information
>KOG3414 consensus Component of the U4/U6 Back     alignment and domain information
>PF14595 Thioredoxin_9: Thioredoxin; PDB: 1Z6N_A Back     alignment and domain information
>PRK13190 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR03679 arCOG00187 arCOG00187 universal archaeal metal-binding-domain/4Fe-4S-binding-domain containing ABC transporter, ATP-binding protein Back     alignment and domain information
>cd03018 PRX_AhpE_like Peroxiredoxin (PRX) family, AhpE-like subfamily; composed of proteins similar to Mycobacterium tuberculosis AhpE Back     alignment and domain information
>PF13192 Thioredoxin_3: Thioredoxin domain; PDB: 1ZYP_B 1ZYN_A 1HYU_A 1ILO_A 1J08_F 2YWM_B 2AYT_B 2HLS_B 1A8L_A 2K8S_B Back     alignment and domain information
>cd03014 PRX_Atyp2cys Peroxiredoxin (PRX) family, Atypical 2-cys PRX subfamily; composed of PRXs containing peroxidatic and resolving cysteines, similar to the homodimeric thiol specific antioxidant (TSA) protein also known as TRX-dependent thiol peroxidase (Tpx) Back     alignment and domain information
>PRK15000 peroxidase; Provisional Back     alignment and domain information
>cd03072 PDI_b'_ERp44 PDIb' family, ERp44 subfamily, second redox inactive TRX-like domain b'; ERp44 is an endoplasmic reticulum (ER)-resident protein, induced during stress, involved in thiol-mediated ER retention Back     alignment and domain information
>KOG2805 consensus tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PRK00876 nadE NAD synthetase; Reviewed Back     alignment and domain information
>cd02983 P5_C P5 family, C-terminal redox inactive TRX-like domain; P5 is a protein disulfide isomerase (PDI)-related protein with a domain structure of aa'b (where a and a' are redox active TRX domains and b is a redox inactive TRX-like domain) Back     alignment and domain information
>PTZ00137 2-Cys peroxiredoxin; Provisional Back     alignment and domain information
>cd03016 PRX_1cys Peroxiredoxin (PRX) family, 1-cys PRX subfamily; composed of PRXs containing only one conserved cysteine, which serves as the peroxidatic cysteine Back     alignment and domain information
>cd02971 PRX_family Peroxiredoxin (PRX) family; composed of the different classes of PRXs including many proteins originally known as bacterioferritin comigratory proteins (BCP), based on their electrophoretic mobility before their function was identified Back     alignment and domain information
>cd01991 Asn_Synthase_B_C The C-terminal domain of Asparagine Synthase B Back     alignment and domain information
>PRK11200 grxA glutaredoxin 1; Provisional Back     alignment and domain information
>cd02976 NrdH NrdH-redoxin (NrdH) family; NrdH is a small monomeric protein with a conserved redox active CXXC motif within a TRX fold, characterized by a glutaredoxin (GRX)-like sequence and TRX-like activity profile Back     alignment and domain information
>cd03073 PDI_b'_ERp72_ERp57 PDIb' family, ERp72 and ERp57 subfamily, second redox inactive TRX-like domain b'; ERp72 and ER57 are involved in oxidative protein folding in the ER, like PDI Back     alignment and domain information
>PF02966 DIM1: Mitosis protein DIM1; InterPro: IPR004123 Thioredoxins [, , , ] are small disulphide-containing redox proteins that have been found in all the kingdoms of living organisms Back     alignment and domain information
>KOG0911 consensus Glutaredoxin-related protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd02968 SCO SCO (an acronym for Synthesis of Cytochrome c Oxidase) family; composed of proteins similar to Sco1, a membrane-anchored protein possessing a soluble domain with a TRX fold Back     alignment and domain information
>cd02981 PDI_b_family Protein Disulfide Isomerase (PDIb) family, redox inactive TRX-like domain b; composed of eukaryotic proteins involved in oxidative protein folding in the endoplasmic reticulum (ER) by acting as catalysts and folding assistants Back     alignment and domain information
>PRK13599 putative peroxiredoxin; Provisional Back     alignment and domain information
>PRK00768 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK10877 protein disulfide isomerase II DsbC; Provisional Back     alignment and domain information
>PRK05370 argininosuccinate synthase; Validated Back     alignment and domain information
>PRK13981 NAD synthetase; Provisional Back     alignment and domain information
>PRK13189 peroxiredoxin; Provisional Back     alignment and domain information
>PRK02628 nadE NAD synthetase; Reviewed Back     alignment and domain information
>PRK13191 putative peroxiredoxin; Provisional Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>PRK15317 alkyl hydroperoxide reductase subunit F; Provisional Back     alignment and domain information
>PRK10606 btuE putative glutathione peroxidase; Provisional Back     alignment and domain information
>TIGR02183 GRXA Glutaredoxin, GrxA family Back     alignment and domain information
>COG0519 GuaA GMP synthase, PP-ATPase domain/subunit [Nucleotide transport and metabolism] Back     alignment and domain information
>KOG3170 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PTZ00253 tryparedoxin peroxidase; Provisional Back     alignment and domain information
>PF00462 Glutaredoxin: Glutaredoxin; InterPro: IPR002109 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF05768 DUF836: Glutaredoxin-like domain (DUF836); InterPro: IPR008554 Glutaredoxins [, , ], also known as thioltransferases (disulphide reductases, are small proteins of approximately one hundred amino-acid residues which utilise glutathione and NADPH as cofactors Back     alignment and domain information
>PF11009 DUF2847: Protein of unknown function (DUF2847); InterPro: IPR022551 Members of this protein family, including YtxJ from Bacillus subtilis, occur in species that encode proteins for synthesizing bacillithiol Back     alignment and domain information
>PF00764 Arginosuc_synth: Arginosuccinate synthase; InterPro: IPR001518 Argininosuccinate synthase (6 Back     alignment and domain information
>TIGR00290 MJ0570_dom MJ0570-related uncharacterized domain Back     alignment and domain information
>cd03020 DsbA_DsbC_DsbG DsbA family, DsbC and DsbG subfamily; V-shaped homodimeric proteins containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>cd03419 GRX_GRXh_1_2_like Glutaredoxin (GRX) family, GRX human class 1 and 2 (h_1_2)-like subfamily; composed of proteins similar to human GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR03140 AhpF alkyl hydroperoxide reductase, F subunit Back     alignment and domain information
>KOG3171 consensus Conserved phosducin-like protein [Signal transduction mechanisms] Back     alignment and domain information
>PF00837 T4_deiodinase: Iodothyronine deiodinase; InterPro: IPR000643 Iodothyronine deiodinase (1 Back     alignment and domain information
>PF00733 Asn_synthase: Asparagine synthase; InterPro: IPR001962 This domain is always found associated with (IPR000583 from INTERPRO) Back     alignment and domain information
>COG0301 ThiI Thiamine biosynthesis ATP pyrophosphatase [Coenzyme metabolism] Back     alignment and domain information
>cd03067 PDI_b_PDIR_N PDIb family, PDIR subfamily, N-terminal TRX-like b domain; composed of proteins similar to human PDIR (for Protein Disulfide Isomerase Related) Back     alignment and domain information
>PRK10329 glutaredoxin-like protein; Provisional Back     alignment and domain information
>COG0171 NadE NAD synthase [Coenzyme metabolism] Back     alignment and domain information
>PF07449 HyaE: Hydrogenase-1 expression protein HyaE; InterPro: IPR010893 This family contains bacterial hydrogenase-1 expression proteins approximately 120 residues long Back     alignment and domain information
>TIGR02194 GlrX_NrdH Glutaredoxin-like protein NrdH Back     alignment and domain information
>cd02066 GRX_family Glutaredoxin (GRX) family; composed of GRX, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>KOG2840 consensus Uncharacterized conserved protein with similarity to predicted ATPase of the PP-loop superfamily [General function prediction only] Back     alignment and domain information
>COG0137 ArgG Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR00289 conserved hypothetical protein TIGR00289 Back     alignment and domain information
>TIGR01536 asn_synth_AEB asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>TIGR02190 GlrX-dom Glutaredoxin-family domain Back     alignment and domain information
>PRK11657 dsbG disulfide isomerase/thiol-disulfide oxidase; Provisional Back     alignment and domain information
>TIGR02181 GRX_bact Glutaredoxin, GrxC family Back     alignment and domain information
>cd01984 AANH_like Adenine nucleotide alpha hydrolases superfamily including N type ATP PPases, ATP sulphurylases Universal Stress Response protein and electron transfer flavoprotein (ETF) Back     alignment and domain information
>cd03418 GRX_GRXb_1_3_like Glutaredoxin (GRX) family, GRX bacterial class 1 and 3 (b_1_3)-like subfamily; composed of bacterial GRXs, approximately 10 kDa in size, and proteins containing a GRX or GRX-like domain Back     alignment and domain information
>TIGR02189 GlrX-like_plant Glutaredoxin-like family Back     alignment and domain information
>cd03027 GRX_DEP Glutaredoxin (GRX) family, Dishevelled, Egl-10, and Pleckstrin (DEP) subfamily; composed of uncharacterized proteins containing a GRX domain and additional domains DEP and DUF547, both of which have unknown functions Back     alignment and domain information
>PF13848 Thioredoxin_6: Thioredoxin-like domain; PDB: 3EC3_B 3BOA_A 2B5E_A 1BJX_A 2K18_A 3UEM_A 3BJ5_A 2BJX_A 2R2J_A 2L4C_A Back     alignment and domain information
>PHA03050 glutaredoxin; Provisional Back     alignment and domain information
>cd02972 DsbA_family DsbA family; consists of DsbA and DsbA-like proteins, including DsbC, DsbG, glutathione (GSH) S-transferase kappa (GSTK), 2-hydroxychromene-2-carboxylate (HCCA) isomerase, an oxidoreductase (FrnE) presumed to be involved in frenolicin biosynthesis, a 27-kDa outer membrane protein, and similar proteins Back     alignment and domain information
>COG1365 Predicted ATPase (PP-loop superfamily) [General function prediction only] Back     alignment and domain information
>TIGR03143 AhpF_homolog putative alkyl hydroperoxide reductase F subunit Back     alignment and domain information
>cd03029 GRX_hybridPRX5 Glutaredoxin (GRX) family, PRX5 hybrid subfamily; composed of hybrid proteins containing peroxiredoxin (PRX) and GRX domains, which is found in some pathogenic bacteria and cyanobacteria Back     alignment and domain information
>COG2102 Predicted ATPases of PP-loop superfamily [General function prediction only] Back     alignment and domain information
>COG0695 GrxC Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR00365 monothiol glutaredoxin, Grx4 family Back     alignment and domain information
>KOG1622 consensus GMP synthase [Nucleotide transport and metabolism] Back     alignment and domain information
>cd03028 GRX_PICOT_like Glutaredoxin (GRX) family, PKC-interacting cousin of TRX (PICOT)-like subfamily; composed of PICOT and GRX-PICOT-like proteins Back     alignment and domain information
>PRK10638 glutaredoxin 3; Provisional Back     alignment and domain information
>cd03069 PDI_b_ERp57 PDIb family, ERp57 subfamily, first redox inactive TRX-like domain b; ERp57 (or ERp60) exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PF01902 ATP_bind_4: ATP-binding region; InterPro: IPR002761 This domain is about 200 amino acids long with a strongly conserved motif SGGKD at the N-terminal Back     alignment and domain information
>cd03066 PDI_b_Calsequestrin_middle PDIb family, Calsequestrin subfamily, Middle TRX-fold domain; Calsequestrin is the major calcium storage protein in the sarcoplasmic reticulum (SR) of skeletal and cardiac muscle Back     alignment and domain information
>KOG1752 consensus Glutaredoxin and related proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd03023 DsbA_Com1_like DsbA family, Com1-like subfamily; composed of proteins similar to Com1, a 27-kDa outer membrane-associated immunoreactive protein originally found in both acute and chronic disease strains of the pathogenic bacteria Coxiella burnetti Back     alignment and domain information
>COG1331 Highly conserved protein containing a thioredoxin domain [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK10824 glutaredoxin-4; Provisional Back     alignment and domain information
>COG1225 Bcp Peroxiredoxin [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG2640 consensus Thioredoxin [Function unknown] Back     alignment and domain information
>PF13462 Thioredoxin_4: Thioredoxin; PDB: 3FEU_A 3HZ8_A 3DVW_A 3A3T_E 3GMF_A 1Z6M_A 3GYK_C 3BCK_A 3BD2_A 3BCI_A Back     alignment and domain information
>cd03019 DsbA_DsbA DsbA family, DsbA subfamily; DsbA is a monomeric thiol disulfide oxidoreductase protein containing a redox active CXXC motif imbedded in a TRX fold Back     alignment and domain information
>COG0367 AsnB Asparagine synthase (glutamine-hydrolyzing) [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR03108 eps_aminotran_1 exosortase 1 system-associated amidotransferase 1 Back     alignment and domain information
>PRK12759 bifunctional gluaredoxin/ribonucleoside-diphosphate reductase subunit beta; Provisional Back     alignment and domain information
>PTZ00062 glutaredoxin; Provisional Back     alignment and domain information
>PLN02549 asparagine synthase (glutamine-hydrolyzing) Back     alignment and domain information
>cd03013 PRX5_like Peroxiredoxin (PRX) family, PRX5-like subfamily; members are similar to the human protein, PRX5, a homodimeric TRX peroxidase, widely expressed in tissues and found cellularly in mitochondria, peroxisomes and the cytosol Back     alignment and domain information
>TIGR03104 trio_amidotrans asparagine synthase family amidotransferase Back     alignment and domain information
>PTZ00077 asparagine synthetase-like protein; Provisional Back     alignment and domain information
>PRK10954 periplasmic protein disulfide isomerase I; Provisional Back     alignment and domain information
>cd02978 KaiB_like KaiB-like family; composed of the circadian clock proteins, KaiB and the N-terminal KaiB-like sensory domain of SasA Back     alignment and domain information
>PRK09431 asnB asparagine synthetase B; Provisional Back     alignment and domain information
>cd03068 PDI_b_ERp72 PDIb family, ERp72 subfamily, first redox inactive TRX-like domain b; ERp72 exhibits both disulfide oxidase and reductase functions like PDI, by catalyzing the formation of disulfide bonds of newly synthesized polypeptides in the ER and acting as isomerases to correct any non-native disulfide bonds Back     alignment and domain information
>PLN02339 NAD+ synthase (glutamine-hydrolysing) Back     alignment and domain information
>cd03031 GRX_GRX_like Glutaredoxin (GRX) family, GRX-like domain containing protein subfamily; composed of uncharacterized eukaryotic proteins containing a GRX-like domain having only one conserved cysteine, aligning to the C-terminal cysteine of the CXXC motif of GRXs Back     alignment and domain information
>KOG1706 consensus Argininosuccinate synthase [Amino acid transport and metabolism] Back     alignment and domain information
>KOG0573 consensus Asparagine synthase [Amino acid transport and metabolism] Back     alignment and domain information
>PHA03075 glutaredoxin-like protein; Provisional Back     alignment and domain information
>PRK09301 circadian clock protein KaiB; Provisional Back     alignment and domain information
>cd03060 GST_N_Omega_like GST_N family, Omega-like subfamily; composed of uncharacterized proteins with similarity to class Omega GSTs Back     alignment and domain information
>TIGR02654 circ_KaiB circadian clock protein KaiB Back     alignment and domain information
>KOG2507 consensus Ubiquitin regulatory protein UBXD2, contains UAS and UBX domains [General function prediction only] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
2goy_A275 Crystal Structure Of Assimilatory Adenosine 5'- Pho 4e-80
2oq2_A261 Crystal Structure Of Yeast Paps Reductase With Pap, 1e-14
2o8v_A252 Paps Reductase In A Covalent Complex With Thioredox 5e-12
1sur_A215 Phospho-Adenylyl-Sulfate Reductase Length = 215 3e-09
2dj3_A133 The Solution Structure Of The Third Thioredoxin Dom 1e-06
2dml_A130 The Solution Structure Of The First Thioredoxin Dom 4e-06
3apo_A 780 Crystal Structure Of Full-Length Erdj5 Length = 780 2e-05
2b5e_A504 Crystal Structure Of Yeast Protein Disulfide Isomer 4e-05
1mek_A120 Human Protein Disulfide Isomerase, Nmr, 40 Structur 6e-05
2diz_A117 The Solution Structure Of The Third Thioredoxin Dom 2e-04
3f8u_A481 TapasinERP57 HETERODIMER Length = 481 2e-04
1x5d_A133 The Solution Structure Of The Second Thioredoxin-Li 2e-04
3uvt_A111 Crystal Structure Of The Third Catalytic Domain Of 2e-04
3uj1_A110 Crystal Structure Of The Third Thioredoxin Domain O 3e-04
2dmm_A142 The Solution Structure Of The Second Thioredoxin Do 6e-04
2dj2_A120 The Solution Structure Of The Second Thioredoxin Do 8e-04
>pdb|2GOY|A Chain A, Crystal Structure Of Assimilatory Adenosine 5'- Phosphosulfate Reductase With Bound Aps Length = 275 Back     alignment and structure

Iteration: 1

Score = 295 bits (754), Expect = 4e-80, Method: Compositional matrix adjust. Identities = 134/243 (55%), Positives = 179/243 (73%), Gaps = 3/243 (1%) Query: 48 DYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDTG 107 D LA + SP +I+ AF+ FG+++ I+FSGAEDVVL++ A R +VFSLDTG Sbjct: 29 DLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLNRNVKVFSLDTG 88 Query: 108 RLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPL 167 RL+PET++F D V +HYGI I+ P+ ++ LV+ KGLFSFY DGH ECC IRK+ PL Sbjct: 89 RLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPL 148 Query: 168 KRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDIW 227 KR L G+RAW TGQR+DQSPGTR+++ V++ID +F + L K+NPL+++ +++W Sbjct: 149 KRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAF---STPEKPLYKFNPLSSMTSEEVW 205 Query: 228 NFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIKQ 287 ++R + +P NSLH +GYISIGCEPCTRPVLP QHEREGRWWWE+A KECGLH GN+ Sbjct: 206 GYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHAGNLIS 265 Query: 288 EEL 290 + L Sbjct: 266 KAL 268
>pdb|2OQ2|A Chain A, Crystal Structure Of Yeast Paps Reductase With Pap, A Product Complex Length = 261 Back     alignment and structure
>pdb|2O8V|A Chain A, Paps Reductase In A Covalent Complex With Thioredoxin C35a Length = 252 Back     alignment and structure
>pdb|1SUR|A Chain A, Phospho-Adenylyl-Sulfate Reductase Length = 215 Back     alignment and structure
>pdb|2DJ3|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 133 Back     alignment and structure
>pdb|2DML|A Chain A, The Solution Structure Of The First Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A6 Length = 130 Back     alignment and structure
>pdb|3APO|A Chain A, Crystal Structure Of Full-Length Erdj5 Length = 780 Back     alignment and structure
>pdb|2B5E|A Chain A, Crystal Structure Of Yeast Protein Disulfide Isomerase Length = 504 Back     alignment and structure
>pdb|1MEK|A Chain A, Human Protein Disulfide Isomerase, Nmr, 40 Structures Length = 120 Back     alignment and structure
>pdb|2DIZ|A Chain A, The Solution Structure Of The Third Thioredoxin Domain Of Human Thioredoxin Domain-Containing Protein 5 Length = 117 Back     alignment and structure
>pdb|3F8U|A Chain A, TapasinERP57 HETERODIMER Length = 481 Back     alignment and structure
>pdb|1X5D|A Chain A, The Solution Structure Of The Second Thioredoxin-Like Domain Of Human Protein Disulfide-Isomerase A6 Length = 133 Back     alignment and structure
>pdb|3UVT|A Chain A, Crystal Structure Of The Third Catalytic Domain Of Erp46 Length = 111 Back     alignment and structure
>pdb|3UJ1|A Chain A, Crystal Structure Of The Third Thioredoxin Domain Of Human Erp46 Length = 110 Back     alignment and structure
>pdb|2DMM|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Human Protein Disulfide-Isomerase A3 Length = 142 Back     alignment and structure
>pdb|2DJ2|A Chain A, The Solution Structure Of The Second Thioredoxin Domain Of Mouse Protein Disulfide-Isomerase A4 Length = 120 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query430
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cl 2e-99
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 3e-95
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 3e-83
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 6e-78
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 1e-48
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/b 2e-45
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 1e-18
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 4e-18
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 6e-18
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 6e-18
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 2e-16
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 2e-16
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 3e-16
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 4e-16
1mek_A120 Protein disulfide isomerase; electron transport, r 4e-16
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 9e-16
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-15
3apo_A780 DNAJ homolog subfamily C member 10; PDI family, th 2e-13
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 2e-11
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 3e-11
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 3e-15
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 1e-14
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 7e-14
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 2e-14
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 2e-13
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 2e-14
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 6e-12
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 7e-14
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 6e-08
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 1e-13
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 3e-06
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 5e-13
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 2e-04
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 6e-13
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 2e-12
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel 2e-11
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 3e-11
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 3e-11
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 1e-10
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 1e-09
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 5e-08
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-08
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 1e-07
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 2e-07
4euy_A105 Uncharacterized protein; structural genomics, PSI- 4e-07
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 6e-07
2l57_A126 Uncharacterized protein; structural genomics, unkn 7e-07
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 9e-07
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 2e-06
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 6e-06
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 2e-05
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 3e-05
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 3e-05
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 3e-05
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 4e-05
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 4e-05
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 4e-05
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 6e-05
2kuc_A130 Putative disulphide-isomerase; structural genomics 8e-05
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 1e-04
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 1e-04
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 2e-04
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 2e-04
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 2e-04
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 2e-04
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 3e-04
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 3e-04
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 3e-04
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 3e-04
2l5l_A136 Thioredoxin; structural genomics, electron transpo 3e-04
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 3e-04
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 4e-04
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 4e-04
1zma_A118 Bacterocin transport accessory protein; alpha-beta 4e-04
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 5e-04
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 5e-04
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 6e-04
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 6e-04
1wmj_A130 Thioredoxin H-type; structural genomics, program f 6e-04
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 7e-04
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 7e-04
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 8e-04
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 8e-04
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 8e-04
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Length = 275 Back     alignment and structure
 Score =  297 bits (761), Expect = 2e-99
 Identities = 134/247 (54%), Positives = 179/247 (72%), Gaps = 3/247 (1%)

Query: 47  EDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLIEYAKLTGRPFRVFSLDT 106
            D   LA  +   SP +I+  AF+ FG+++ I+FSGAEDVVL++ A    R  +VFSLDT
Sbjct: 28  FDLPALASSLADKSPQDILKAAFEHFGDELWISFSGAEDVVLVDMAWKLNRNVKVFSLDT 87

Query: 107 GRLNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRP 166
           GRL+PET++F D V +HYGI I+   P+   ++ LV+ KGLFSFY DGH ECC IRK+ P
Sbjct: 88  GRLHPETYRFIDQVREHYGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEP 147

Query: 167 LKRALKGLRAWITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDI 226
           LKR L G+RAW TGQR+DQSPGTR+++ V++ID +F   +       K+NPL+++  +++
Sbjct: 148 LKRKLAGVRAWATGQRRDQSPGTRSQVAVLEIDGAFSTPEKPL---YKFNPLSSMTSEEV 204

Query: 227 WNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHNGNIK 286
           W ++R + +P NSLH +GYISIGCEPCTRPVLP QHEREGRWWWE+A  KECGLH GN+ 
Sbjct: 205 WGYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHAGNLI 264

Query: 287 QEELSQH 293
            + L  H
Sbjct: 265 SKALEHH 271


>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Length = 252 Back     alignment and structure
>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Length = 261 Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Length = 215 Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Length = 306 Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Length = 308 Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 133 Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} Length = 127 Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 126 Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Length = 130 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Length = 140 Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A Length = 111 Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Length = 121 Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 133 Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Length = 120 Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Length = 122 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Length = 780 Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Length = 382 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Length = 504 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Length = 241 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Length = 481 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Length = 361 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Length = 244 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Length = 298 Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Length = 240 Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Length = 519 Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Length = 325 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3trq_A* 3trp_A* 3uom_A Length = 367 Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Length = 350 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Length = 470 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Length = 210 Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Length = 137 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Length = 134 Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Length = 164 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Length = 105 Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Length = 229 Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Length = 126 Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Length = 130 Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Length = 248 Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} PDB: 1xbs_A Length = 149 Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Length = 121 Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Length = 142 Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Length = 112 Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Length = 118 Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Length = 111 Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} Length = 111 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Length = 130 Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Length = 110 Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Length = 113 Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Length = 133 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Length = 106 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Length = 112 Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Length = 122 Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Length = 85 Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Length = 141 Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Length = 118 Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Length = 128 Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Length = 136 Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Length = 135 Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Length = 124 Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Length = 117 Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Length = 118 Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Length = 104 Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} Length = 109 Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Length = 140 Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Length = 140 Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Length = 130 Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Length = 153 Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Length = 148 Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Length = 104 Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Length = 135 Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Length = 287 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
2goy_A275 Adenosine phosphosulfate reductase; iron sulfur cl 100.0
2oq2_A261 Phosphoadenosine phosphosulfate reductase; sulfate 100.0
2o8v_A252 Phosphoadenosine phosphosulfate reductase; disulfi 100.0
3fwk_A308 FMN adenylyltransferase; FAD biosynthesis, alpha/b 100.0
1zun_A325 Sulfate adenylyltransferase subunit 2; beta barrel 100.0
2wsi_A306 FAD synthetase; transferase, nucleotidyltransferas 100.0
1sur_A215 PAPS reductase; assimilatory sulfate reduction, 3- 100.0
3zzx_A105 Thioredoxin; oxidoreductase; 1.88A {Litopenaeus va 99.86
3h79_A127 Thioredoxin-like protein; thioredoxin fold, cataly 99.84
2av4_A160 Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECI 99.82
2qsi_A137 Putative hydrogenase expression/formation protein; 99.82
2qgv_A140 Hydrogenase-1 operon protein HYAE; alpha-beta prot 99.81
3gnj_A111 Thioredoxin domain protein; APC92103, STR genomics 99.8
3ga4_A178 Dolichyl-diphosphooligosaccharide-protein glycosyl 99.8
2dml_A130 Protein disulfide-isomerase A6; thioredoxin domain 99.79
3tco_A109 Thioredoxin (TRXA-1); disulfide oxidoreductase, ox 99.79
2dj1_A140 Protein disulfide-isomerase A4; protein ERP-72, ER 99.79
2trx_A108 Thioredoxin; electron transport; 1.68A {Escherichi 99.78
3die_A106 Thioredoxin, TRX; electron transport, SWAP domain, 99.78
3hxs_A141 Thioredoxin, TRXP; electron transport; 2.00A {Bact 99.78
2i4a_A107 Thioredoxin; acidophIle, disulfide exchange, oxido 99.78
1nsw_A105 Thioredoxin, TRX; thermostability, electron transp 99.78
1x5d_A133 Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC 99.78
3uvt_A111 Thioredoxin domain-containing protein 5; thioredox 99.77
2voc_A112 Thioredoxin; electron transport, homodimer, disulf 99.77
1x5e_A126 Thioredoxin domain containing protein 1; TMX, TXND 99.77
1r26_A125 Thioredoxin; redox-active disulfide, electron tran 99.77
2yzu_A109 Thioredoxin; redox protein, electron transport, st 99.77
3qfa_C116 Thioredoxin; protein-protein complex, rossmann fol 99.77
3p2a_A148 Thioredoxin 2, putative thioredoxin-like protein; 99.77
1t00_A112 Thioredoxin, TRX; redox regulation, multifunction 99.77
3hz4_A140 Thioredoxin; NYSGXRC, PSI-II, reduced form, protei 99.77
2ppt_A155 Thioredoxin-2; thiredoxin, zinc finger, oxidoreduc 99.77
1w4v_A119 Thioredoxin, mitochondrial; antioxidant enzyme, mi 99.76
2l5l_A136 Thioredoxin; structural genomics, electron transpo 99.76
1dby_A107 Chloroplast thioredoxin M CH2; thioredoxin CH2, ch 99.76
3f3q_A109 Thioredoxin-1; His TAG, electron transport, cytopl 99.76
3d6i_A112 Monothiol glutaredoxin-3; thioredoxin-like, electr 99.76
2o8v_B128 Thioredoxin 1; disulfide crosslinked complex, oxid 99.76
2pu9_C111 TRX-F, thioredoxin F-type, chloroplast; protein-pr 99.76
1thx_A115 Thioredoxin, thioredoxin 2; oxido-reductase, elect 99.76
1fb6_A105 Thioredoxin M; electron transport; 2.10A {Spinacia 99.75
3aps_A122 DNAJ homolog subfamily C member 10; thioredoxin fo 99.75
2e0q_A104 Thioredoxin; electron transport; 1.49A {Sulfolobus 99.75
1gh2_A107 Thioredoxin-like protein; redox-active center, ele 99.75
4euy_A105 Uncharacterized protein; structural genomics, PSI- 99.75
3evi_A118 Phosducin-like protein 2; alpha beta, 3-layer(ABA) 99.75
1mek_A120 Protein disulfide isomerase; electron transport, r 99.75
1ep7_A112 Thioredoxin CH1, H-type; electron transport; 2.10A 99.74
3idv_A 241 Protein disulfide-isomerase A4; thioredoxin-like f 99.74
1syr_A112 Thioredoxin; SGPP, structural genomics, PSI, prote 99.74
2i1u_A121 Thioredoxin, TRX, MPT46; redox protein, electron t 99.74
2dj3_A133 Protein disulfide-isomerase A4; protein ERP-72, ER 99.74
3qou_A 287 Protein YBBN; thioredoxin-like fold, tetratricopep 99.74
1faa_A124 Thioredoxin F; electron transport; 1.85A {Spinacia 99.73
1xwb_A106 Thioredoxin; dimerization, redox regulation, THI X 99.73
3ed3_A 298 Protein disulfide-isomerase MPD1; thioredoxin-like 99.73
3m9j_A105 Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} 99.73
3gix_A149 Thioredoxin-like protein 4B; PRE-mRNA splicing, TX 99.73
2vim_A104 Thioredoxin, TRX; thioredoxin fold, oxidoreductase 99.73
1xfl_A124 Thioredoxin H1; AT3G51030, structural genomics, pr 99.72
3apq_A210 DNAJ homolog subfamily C member 10; thioredoxin fo 99.72
2djj_A121 PDI, protein disulfide-isomerase; thioredoxin fold 99.72
2oe3_A114 Thioredoxin-3; electron transport, alpha/beta sand 99.72
2xc2_A117 Thioredoxinn; oxidoreductase, protein disulfide re 99.72
1oaz_A123 Thioredoxin 1; immune system, antibody/complex, an 99.72
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 99.72
2dj0_A137 Thioredoxin-related transmembrane protein 2; AVLA2 99.72
2vlu_A122 Thioredoxin, thioredoxin H isoform 2.; oxidoreduct 99.71
1v98_A140 Thioredoxin; oxidoreductase, structural genomics, 99.71
2r2j_A 382 Thioredoxin domain-containing protein 4; CRFS moti 99.71
3ul3_B128 Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 99.71
2wz9_A153 Glutaredoxin-3; protein binding; 1.55A {Homo sapie 99.71
3dxb_A 222 Thioredoxin N-terminally fused to PUF60(UHM); spli 99.71
2b5e_A 504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.71
2l6c_A110 Thioredoxin; oxidoreductase; NMR {Desulfovibrio vu 99.71
1qgv_A142 Spliceosomal protein U5-15KD; snRNP, thioredoxin, 99.7
2j23_A121 Thioredoxin; immune protein, autoreactivity, cross 99.7
1zma_A118 Bacterocin transport accessory protein; alpha-beta 99.7
3cxg_A133 Putative thioredoxin; malaria, structural GEN oxid 99.69
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 99.69
3d22_A139 TRXH4, thioredoxin H-type; electron transport, cyt 99.69
2dbc_A135 PDCL2, unnamed protein product; phosducin-like pro 99.69
1ti3_A113 Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Popul 99.69
3q6o_A 244 Sulfhydryl oxidase 1; protein disulfide isomerase, 99.69
2f51_A118 Thioredoxin; electron transport; 1.90A {Trichomona 99.69
3idv_A241 Protein disulfide-isomerase A4; thioredoxin-like f 99.69
3emx_A135 Thioredoxin; structural genomics, oxidoreductase, 99.69
2l57_A126 Uncharacterized protein; structural genomics, unkn 99.69
2vm1_A118 Thioredoxin, thioredoxin H isoform 1.; oxidoreduct 99.68
3f8u_A 481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.68
2es7_A142 Q8ZP25_salty, putative thiol-disulfide isomerase a 99.68
2c0g_A 248 ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, 99.66
3uem_A361 Protein disulfide-isomerase; thioredoxin-like doma 99.64
3fk8_A133 Disulphide isomerase; APC61824.1, xylella fastidio 99.62
2qc7_A 240 ERP31, ERP28, endoplasmic reticulum protein ERP29; 99.62
2yj7_A106 LPBCA thioredoxin; oxidoreductase; 1.65A {Syntheti 99.42
1a8l_A226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.62
1wou_A123 Thioredoxin -related protein, 14 kDa; electron tra 99.62
2djk_A133 PDI, protein disulfide-isomerase; thioredoxin fold 99.62
2trc_P217 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.61
2kuc_A130 Putative disulphide-isomerase; structural genomics 99.61
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 99.61
2fwh_A134 Thiol:disulfide interchange protein DSBD; thioredo 99.61
3iv4_A112 Putative oxidoreductase; APC23140, meticillin-resi 99.61
1a0r_P245 Phosducin, MEKA, PP33; transducin, beta-gamma, sig 99.59
2ywm_A229 Glutaredoxin-like protein; redox protein, structur 99.59
3f8u_A481 Protein disulfide-isomerase A3ERP57; endoplasmic r 99.59
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.58
1wmj_A130 Thioredoxin H-type; structural genomics, program f 99.56
1fo5_A85 Thioredoxin; disulfide oxidoreductase, structural 99.56
3qcp_A 470 QSOX from trypanosoma brucei (tbqsox); ERV fold, t 99.56
1nho_A85 Probable thioredoxin; beta sheet, alpha helix, oxi 99.55
2b5e_A504 Protein disulfide-isomerase; 2.40A {Saccharomyces 99.54
3f9u_A172 Putative exported cytochrome C biogenesis-related; 99.54
3apo_A 780 DNAJ homolog subfamily C member 10; PDI family, th 99.5
3dml_A116 Putative uncharacterized protein; thioredoxin, oxi 99.49
2ju5_A154 Thioredoxin disulfide isomerase; protein, oxidored 99.48
2lst_A130 Thioredoxin; structural genomics, NEW YORK structu 99.21
1z6n_A167 Hypothetical protein PA1234; alpha-beta-alpha sand 99.46
2ywb_A503 GMP synthase [glutamine-hydrolyzing]; GMP syntheta 99.45
2hls_A243 Protein disulfide oxidoreductase; thioredoxin fold 99.44
1sen_A164 Thioredoxin-like protein P19; endoplasmic reticulu 99.44
3kp8_A106 Vkorc1/thioredoxin domain protein; blood coagulati 99.44
3raz_A151 Thioredoxin-related protein; structural genomics, 99.44
1lu4_A136 Soluble secreted antigen MPT53; thioredoxin-like f 99.44
2b5x_A148 YKUV protein, TRXY; thioredoxin-like, oxidoreducta 99.44
2dpl_A308 GMP synthetase, GMP synthase [glutamine-hydrolyzin 99.43
1wy5_A317 TILS, hypothetical UPF0072 protein AQ_1887; N-type 99.43
3ph9_A151 Anterior gradient protein 3 homolog; thioredoxin f 99.43
3ira_A173 Conserved protein; methanosarcina mazei,structural 99.42
3or5_A165 Thiol:disulfide interchange protein, thioredoxin p 99.42
1ilo_A77 Conserved hypothetical protein MTH895; beta-alpha- 99.42
1a8l_A 226 Protein disulfide oxidoreductase; PDI, thioredoxin 99.42
3erw_A145 Sporulation thiol-disulfide oxidoreductase A; thio 99.41
1zzo_A136 RV1677; thioredoxin fold, structural genomics, PSI 99.4
2f9s_A151 Thiol-disulfide oxidoreductase RESA; thioredoxin-l 99.4
2ywm_A 229 Glutaredoxin-like protein; redox protein, structur 99.39
2h30_A164 Thioredoxin, peptide methionine sulfoxide reductas 99.39
2lja_A152 Putative thiol-disulfide oxidoreductase; structura 99.36
3lor_A160 Thiol-disulfide isomerase and thioredoxins; PSI, M 99.36
3eyt_A158 Uncharacterized protein SPOA0173; thioredoxin-like 99.36
4evm_A138 Thioredoxin family protein; structural genomics, n 99.35
3hcz_A148 Possible thiol-disulfide isomerase; APC61559.2, cy 99.33
2l5o_A153 Putative thioredoxin; structural genomics, unknown 99.33
2fgx_A107 Putative thioredoxin; NET3, NESG, GFT-glutaredoxin 99.33
3eur_A142 Uncharacterized protein; PSI2,MCSG, conserved prot 99.33
3hdc_A158 Thioredoxin family protein; ATCC53774, DSM 7210, , 99.32
3ewl_A142 Uncharacterized conserved protein BF1870; alpha-be 99.32
3fkf_A148 Thiol-disulfide oxidoreductase; structural genomic 99.32
2lrn_A152 Thiol:disulfide interchange protein; structural ge 99.32
3gl3_A152 Putative thiol:disulfide interchange protein DSBE; 99.32
1ttz_A87 Conserved hypothetical protein; structural genomic 99.3
3lwa_A183 Secreted thiol-disulfide isomerase; thioredoxin, P 99.29
2lrt_A152 Uncharacterized protein; structural genomics, thio 99.28
3ia1_A154 THIO-disulfide isomerase/thioredoxin; oxidoreducta 99.28
3k32_A203 Uncharacterized protein MJ0690; predicted subunit 99.27
3bl5_A219 Queuosine biosynthesis protein QUEC; PREQ1 biosynt 99.26
3kcm_A154 Thioredoxin family protein; SGX, thioredoxin prote 99.26
3uem_A 361 Protein disulfide-isomerase; thioredoxin-like doma 99.24
3ha9_A165 Uncharacterized thioredoxin-like protein; PSI, MCS 99.24
1i5g_A144 Tryparedoxin II; electron transport; HET: TS5; 1.4 99.23
1kng_A156 Thiol:disulfide interchange protein CYCY; thioredo 99.23
4fo5_A143 Thioredoxin-like protein; AHPC/TSA family protein, 99.23
3fw2_A150 Thiol-disulfide oxidoreductase; structural genomic 99.23
2b1k_A168 Thiol:disulfide interchange protein DSBE; C-termin 99.22
1o8x_A146 Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrot 99.21
3a2k_A464 TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, 99.2
1kor_A400 Argininosuccinate synthetase; ligase, riken struct 99.19
2dlx_A153 UBX domain-containing protein 7; UAS domain, prote 99.19
1o73_A144 Tryparedoxin; electron transport, trypanosomatid, 99.19
1ni5_A433 Putative cell cycle protein MESJ; structural genom 99.19
2ywi_A196 Hypothetical conserved protein; uncharacterized co 99.18
3s9f_A165 Tryparedoxin; thioredoxin fold, disulfide reductas 99.18
2hyx_A 352 Protein DIPZ; thioredoxin fold, jelly-roll, struct 99.17
3kh7_A176 Thiol:disulfide interchange protein DSBE; TRX-like 99.16
2pg3_A232 Queuosine biosynthesis protein QUEC; YP_049261.1, 99.13
2cvb_A188 Probable thiol-disulfide isomerase/thioredoxin; re 99.12
1jfu_A186 Thiol:disulfide interchange protein TLPA; thioredo 99.11
2hls_A 243 Protein disulfide oxidoreductase; thioredoxin fold 99.1
3u5r_E218 Uncharacterized protein; structural genomics, PSI- 99.1
2ls5_A159 Uncharacterized protein; structural genomics, unkn 98.68
2hma_A376 Probable tRNA (5-methylaminomethyl-2-thiouridylat 99.09
3kp9_A291 Vkorc1/thioredoxin domain protein; warfarin, disul 99.08
2lus_A143 Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carci 98.66
3drn_A161 Peroxiredoxin, bacterioferritin comigratory prote 99.05
1wjk_A100 C330018D20RIK protein; glutaredoxin, thioredoxin f 99.04
1hyu_A 521 AHPF, alkyl hydroperoxide reductase subunit F; thi 99.02
2rli_A171 SCO2 protein homolog, mitochondrial; copper protei 99.0
2ggt_A164 SCO1 protein homolog, mitochondrial; copper chaper 98.99
1xng_A268 NH(3)-dependent NAD(+) synthetase; amidotransferas 98.98
2vup_A190 Glutathione peroxidase-like protein; oxidoreductas 98.97
3fiu_A249 NH(3)-dependent NAD(+) synthetase; rossman fold, a 98.96
2k8s_A80 Thioredoxin; dimer, structural genomics, PSI-2, pr 98.95
3dwv_A187 Glutathione peroxidase-like protein; alpha beta, 3 98.95
2der_A380 TRNA-specific 2-thiouridylase MNMA; protein-RNA co 98.95
2bmx_A195 Alkyl hydroperoxidase C; peroxiredoxin, antioxidan 98.95
1xvw_A160 Hypothetical protein RV2238C/MT2298; thioredoxin f 98.95
3tqi_A527 GMP synthase [glutamine-hydrolyzing]; ligase; 2.84 98.94
3cmi_A171 Peroxiredoxin HYR1; thioredoxin-like fold, oxidore 98.94
2v1m_A169 Glutathione peroxidase; selenium, selenocysteine, 98.93
2e18_A257 NH(3)-dependent NAD(+) synthetase; ligase, structu 98.93
2p5q_A170 Glutathione peroxidase 5; thioredoxin fold, oxidor 98.92
1we0_A187 Alkyl hydroperoxide reductase C; peroxiredoxin, AH 98.92
1zof_A198 Alkyl hydroperoxide-reductase; decamer, toroide-sh 98.92
1ego_A85 Glutaredoxin; electron transport; NMR {Escherichia 98.91
2k6v_A172 Putative cytochrome C oxidase assembly protein; th 98.91
2e7p_A116 Glutaredoxin; thioredoxin fold, poplar, electron t 98.91
2p31_A181 CL683, glutathione peroxidase 7; thioredoxin fold, 98.9
3p52_A249 NH(3)-dependent NAD(+) synthetase; structural geno 98.89
2f8a_A208 Glutathione peroxidase 1; thioredoxin fold, struct 98.86
1qmv_A197 Human thioredoxin peroxidase-B; peroxiredoxin, sul 98.85
2obi_A183 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.85
1gpm_A525 GMP synthetase, XMP aminase; class I glutamine ami 98.8
2gs3_A185 PHGPX, GPX-4, phospholipid hydroperoxide glutathio 98.79
1uul_A202 Tryparedoxin peroxidase homologue; peroxiredoxin, 98.79
4f9z_D227 Endoplasmic reticulum resident protein 27; thiored 98.78
1zye_A220 Thioredoxin-dependent peroxide reductase; catenane 98.78
2h01_A192 2-Cys peroxiredoxin; thioredoxin peroxidase, struc 98.77
3kij_A180 Probable glutathione peroxidase 8; human PDI-perox 98.76
2i81_A213 2-Cys peroxiredoxin; structural genomics consortiu 98.75
3ztl_A222 Thioredoxin peroxidase; oxidoreductase, reductase, 98.73
2c5s_A413 THII, probable thiamine biosynthesis protein THII; 98.73
3gkn_A163 Bacterioferritin comigratory protein; BCP, PRX, at 98.72
2jsy_A167 Probable thiol peroxidase; solution structure, ant 98.69
3gyk_A175 27KDA outer membrane protein; APC61738.2, siliciba 98.66
1k92_A455 Argininosuccinate synthase, argininosuccinate SY; 98.65
1eej_A216 Thiol:disulfide interchange protein; oxidoreductas 98.62
2b7k_A200 SCO1 protein; metallochaperone, cytochrome C oxida 98.6
2nz2_A413 Argininosuccinate synthase; amino-acid biosynthesi 98.6
1xzo_A174 BSSCO, hypothetical protein YPMQ; thioredoxin-like 98.59
1t3b_A211 Thiol:disulfide interchange protein DSBC; oxidored 98.58
1xvq_A175 Thiol peroxidase; thioredoxin fold, structural gen 98.56
3hd5_A195 Thiol:disulfide interchange protein DSBA; protein 98.52
1r7h_A75 NRDH-redoxin; thioredoxin, glutaredoxin, redox pro 98.51
1h75_A81 Glutaredoxin-like protein NRDH; electron transport 98.51
2a4v_A159 Peroxiredoxin DOT5; yeast nuclear thiol peroxidase 98.49
2c0d_A221 Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, th 98.49
3ixr_A179 Bacterioferritin comigratory protein; alpha beta p 98.48
3uow_A556 GMP synthetase; structural genomics consortium, SG 98.48
2i3y_A215 Epididymal secretory glutathione peroxidase; thior 98.46
3a2v_A249 Probable peroxiredoxin; thioredoxin peroxidase, hy 98.45
2l4c_A124 Endoplasmic reticulum resident protein 27; ERP27, 98.44
2pn8_A211 Peroxiredoxin-4; thioredoxin, oxidoreductase, stru 98.42
1n8j_A186 AHPC, alkyl hydroperoxide reductase C22 protein; p 98.41
2r37_A207 Glutathione peroxidase 3; plasma, structural genom 98.4
3h93_A192 Thiol:disulfide interchange protein DSBA; disulfid 98.4
4g2e_A157 Peroxiredoxin; redox protein, structural genomics, 98.39
1v58_A241 Thiol:disulfide interchange protein DSBG; reduced 98.37
1vl2_A421 Argininosuccinate synthase; TM1780, structural gen 98.34
3me7_A170 Putative uncharacterized protein; electron transfe 98.33
3us3_A 367 Calsequestrin-1; calcium-binding protein; 1.74A {O 98.32
3qpm_A240 Peroxiredoxin; oxidoreductase, thioredoxin fold, p 98.31
4f9z_D 227 Endoplasmic reticulum resident protein 27; thiored 98.3
2vxo_A697 GMP synthase [glutamine-hydrolyzing]; proto-oncoge 98.26
1psq_A163 Probable thiol peroxidase; structural genomics, NY 98.26
4gqc_A164 Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, f 98.26
1sji_A 350 Calsequestrin 2, calsequestrin, cardiac muscle iso 98.23
1kte_A105 Thioltransferase; redox-active center, electron tr 98.19
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 98.17
2hze_A114 Glutaredoxin-1; thioredoxin fold, arsenic, dimethy 98.15
3tjj_A254 Peroxiredoxin-4; thioredoxin fold, sulfenylation, 98.13
3uma_A184 Hypothetical peroxiredoxin protein; nysgrc, PSI bi 98.11
3p7x_A166 Probable thiol peroxidase; thioredoxin fold, oxido 98.11
1q98_A165 Thiol peroxidase, TPX; structural genomics, NYSGXR 98.09
1prx_A224 HORF6; peroxiredoxin, hydrogen peroxide, redox reg 98.07
1tp9_A162 Peroxiredoxin, PRX D (type II); oligomer, thioredo 98.06
2wfc_A167 Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidan 98.05
2yzh_A171 Probable thiol peroxidase; redox protein, antioxid 98.04
3n05_A590 NH(3)-dependent NAD(+) synthetase; ligase, structu 98.03
2v2g_A233 Peroxiredoxin 6; oxidoreductase, antioxidant enzym 98.02
2ec4_A178 FAS-associated factor 1; UAS domain, protein FAF1, 98.01
1un2_A197 DSBA, thiol-disulfide interchange protein; disulfi 98.0
2klx_A89 Glutaredoxin; thioredoxin type domain, ssgcid, ele 98.0
3q4g_A279 NH(3)-dependent NAD(+) synthetase; structural geno 97.98
3bj5_A147 Protein disulfide-isomerase; thioredoxin fold, cha 97.97
2znm_A195 Thiol:disulfide interchange protein DSBA; thioredo 97.95
3mng_A173 Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, 97.95
3dpi_A285 NAD+ synthetase; ssgcid, decode, structural genomi 97.94
3zrd_A200 Thiol peroxidase; oxidoreductase, 2Cys peroxiredox 97.93
2lqo_A92 Putative glutaredoxin RV3198.1/MT3292; TRX fold, o 97.93
1kqp_A271 NAD+ synthase, NH(3)-dependent NAD(+) synthetase, 97.93
2cq9_A130 GLRX2 protein, glutaredoxin 2; glutathione-S-trans 97.92
2yan_A105 Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {H 97.91
3c1r_A118 Glutaredoxin-1; oxidized form, oxidoreductase, cyt 97.89
3ic4_A92 Glutaredoxin (GRX-1); structural genomics, PSI, MC 97.89
2ht9_A146 Glutaredoxin-2; thioredoxin fold, iron-sulfur clus 97.88
3qmx_A99 Glutaredoxin A, glutaredoxin 3; electron transport 97.88
1xcc_A220 1-Cys peroxiredoxin; unknown function, structural 97.87
4hde_A170 SCO1/SENC family lipoprotein; structural genomics, 97.87
2rem_A193 Disulfide oxidoreductase; disulfide oxidoreductase 97.85
1z6m_A175 Conserved hypothetical protein; structural genomic 97.84
3gv1_A147 Disulfide interchange protein; neisseria gonorrhoe 97.83
1wxi_A275 NH(3)-dependent NAD(+) synthetase; NADE, E.coli, l 97.83
2pwj_A171 Mitochondrial peroxiredoxin; alpha and beta protei 97.81
4dvc_A184 Thiol:disulfide interchange protein DSBA; pilus as 97.81
3nzn_A103 Glutaredoxin; structural genomics, PSI2, MCSG, pro 97.77
2h8l_A 252 Protein disulfide-isomerase A3; thioredoxin-like f 97.76
3ec3_A 250 Protein disulfide-isomerase A4; thioredoxin-like f 97.72
1fov_A82 Glutaredoxin 3, GRX3; active site disulfide, CIS P 97.7
2r2j_A382 Thioredoxin domain-containing protein 4; CRFS moti 97.68
2khp_A92 Glutaredoxin; thioredoxin type domain, ssgcid, ele 97.66
3rhb_A113 ATGRXC5, glutaredoxin-C5, chloroplastic; thioredox 97.65
3rjz_A237 N-type ATP pyrophosphatase superfamily; structural 97.62
1vbk_A307 Hypothetical protein PH1313; structural genomics, 97.54
3msz_A89 Glutaredoxin 1; alpha-beta sandwich, center for st 97.5
3hz8_A193 Thiol:disulfide interchange protein DSBA; thiol-ox 97.41
3l9s_A191 Thiol:disulfide interchange protein; thioredoxin-f 97.32
1wik_A109 Thioredoxin-like protein 2; picot homology 2 domai 97.31
3ctg_A129 Glutaredoxin-2; reduced form, electron transport, 97.3
3h8q_A114 Thioredoxin reductase 3; oxidoreductase, structura 97.29
3sdb_A680 Glutamine-dependent NAD(+) synthetase; glutamine-a 97.28
2h8l_A252 Protein disulfide-isomerase A3; thioredoxin-like f 97.26
3keb_A224 Probable thiol peroxidase; structural genomics, AP 97.26
3sbc_A216 Peroxiredoxin TSA1; alpha-beta fold, peroxidase, c 97.25
3ilv_A634 Glutamine-dependent NAD(+) synthetase; protein str 97.21
3ed3_A298 Protein disulfide-isomerase MPD1; thioredoxin-like 97.15
3ec3_A250 Protein disulfide-isomerase A4; thioredoxin-like f 97.11
3l9v_A189 Putative thiol-disulfide isomerase or thioredoxin; 97.06
2wci_A135 Glutaredoxin-4; redox-active center, iron-sulfur c 96.78
3gha_A202 Disulfide bond formation protein D; BDBD, DSBA-lik 96.72
4f82_A176 Thioredoxin reductase; structural genomics, niaid, 96.67
3feu_A185 Putative lipoprotein; alpha-beta structure, struct 96.66
3l4n_A127 Monothiol glutaredoxin-6; C-terminal domain of GRX 96.55
4eo3_A 322 Bacterioferritin comigratory protein/NADH dehydro; 96.48
3f4s_A226 Alpha-DSBA1, putative uncharacterized protein; thi 96.35
3tue_A219 Tryparedoxin peroxidase; thioredoxin fold, peroxir 96.29
3zyw_A111 Glutaredoxin-3; metal binding protein; 1.84A {Homo 96.23
3ipz_A109 Monothiol glutaredoxin-S14, chloroplastic; electro 96.21
1nm3_A241 Protein HI0572; hybrid, peroxiredoxin, glutaredoxi 96.05
1jgt_A513 Beta-lactam synthetase; asparagine synthetase, cla 96.02
2axo_A 270 Hypothetical protein ATU2684; alpha beta protein., 95.97
1ct9_A553 Asparagine synthetase B; amidotransferase, substra 95.92
1aba_A87 Glutaredoxin; electron transport; HET: MES; 1.45A 95.91
1q15_A503 CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, 95.8
3q6o_A244 Sulfhydryl oxidase 1; protein disulfide isomerase, 95.74
4f4h_A565 Glutamine dependent NAD+ synthetase; structural ge 95.72
3gx8_A121 Monothiol glutaredoxin-5, mitochondrial; TRX fold, 95.71
2ct6_A111 SH3 domain-binding glutamic acid-rich-like protein 95.68
1t1v_A93 SH3BGRL3, SH3 domain-binding glutamic acid-rich pr 95.63
2wem_A118 Glutaredoxin-related protein 5; chromosome 14 open 94.85
3c7m_A195 Thiol:disulfide interchange protein DSBA-like; red 94.21
3t58_A 519 Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2. 94.18
1xiy_A182 Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin 93.34
3kzq_A 208 Putative uncharacterized protein VP2116; protein w 92.51
1t4y_A105 Adaptive-response sensory-kinase SASA; alpha/beta 91.85
1u6t_A121 SH3 domain-binding glutamic acid-rich-like protein 91.28
2wul_A118 Glutaredoxin related protein 5; chromosome 14 open 90.37
3gn3_A182 Putative protein-disulfide isomerase; MCSG, PSI, s 89.06
2kok_A120 Arsenate reductase; brucellosis, zoonotic, oxidore 88.91
3bci_A186 Disulfide bond protein A; thiol-disulfide oxidored 88.1
2xhf_A171 Peroxiredoxin 5; oxidoreductase, antioxidant enzym 87.89
2jad_A362 Yellow fluorescent protein glutaredoxin fusion pro 87.87
2in3_A216 Hypothetical protein; DSBA family, FRNE-like subfa 87.32
3gmf_A205 Protein-disulfide isomerase; oxidoreductase, PSI-2 86.22
3tdg_A273 DSBG, putative uncharacterized protein; thioredoxi 85.62
2x8g_A 598 Thioredoxin glutathione reductase; redox-active ce 81.46
2g2q_A124 Glutaredoxin-2; thioredoxin-fold, oxidoreductase, 80.79
>2goy_A Adenosine phosphosulfate reductase; iron sulfur cluster, nucleotide binding, thiosulfonate intermediate, oxidoreductase; HET: ADX; 2.70A {Pseudomonas aeruginosa} Back     alignment and structure
Probab=100.00  E-value=2.5e-58  Score=439.84  Aligned_cols=238  Identities=53%  Similarity=1.016  Sum_probs=199.7

Q ss_pred             ChhhHHHHHHhccCCCHHHHHHHHHHHcCCcEEEEechhHHHHHH-HHHHhcCCCcEEEEecCCCCCHHHHHHHHHHHHH
Q 042284           45 DHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLI-EYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKH  123 (430)
Q Consensus        45 ~~~~~~~l~~~l~~~~~~~~i~~~~~~~~~~i~vs~SGGKDS~vl-~l~~~~~~~i~vi~~DTg~~fpet~~~~~~~~~~  123 (430)
                      +..++..+|++++.++++++|+++++.|+++++|+|| ||||+|| +|+.+.++++.|+|+|||.+||||++|+++++++
T Consensus        26 ~~~~~~~~~~~~~~~~a~~~l~~a~~~~g~~i~Va~S-GkDS~vLL~Ll~~~~~~i~vv~iDtg~~~~et~~~v~~~~~~  104 (275)
T 2goy_A           26 QPFDLPALASSLADKSPQDILKAAFEHFGDELWISFS-GAEDVVLVDMAWKLNRNVKVFSLDTGRLHPETYRFIDQVREH  104 (275)
T ss_dssp             --CCHHHHHHHHTTSCHHHHHHHHHHHHSTTEEEECC-SSTTHHHHHHHHHHCTTCCEEEECCSCCCHHHHHHHHHHHHH
T ss_pred             CHHHHHHHHHHhccCCHHHHHHHHHHHcCCCEEEEee-cHHHHHHHHHHHHhCCCceEEEEeCCCCCHHHHHHHHHHHHH
Confidence            4556889999999999999999999999777999999 9999776 8999999999999999999999999999999999


Q ss_pred             hCCcEEEEccCchHHHHHHHhcCCCCCCccchhhhhhhhchHHHHHHHhcCceEEEeeeccCC-cccccCCCeeeecCCC
Q 042284          124 YGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLRAWITGQRKDQS-PGTRAEIPVVQIDTSF  202 (430)
Q Consensus       124 ~gl~i~~~~p~~~~~~~~~~~~g~~~~~~~~~~~cc~~~K~~pl~~~~~~~~~~i~G~R~~Es-~~~R~~~~~~~~d~~~  202 (430)
                      ||++++++.|+...+.+...+.|.+.++..+.++||.++|++|++++++++++|++|+|++|+ . .|+.+++++.+..+
T Consensus       105 ~gi~l~v~~~~~~~~~~~~~~~g~~~~~~~~~~~cc~~~K~~pl~r~l~~~~~~itG~r~dds~~-~R~~~~~~~~d~~~  183 (275)
T 2goy_A          105 YGIAIDVLSPDPRLLEPLVKEKGLFSFYRDGHGECCGIRKIEPLKRKLAGVRAWATGQRRDQSPG-TRSQVAVLEIDGAF  183 (275)
T ss_dssp             HTCCCEEECCCHHHHHHHHHHHCSCHHHHHCTHHHHHHHTHHHHHHHHHTCSEEECCCCGGGTTS-CSCCCCSEEECTTT
T ss_pred             HCCeEEEEeCCccCHHHHHHHhCCCCccccCHHHHHHHHHHHHHHHHHHhcCchhcCchhhhhhh-hhhhCccccccccc
Confidence            999999999986555666677777666666678999999999999999999999999999999 5 89999999887533


Q ss_pred             CcccCCCCCeEEEecccccchHHHHHHHHHcCCCCccccccCCcccCCcCCCCCCCCCCccccCCCcCCCCCcccccCCC
Q 042284          203 EGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEPCTRPVLPGQHEREGRWWWEDAKAKECGLHN  282 (430)
Q Consensus       203 ~~~~~~~~~~~~~~Pi~dWt~~dVw~yi~~~~lp~~pLY~~Gy~siGC~~Ct~~~~~~~~~r~grw~~~~~~~~e~g~~~  282 (430)
                      ..   ..++.++++||++|+++|||.|++++||||||||++||+||||++||+++.+|+++|+|||||++..|+|||||.
T Consensus       184 ~~---~~~g~~~i~PL~~wt~~dV~~Yi~~~~lp~~~Ly~~Gy~siGC~~Ct~~~~~g~~~R~gRw~w~~~~k~ecGlh~  260 (275)
T 2goy_A          184 ST---PEKPLYKFNPLSSMTSEEVWGYIRMLELPYNSLHERGYISIGCEPCTRPVLPNQHEREGRWWWEEATHKECGLHA  260 (275)
T ss_dssp             CC---SSSCCEEECTTTTCCHHHHHHHHHHTTCCCCGGGGGTCSSCCCGGGBCCCCTTCCGGGGBSTTC-----------
T ss_pred             cc---CCCCeEEEechHhCCHHHHHHHHHHhCCCCChHHHcCCCCCCCccCCCCCCCCCccccCccccCCCCCccCCCCc
Confidence            20   124689999999999999999999999999999999999999999999999999999999999999999999998


Q ss_pred             CCccc
Q 042284          283 GNIKQ  287 (430)
Q Consensus       283 ~~i~~  287 (430)
                      .+++.
T Consensus       261 ~~~~~  265 (275)
T 2goy_A          261 GNLIS  265 (275)
T ss_dssp             -----
T ss_pred             Ccchh
Confidence            76654



>2oq2_A Phosphoadenosine phosphosulfate reductase; sulfate reduction, PAPS reductase, oxidoreductase; HET: A3P; 2.10A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8v_A Phosphoadenosine phosphosulfate reductase; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>3fwk_A FMN adenylyltransferase; FAD biosynthesis, alpha/beta protein, rossmann- like fold, APO-form, extended loop region; HET: BGC; 1.20A {Candida glabrata} PDB: 3g59_A* 3g5a_A* 3g6k_A* Back     alignment and structure
>1zun_A Sulfate adenylyltransferase subunit 2; beta barrel, switch domain, heterodimer, pyrophosphate, G protein; HET: GDP AGS; 2.70A {Pseudomonas syringae} SCOP: c.26.2.2 Back     alignment and structure
>2wsi_A FAD synthetase; transferase, nucleotidyltransferase, nucleotide-binding; HET: FAD; 1.90A {Saccharomyces cerevisiae} Back     alignment and structure
>1sur_A PAPS reductase; assimilatory sulfate reduction, 3-phospho-adenylyl-sulfate reductase, oxidoreductase; 2.00A {Escherichia coli} SCOP: c.26.2.2 Back     alignment and structure
>3zzx_A Thioredoxin; oxidoreductase; 1.88A {Litopenaeus vannamei} Back     alignment and structure
>3h79_A Thioredoxin-like protein; thioredoxin fold, catalytic cysteines missing, unknown funct; 1.50A {Trypanosoma cruzi} SCOP: c.47.1.0 Back     alignment and structure
>2av4_A Thioredoxin-like protein 4A (DIM1); U5 snRNP-SPECIFIC 15KD prote structural genomics, structural genomics consortium, SGC, U function; 1.73A {Plasmodium yoelii} Back     alignment and structure
>2qsi_A Putative hydrogenase expression/formation protein; HUPG, MCS SAD, structural genomics, protein structure initiative; 1.80A {Rhodopseudomonas palustris} Back     alignment and structure
>2qgv_A Hydrogenase-1 operon protein HYAE; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; 2.70A {Shigella flexneri 2A} PDB: 2hfd_A Back     alignment and structure
>3gnj_A Thioredoxin domain protein; APC92103, STR genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.99A {Desulfitobacterium hafniense dcb-2} SCOP: c.47.1.0 Back     alignment and structure
>3ga4_A Dolichyl-diphosphooligosaccharide-protein glycosyltransferase subunit OST6; oxidoreductase, active site loop, redox state, membrane; HET: PG4; 1.30A {Saccharomyces cerevisiae} PDB: 3g7y_A 3g9b_A* Back     alignment and structure
>2dml_A Protein disulfide-isomerase A6; thioredoxin domain-containing protein 7, endoplasmic reticulum, redox-active center, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3tco_A Thioredoxin (TRXA-1); disulfide oxidoreductase, oxidoreductase; 1.90A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>2dj1_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>2trx_A Thioredoxin; electron transport; 1.68A {Escherichia coli} SCOP: c.47.1.1 PDB: 1skr_B* 1skw_B* 1sl0_B* 1sks_B* 1sl2_B* 1t7p_B* 1t8e_B* 1tk0_B* 1tk5_B* 1tk8_B* 1tkd_B* 1sl1_B* 1x9s_B* 1x9w_B* 1xoa_A 1xob_A 1zyq_B* 2ajq_B* 2bto_T* 2h6x_A ... Back     alignment and structure
>3die_A Thioredoxin, TRX; electron transport, SWAP domain, redox enzymology, oxidoreductase, redox-active center, transport; 1.85A {Staphylococcus aureus} SCOP: c.47.1.1 PDB: 2o7k_A 2o85_A 2o89_A 2o87_A Back     alignment and structure
>3hxs_A Thioredoxin, TRXP; electron transport; 2.00A {Bacteroides fragilis} PDB: 3hyp_A Back     alignment and structure
>2i4a_A Thioredoxin; acidophIle, disulfide exchange, oxidoreductase; 1.00A {Acetobacter aceti} Back     alignment and structure
>1nsw_A Thioredoxin, TRX; thermostability, electron transport; 1.90A {Alicyclobacillus acidocaldarius} SCOP: c.47.1.1 PDB: 1rqm_A 1quw_A 1nw2_A Back     alignment and structure
>1x5d_A Protein disulfide-isomerase A6; PDIA6, ERP5, TXNDC7, thioredoxin like domain, redox, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3uvt_A Thioredoxin domain-containing protein 5; thioredoxin-like fold, isomerase; 2.00A {Homo sapiens} PDB: 2diz_A 3uj1_A Back     alignment and structure
>2voc_A Thioredoxin; electron transport, homodimer, disulfide, transport, redox-active center; 1.50A {Bacillus subtilis} PDB: 2ipa_A 2gzy_A 2gzz_A Back     alignment and structure
>1x5e_A Thioredoxin domain containing protein 1; TMX, TXNDC1, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1r26_A Thioredoxin; redox-active disulfide, electron transport; 1.40A {Trypanosoma} SCOP: c.47.1.1 Back     alignment and structure
>2yzu_A Thioredoxin; redox protein, electron transport, structural genomics; 1.90A {Thermus thermophilus} PDB: 2cvk_A Back     alignment and structure
>3qfa_C Thioredoxin; protein-protein complex, rossmann fold, HO pyridine nucleotide disulfide oxidoreductase, electron TRAN oxidoreductase; HET: FAD; 2.20A {Homo sapiens} PDB: 3qfb_C* Back     alignment and structure
>3p2a_A Thioredoxin 2, putative thioredoxin-like protein; structural genomics, center for structural genomics of infec diseases, csgid; 2.19A {Yersinia pestis} Back     alignment and structure
>1t00_A Thioredoxin, TRX; redox regulation, multifunction macromolecule, electron transport; 1.51A {Streptomyces coelicolor} Back     alignment and structure
>3hz4_A Thioredoxin; NYSGXRC, PSI-II, reduced form, protein structure initiative, structural genomics; 2.30A {Methanosarcina mazei} Back     alignment and structure
>2ppt_A Thioredoxin-2; thiredoxin, zinc finger, oxidoreductase; 1.92A {Rhodobacter capsulatus} Back     alignment and structure
>1w4v_A Thioredoxin, mitochondrial; antioxidant enzyme, mitochondrion, electron TRA oxidoreductase; 1.80A {Homo sapiens} PDB: 1uvz_A 1w89_A Back     alignment and structure
>2l5l_A Thioredoxin; structural genomics, electron transport, PSI-2, protein STRU initiative; NMR {Bacteroides vulgatus} Back     alignment and structure
>1dby_A Chloroplast thioredoxin M CH2; thioredoxin CH2, chloroplastic thioredoxin, oxidoreductase; NMR {Chlamydomonas reinhardtii} SCOP: c.47.1.1 Back     alignment and structure
>3f3q_A Thioredoxin-1; His TAG, electron transport, cytoplasm, deoxyribonucleotide synthesis, golgi apparatus, membrane, nucleus; 1.76A {Saccharomyces cerevisiae} PDB: 3f3r_A* 2i9h_A 2fa4_A 2hsy_A 3pin_A 4dss_B Back     alignment and structure
>3d6i_A Monothiol glutaredoxin-3; thioredoxin-like, electron transport, redox- active center, transport, oxidoreductase; HET: CME; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>2o8v_B Thioredoxin 1; disulfide crosslinked complex, oxidoreductase; 3.00A {Escherichia coli} Back     alignment and structure
>2pu9_C TRX-F, thioredoxin F-type, chloroplast; protein-protein complex, iron-sulfur, electron transport; 1.65A {Spinacia oleracea} PDB: 2pvo_C 1f9m_A Back     alignment and structure
>1thx_A Thioredoxin, thioredoxin 2; oxido-reductase, electron transport; 1.60A {Nostoc SP} SCOP: c.47.1.1 Back     alignment and structure
>1fb6_A Thioredoxin M; electron transport; 2.10A {Spinacia oleracea} SCOP: c.47.1.1 PDB: 1fb0_A 1gl8_A 2puk_C Back     alignment and structure
>3aps_A DNAJ homolog subfamily C member 10; thioredoxin fold, CXXC motif, endoplasmic reticulum, oxidore; 1.90A {Mus musculus} Back     alignment and structure
>2e0q_A Thioredoxin; electron transport; 1.49A {Sulfolobus tokodaii} PDB: 3hhv_A Back     alignment and structure
>1gh2_A Thioredoxin-like protein; redox-active center, electron transport; 2.22A {Homo sapiens} SCOP: c.47.1.1 Back     alignment and structure
>4euy_A Uncharacterized protein; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, unknown function; 2.90A {Bacillus cereus} Back     alignment and structure
>3evi_A Phosducin-like protein 2; alpha beta, 3-layer(ABA) sandwich, unknown function; 2.70A {Homo sapiens} Back     alignment and structure
>1mek_A Protein disulfide isomerase; electron transport, redox-active center, endoplasmic reticulum; NMR {Homo sapiens} SCOP: c.47.1.2 Back     alignment and structure
>1ep7_A Thioredoxin CH1, H-type; electron transport; 2.10A {Chlamydomonas reinhardtii} SCOP: c.47.1.1 PDB: 1tof_A 1ep8_A Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>1syr_A Thioredoxin; SGPP, structural genomics, PSI, protein structure initiative structural genomics of pathogenic protozoa consortium; 2.95A {Plasmodium falciparum} SCOP: c.47.1.1 Back     alignment and structure
>2i1u_A Thioredoxin, TRX, MPT46; redox protein, electron transport; 1.30A {Mycobacterium tuberculosis} PDB: 3nof_A 3o6t_A* 2l4q_A 2l59_A Back     alignment and structure
>2dj3_A Protein disulfide-isomerase A4; protein ERP-72, ERP72, CAI, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>3qou_A Protein YBBN; thioredoxin-like fold, tetratricopeptide repeat, lysine dimethylation, protein binding; HET: MLY; 1.80A {Escherichia coli} PDB: 3qdn_A* Back     alignment and structure
>1faa_A Thioredoxin F; electron transport; 1.85A {Spinacia oleracea} SCOP: c.47.1.1 Back     alignment and structure
>1xwb_A Thioredoxin; dimerization, redox regulation, THI X-RAY electron transport; 2.20A {Drosophila melanogaster} SCOP: c.47.1.1 PDB: 1xw9_A 1xwc_A 1xwa_A Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3m9j_A Thioredoxin; oxidoreductase; 1.10A {Homo sapiens} SCOP: c.47.1.1 PDB: 3m9k_A 2hsh_A 1erv_A 2ifq_A 2ifq_B 1auc_A 1eru_A 1ert_A 3kd0_A 1aiu_A 3trx_A 4trx_A 1trs_A 1tru_A 1trv_A 1trw_A 3e3e_A* 1cqg_A 1cqh_A 1mdi_A ... Back     alignment and structure
>3gix_A Thioredoxin-like protein 4B; PRE-mRNA splicing, TXNL4B, DLP, cell cycle, mRNA processing, mRNA splicing, nucleus, phosphoprotein, splicing; HET: SUC; 1.33A {Homo sapiens} SCOP: c.47.1.0 PDB: 1xbs_A Back     alignment and structure
>2vim_A Thioredoxin, TRX; thioredoxin fold, oxidoreductase; 1.38A {Fasciola hepatica} Back     alignment and structure
>1xfl_A Thioredoxin H1; AT3G51030, structural genomics, protein structure initiative, CESG, center for eukaryotic structural genomics; NMR {Arabidopsis thaliana} SCOP: c.47.1.1 Back     alignment and structure
>3apq_A DNAJ homolog subfamily C member 10; thioredoxin fold, DNAJ domain, endoplasmic reticulum, oxidor; 1.84A {Mus musculus} Back     alignment and structure
>2djj_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp1_A Back     alignment and structure
>2oe3_A Thioredoxin-3; electron transport, alpha/beta sandwich, oxidized, dimer; 1.80A {Saccharomyces cerevisiae} PDB: 2oe1_A 2oe0_A Back     alignment and structure
>2xc2_A Thioredoxinn; oxidoreductase, protein disulfide reductase; 1.56A {Schistosoma mansoni} PDB: 2xbq_A 2xbi_A Back     alignment and structure
>1oaz_A Thioredoxin 1; immune system, antibody/complex, antibody, allergy, IGE, conformational diversity, multispecficity, redox-active center; 2.77A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>2dj0_A Thioredoxin-related transmembrane protein 2; AVLA237, CGI-31 protein, TXNDC14, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2vlu_A Thioredoxin, thioredoxin H isoform 2.; oxidoreductase, thioredoxin-fold, protein disulfide reductase; 1.70A {Hordeum vulgare var} PDB: 2vlt_A 2vlv_A 2iwt_A* Back     alignment and structure
>1v98_A Thioredoxin; oxidoreductase, structural genomics, riken structural genomics/proteomics initiative, RSGI; 1.82A {Thermus thermophilus} Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>3ul3_B Thioredoxin, thioredoxin-2; PTEX, oxidoreductase; 2.90A {Plasmodium falciparum} Back     alignment and structure
>2wz9_A Glutaredoxin-3; protein binding; 1.55A {Homo sapiens} PDB: 2diy_A Back     alignment and structure
>3dxb_A Thioredoxin N-terminally fused to PUF60(UHM); splicing, FBP interacting repressor, RRM, electron TRAN redox-active center, transport; 2.20A {Escherichia coli O157} Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>2l6c_A Thioredoxin; oxidoreductase; NMR {Desulfovibrio vulgaris} PDB: 2l6d_A Back     alignment and structure
>1qgv_A Spliceosomal protein U5-15KD; snRNP, thioredoxin, transcription; 1.40A {Homo sapiens} SCOP: c.47.1.8 PDB: 1syx_A 1pqn_A Back     alignment and structure
>2j23_A Thioredoxin; immune protein, autoreactivity, cross-reactivity, IGE, fungi, epitope, allergen; 1.41A {Malassezia sympodialis} Back     alignment and structure
>1zma_A Bacterocin transport accessory protein; alpha-beta-alpha-sandwich, structural genomics, PSI, protein structure initiative; HET: MSE; 1.25A {Streptococcus pneumoniae} SCOP: c.47.1.1 Back     alignment and structure
>3cxg_A Putative thioredoxin; malaria, structural GEN oxidoreductase, structural genomics consortium, SGC; 2.00A {Plasmodium falciparum} Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>3d22_A TRXH4, thioredoxin H-type; electron transport, cytoplasm, redox-active center, transport, oxidoreductase; 1.60A {Populus trichocarpa x populusdeltoides} PDB: 3d21_A Back     alignment and structure
>2dbc_A PDCL2, unnamed protein product; phosducin-like protein, thioredoxin_FOLD, structural genomics, NPPSFA; NMR {Mus musculus} Back     alignment and structure
>1ti3_A Thioredoxin H, PTTRXH1; oxidoreductase; NMR {Populus tremula} SCOP: c.47.1.1 Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>2f51_A Thioredoxin; electron transport; 1.90A {Trichomonas vaginalis} Back     alignment and structure
>3idv_A Protein disulfide-isomerase A4; thioredoxin-like fold, disulfide bond, endoplasmic reticulum isomerase, redox-active center; 1.95A {Homo sapiens} PDB: 2dj2_A Back     alignment and structure
>3emx_A Thioredoxin; structural genomics, oxidoreductase, PSI-2, protein structure initiative, NEW YORK SGX research center for structural genomics; 2.25A {Aeropyrum pernix} Back     alignment and structure
>2l57_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, PSI protein structure initiative; NMR {Clostridium perfringens} Back     alignment and structure
>2vm1_A Thioredoxin, thioredoxin H isoform 1.; oxidoreductase, protein disulfide reductase, thioredoxin-FOL; 1.7A {Hordeum vulgare var} PDB: 2vm2_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>2es7_A Q8ZP25_salty, putative thiol-disulfide isomerase and thioredoxi; structural genomics, PSI, protein structure initiative; 2.80A {Salmonella typhimurium} SCOP: c.47.1.20 PDB: 2gzp_A 2jzt_A Back     alignment and structure
>2c0g_A ERP29 homolog, windbeutel protein; PDI-dbeta, PDI, protein disulfide isomerase, PIPE, dorsal-ventral patterning, chaperone, WIND mutants; 1.75A {Drosophila melanogaster} SCOP: a.71.1.1 c.47.1.7 PDB: 1ovn_A 2c0f_A 2c1y_A 2c0e_A Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3fk8_A Disulphide isomerase; APC61824.1, xylella fastidiosa temecul structural genomics, PSI-2, protein structure initiative; 1.30A {Xylella fastidiosa} Back     alignment and structure
>2qc7_A ERP31, ERP28, endoplasmic reticulum protein ERP29; B domain (residues 33-153), D domain (residues 154-261), CHA; 2.90A {Homo sapiens} PDB: 1g7e_A 1g7d_A Back     alignment and structure
>2yj7_A LPBCA thioredoxin; oxidoreductase; 1.65A {Synthetic construct} Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>1wou_A Thioredoxin -related protein, 14 kDa; electron transport; 1.80A {Homo sapiens} SCOP: c.47.1.16 PDB: 1v9w_A Back     alignment and structure
>2djk_A PDI, protein disulfide-isomerase; thioredoxin fold; NMR {Humicola insolens} SCOP: c.47.1.2 PDB: 2kp2_A Back     alignment and structure
>2trc_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; 2.40A {Rattus norvegicus} SCOP: c.47.1.6 Back     alignment and structure
>2kuc_A Putative disulphide-isomerase; structural genomics, thioredo PSI-2, protein structure initiative; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>2fwh_A Thiol:disulfide interchange protein DSBD; thioredoxin-like, C-terminal domain, reduced form at PH7, oxidoreductase; 0.99A {Escherichia coli} SCOP: c.47.1.1 PDB: 2fwe_A 2fwf_A 2fwg_A 1vrs_D 1uc7_A Back     alignment and structure
>3iv4_A Putative oxidoreductase; APC23140, meticillin-resistant staphylococcus aureus, oxidor thioredoxin fold, structural genomics, PSI-2; HET: MSE; 1.50A {Staphylococcus aureus subsp} Back     alignment and structure
>1a0r_P Phosducin, MEKA, PP33; transducin, beta-gamma, signal transduction, regulation, phosphorylation, G proteins, thioredoxin, vision; HET: FAR; 2.80A {Bos taurus} SCOP: c.47.1.6 PDB: 1b9y_C 1b9x_C Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>3f8u_A Protein disulfide-isomerase A3ERP57; endoplasmic reticulum, glycoprotein, immunoglobulin domain, microsome, protein disulfide isomerase, thioredoxin-like FO like domain; HET: NAG; 2.60A {Homo sapiens} PDB: 2dmm_A 2alb_A Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>1wmj_A Thioredoxin H-type; structural genomics, program for RICE genome research, oxidoreductase; NMR {Oryza sativa} Back     alignment and structure
>1fo5_A Thioredoxin; disulfide oxidoreductase, structural genomics, BSGC structure funded by NIH, protein structure initiative, PSI; NMR {Methanocaldococcus jannaschii} SCOP: c.47.1.1 Back     alignment and structure
>3qcp_A QSOX from trypanosoma brucei (tbqsox); ERV fold, thioredoxin fold, sulfhydryl oxidase, oxidoreducta; HET: FAD; 2.30A {Trypanosoma brucei} PDB: 3qd9_A* Back     alignment and structure
>1nho_A Probable thioredoxin; beta sheet, alpha helix, oxidoreductase; NMR {Methanothermobacter thermautotrophicusorganism_taxid} SCOP: c.47.1.1 Back     alignment and structure
>2b5e_A Protein disulfide-isomerase; 2.40A {Saccharomyces cerevisiae} SCOP: c.47.1.2 c.47.1.2 c.47.1.2 c.47.1.2 PDB: 3boa_A Back     alignment and structure
>3f9u_A Putative exported cytochrome C biogenesis-related; exported cytochrome C biogenesis-related protein, bacteroide fragilis; 2.20A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>3apo_A DNAJ homolog subfamily C member 10; PDI family, thioredoxin, endoplasmic reticulum, oxidoreducta; 2.40A {Mus musculus} Back     alignment and structure
>3dml_A Putative uncharacterized protein; thioredoxin, oxidoreductase, sulfur oxidation, thiol- disulfide oxidoreductase; HET: MSE; 1.90A {Paracoccus denitrificans} PDB: 3d4t_A* Back     alignment and structure
>2ju5_A Thioredoxin disulfide isomerase; protein, oxidoreductase; NMR {Chlamydophila pneumoniae} Back     alignment and structure
>2lst_A Thioredoxin; structural genomics, NEW YORK structural genomics research consortium, oxidoreductase; NMR {Thermus thermophilus} Back     alignment and structure
>1z6n_A Hypothetical protein PA1234; alpha-beta-alpha sandwich, structura genomics, PSI, protein structure initiative; 1.50A {Pseudomonas aeruginosa} SCOP: c.47.1.1 PDB: 3lef_A Back     alignment and structure
>2ywb_A GMP synthase [glutamine-hydrolyzing]; GMP synthetase, XMP binding, ATP binding, purine nucleotide biosynthetic pathway, structural genomics; 2.10A {Thermus thermophilus} PDB: 2ywc_A* Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>1sen_A Thioredoxin-like protein P19; endoplasmic reticulum, RP19, structural genomics, PSI, protein structure initiative; 1.20A {Homo sapiens} SCOP: c.47.1.1 PDB: 2k8v_A Back     alignment and structure
>3kp8_A Vkorc1/thioredoxin domain protein; blood coagulation, disulfide formation, redox partner, oxidoreductase; 1.66A {Synechococcus SP} Back     alignment and structure
>3raz_A Thioredoxin-related protein; structural genomics, PSI-2, protein structure initiative; 2.00A {Neisseria meningitidis serogroup B} Back     alignment and structure
>1lu4_A Soluble secreted antigen MPT53; thioredoxin-like fold, structural genomics, PSI, protein structure initiative; 1.12A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>2b5x_A YKUV protein, TRXY; thioredoxin-like, oxidoreductase; NMR {Bacillus subtilis} SCOP: c.47.1.10 PDB: 2b5y_A Back     alignment and structure
>2dpl_A GMP synthetase, GMP synthase [glutamine-hydrolyzing] subunit B; pyrococcus horikoshii OT3, structural genomics, NPPSFA; 1.43A {Pyrococcus horikoshii} PDB: 2z0c_A 3a4i_A Back     alignment and structure
>1wy5_A TILS, hypothetical UPF0072 protein AQ_1887; N-type ATP-ppase, structural genomics, translation, NPPSFA; 2.42A {Aquifex aeolicus} SCOP: c.26.2.5 d.229.1.1 PDB: 2e21_A* 2e89_A* Back     alignment and structure
>3ph9_A Anterior gradient protein 3 homolog; thioredoxin fold, protein disulfide isomerase, endoplasmic R isomerase; 1.83A {Homo sapiens} SCOP: c.47.1.0 PDB: 2lns_A 2lnt_A Back     alignment and structure
>3ira_A Conserved protein; methanosarcina mazei,structural genomics, MCSG, protein structure initiative, midwest center for STRU genomics; 2.10A {Methanosarcina mazei} Back     alignment and structure
>3or5_A Thiol:disulfide interchange protein, thioredoxin protein; PSI-II, structural genomics, protein structure initiative; 1.66A {Chlorobaculum tepidum} SCOP: c.47.1.0 Back     alignment and structure
>1ilo_A Conserved hypothetical protein MTH895; beta-alpha-beta-alpha-beta-BETA-alpha motif, structural genomics, PSI; NMR {Methanothermobacterthermautotrophicus str} SCOP: c.47.1.1 Back     alignment and structure
>1a8l_A Protein disulfide oxidoreductase; PDI, thioredoxin fold; 1.90A {Pyrococcus furiosus} SCOP: c.47.1.2 c.47.1.2 PDB: 1j08_A Back     alignment and structure
>3erw_A Sporulation thiol-disulfide oxidoreductase A; thioredoxin-like fold, RESA-like fold, dithiol, STOA, redox-active center; 2.50A {Bacillus subtilis} SCOP: c.47.1.0 Back     alignment and structure
>1zzo_A RV1677; thioredoxin fold, structural genomics, PSI, protein structure initiative, TB structural genomics consortium, TBSGC; 1.60A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 3ios_A Back     alignment and structure
>2f9s_A Thiol-disulfide oxidoreductase RESA; thioredoxin-like protein; HET: MSE; 1.40A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1st9_A 1su9_A 2h1d_A 2h1b_A 2h1a_A 2h19_A 2h1g_A 3c71_A 3c73_A Back     alignment and structure
>2ywm_A Glutaredoxin-like protein; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 2.30A {Aquifex aeolicus} PDB: 2ayt_A Back     alignment and structure
>2h30_A Thioredoxin, peptide methionine sulfoxide reductase MSRA/MSRB; reduced, thiol-disulfide exchange, oxidoreductase; 1.60A {Neisseria gonorrhoeae} PDB: 2jzr_A 2jzs_A 2k9f_A 2fy6_A Back     alignment and structure
>2lja_A Putative thiol-disulfide oxidoreductase; structural genomics, unknown function, thioredoxin-like; NMR {Bacteroides vulgatus} Back     alignment and structure
>3lor_A Thiol-disulfide isomerase and thioredoxins; PSI, MCSG, structural genomics, midwest CE structural genomics; HET: MSE; 2.20A {Corynebacterium glutamicum} Back     alignment and structure
>3eyt_A Uncharacterized protein SPOA0173; thioredoxin-like superfamily protein SPOA0173, silicibacter DSS, structural genomics, PSI-2; 1.95A {Silicibacter pomeroyi} Back     alignment and structure
>4evm_A Thioredoxin family protein; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.51A {Streptococcus pneumoniae} Back     alignment and structure
>3hcz_A Possible thiol-disulfide isomerase; APC61559.2, cytophaga hutchinsoni structural genomics, PSI-2, protein structure initiative; 1.88A {Cytophaga hutchinsonii} Back     alignment and structure
>2l5o_A Putative thioredoxin; structural genomics, unknown function, PSI-2, protein struct initiative; NMR {Neisseria meningitidis serogroup B} Back     alignment and structure
>2fgx_A Putative thioredoxin; NET3, NESG, GFT-glutaredoxin-like, structural genomics, PSI, protein structure initiative; NMR {Nitrosomonas europaea} Back     alignment and structure
>3eur_A Uncharacterized protein; PSI2,MCSG, conserved protein, structural genomics, protein S initiative, midwest center for structural genomics; HET: MSE; 1.30A {Bacteroides fragilis} Back     alignment and structure
>3hdc_A Thioredoxin family protein; ATCC53774, DSM 7210, , structural genomics, PSI-2, protein structure initiative; 1.77A {Geobacter metallireducens gs-15} Back     alignment and structure
>3ewl_A Uncharacterized conserved protein BF1870; alpha-beta fold, structural genomics, PSI-2, protein structu initiative; 2.00A {Bacteroides fragilis} Back     alignment and structure
>3fkf_A Thiol-disulfide oxidoreductase; structural genomics, PSI-2, structure initiative, midwest center for structural genomic oxidoreductase; 2.20A {Bacteroides fragilis} Back     alignment and structure
>2lrn_A Thiol:disulfide interchange protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, oxidoreductase; NMR {Bacteroides SP} Back     alignment and structure
>3gl3_A Putative thiol:disulfide interchange protein DSBE; oxidoreductase, PSI-II, structural genomics, protein structure initiative; 2.09A {Chlorobium tepidum tls} Back     alignment and structure
>1ttz_A Conserved hypothetical protein; structural genomics, unknown function, PSI, protein structure initiative; 2.11A {Xanthomonas campestris} SCOP: c.47.1.1 PDB: 1xpv_A Back     alignment and structure
>3lwa_A Secreted thiol-disulfide isomerase; thioredoxin, PSI, MCSG, structural genomics, midwest center for structural genomics; 1.75A {Corynebacterium glutamicum} Back     alignment and structure
>2lrt_A Uncharacterized protein; structural genomics, thioredoxin-like, NEW YORK structural G research consortium, nysgrc, PSI-biology; NMR {Bacteroides vulgatus} Back     alignment and structure
>3ia1_A THIO-disulfide isomerase/thioredoxin; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Thermus thermophilus} Back     alignment and structure
>3k32_A Uncharacterized protein MJ0690; predicted subunit of tRNA methyltransferase, methanocaldococcus jannaschii DSM , PSI- 2; 2.50A {Methanocaldococcus jannaschii} Back     alignment and structure
>3bl5_A Queuosine biosynthesis protein QUEC; PREQ1 biosynthesis, RNA modification, tRNA, hydrolase; 2.95A {Bacillus subtilis} Back     alignment and structure
>3kcm_A Thioredoxin family protein; SGX, thioredoxin protein, PSI, structural genomics, protein initiative; 2.45A {Geobacter metallireducens gs-15} Back     alignment and structure
>3uem_A Protein disulfide-isomerase; thioredoxin-like domain, chaper; 2.29A {Homo sapiens} PDB: 2k18_A 1x5c_A 1bjx_A 2bjx_A Back     alignment and structure
>3ha9_A Uncharacterized thioredoxin-like protein; PSI, MCSG, structural G midwest center for structural genomics, protein structure initiative; 1.70A {Aeropyrum pernix} Back     alignment and structure
>1i5g_A Tryparedoxin II; electron transport; HET: TS5; 1.40A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1o6j_A 1o81_A 1oc8_A 1oc9_B 1fg4_A 1oc9_A Back     alignment and structure
>1kng_A Thiol:disulfide interchange protein CYCY; thioredoxin fold, cytochrome C maturation, atomic resolution oxidoreductase; 1.14A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>4fo5_A Thioredoxin-like protein; AHPC/TSA family protein, structural genomics, joint center F structural genomics, JCSG; 2.02A {Parabacteroides distasonis} Back     alignment and structure
>3fw2_A Thiol-disulfide oxidoreductase; structural genomics, APC61456.1, thiol-disulfide oxidoreduct TLPA-like family, PSI-2; 1.74A {Bacteroides thetaiotaomicron} Back     alignment and structure
>2b1k_A Thiol:disulfide interchange protein DSBE; C-terminal thioredoxin-like domain, N-terminal beta-sheet, fingerprint rigion, oxidoreductase; 1.90A {Escherichia coli} PDB: 3k8n_A 2g0f_A 1z5y_E 2b1l_A Back     alignment and structure
>1o8x_A Tryparedoxin, TRYX, TXNI; tryparedoxin-I, synchrotron radiation, disulfide bonds tryparedoxin, thioredoxin, trypanosome; 1.3A {Crithidia fasciculata} SCOP: c.47.1.10 PDB: 1okd_A 1qk8_A 1o85_A 1o8w_A 1o7u_A 1ezk_A 1ewx_A Back     alignment and structure
>3a2k_A TRNA(Ile)-lysidine synthase; ligase, pseudo-knot, ligase/RNA complex; 3.65A {Geobacillus kaustophilus} Back     alignment and structure
>1kor_A Argininosuccinate synthetase; ligase, riken structural genomics/proteomics initiative, RSGI, structural genomics; HET: ANP ARG; 1.95A {Thermus thermophilus} SCOP: c.26.2.1 d.210.1.1 PDB: 1j1z_A* 1j21_A* 1kh1_A 1kh2_A* 1kh3_A* 1j20_A* Back     alignment and structure
>2dlx_A UBX domain-containing protein 7; UAS domain, protein KIAA0794, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: c.47.1.24 Back     alignment and structure
>1o73_A Tryparedoxin; electron transport, trypanosomatid, thioredoxin; 2.28A {Trypanosoma brucei brucei} SCOP: c.47.1.10 Back     alignment and structure
>1ni5_A Putative cell cycle protein MESJ; structural genomics, ATPase, PP-type, putative cell cycle PR PSI, protein structure initiative; 2.65A {Escherichia coli} SCOP: b.153.1.2 c.26.2.5 d.229.1.1 Back     alignment and structure
>2ywi_A Hypothetical conserved protein; uncharacterized conserved protein, NPPSFA, national project protein structural and functional analyses; 1.60A {Geobacillus kaustophilus} Back     alignment and structure
>3s9f_A Tryparedoxin; thioredoxin fold, disulfide reductase, electron transport; 1.80A {Leishmania major} Back     alignment and structure
>2hyx_A Protein DIPZ; thioredoxin fold, jelly-roll, structural genomics, TB struct genomics consortium, TBSGC, unknown function; 1.90A {Mycobacterium tuberculosis} Back     alignment and structure
>3kh7_A Thiol:disulfide interchange protein DSBE; TRX-like, thiol-disulfide exchange, cell inner membrane, CYT C-type biogenesis, disulfide bond; 1.75A {Pseudomonas aeruginosa} PDB: 3kh9_A Back     alignment and structure
>2pg3_A Queuosine biosynthesis protein QUEC; YP_049261.1, hypothetical protein, structural genomics, JOIN for structural genomics; 2.40A {Pectobacterium atrosepticum SCRI1043} SCOP: c.26.2.1 Back     alignment and structure
>2cvb_A Probable thiol-disulfide isomerase/thioredoxin; redox protein, structural genomics, riken struc genomics/proteomics initiative, RSGI; 1.80A {Thermus thermophilus} SCOP: c.47.1.10 PDB: 2ywo_A Back     alignment and structure
>1jfu_A Thiol:disulfide interchange protein TLPA; thioredoxin-like, double disulfide bridge, membrane protein; 1.60A {Bradyrhizobium japonicum} SCOP: c.47.1.10 Back     alignment and structure
>2hls_A Protein disulfide oxidoreductase; thioredoxin fold; 1.93A {Aeropyrum pernix} Back     alignment and structure
>3u5r_E Uncharacterized protein; structural genomics, PSI-biology, NEW YORK structural genomi research consortium, nysgrc, hypothetical protein; 2.05A {Sinorhizobium meliloti} Back     alignment and structure
>2ls5_A Uncharacterized protein; structural genomics, unknown function, thioredoxin-like, NEW structural genomics research consortium; NMR {Bacteroides thetaiotaomicron} Back     alignment and structure
>2hma_A Probable tRNA (5-methylaminomethyl-2-thiouridylat methyltransferase; alpha-beta, beta barrel, structural genomics, PSI-2; HET: MSE SAM; 2.41A {Streptococcus pneumoniae} Back     alignment and structure
>3kp9_A Vkorc1/thioredoxin domain protein; warfarin, disulfide formation, blood coagulation, oxidoreduc blood coagulation,oxidoreductase; HET: U10; 3.60A {Synechococcus SP} Back     alignment and structure
>2lus_A Thioredoxion; CR-Trp16, oxidoreductase; NMR {Carcinoscorpius rotundicauda} Back     alignment and structure
>3drn_A Peroxiredoxin, bacterioferritin comigratory prote homolog; bacterioferritin comigratory protein, oxidore; HET: CIT; 2.15A {Sulfolobus solfataricus} SCOP: c.47.1.0 Back     alignment and structure
>1wjk_A C330018D20RIK protein; glutaredoxin, thioredoxin fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>1hyu_A AHPF, alkyl hydroperoxide reductase subunit F; thiol-thiolate hydrogen bond, nucleotide binding fold, thior reductase, thioredoxin; HET: FAD; 2.00A {Salmonella typhimurium} SCOP: c.3.1.5 c.3.1.5 c.47.1.2 c.47.1.2 PDB: 1zyn_A 1zyp_A Back     alignment and structure
>2rli_A SCO2 protein homolog, mitochondrial; copper protein, thioredoxin fold, metal transport, structural genomics, spine2-complexes; NMR {Homo sapiens} Back     alignment and structure
>2ggt_A SCO1 protein homolog, mitochondrial; copper chaperone, Cu-binding protein, mitochondrial assembly factor, redox, nickel, disuplhide, mitochondrion; 2.40A {Homo sapiens} SCOP: c.47.1.10 PDB: 2gqk_A 2gql_A 2gqm_A 2gt5_A 2gt6_A 2gvp_A 2hrf_A 2hrn_A 1wp0_A Back     alignment and structure
>1xng_A NH(3)-dependent NAD(+) synthetase; amidotransferase, ligase; HET: DND ATP; 1.70A {Helicobacter pylori} SCOP: c.26.2.1 PDB: 1xnh_A Back     alignment and structure
>2vup_A Glutathione peroxidase-like protein; oxidoreductase, trypanothione, dithiol-dependant peroxidase; 2.10A {Trypanosoma brucei} Back     alignment and structure
>3fiu_A NH(3)-dependent NAD(+) synthetase; rossman fold, adenine nucleotide alpha hydrolase-like, ATP- binding, ligase, nucleotide-binding; HET: AMP; 1.85A {Francisella tularensis subsp} Back     alignment and structure
>2k8s_A Thioredoxin; dimer, structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; NMR {Nitrosomonas europaea} Back     alignment and structure
>3dwv_A Glutathione peroxidase-like protein; alpha beta, 3-layer(ABA) sandwich, glutaredoxin fold, oxidor peroxidase; 1.41A {Trypanosoma brucei} PDB: 2rm5_A 2rm6_A 3e0u_A Back     alignment and structure
>2der_A TRNA-specific 2-thiouridylase MNMA; protein-RNA complex, transferase/RNA complex; 3.10A {Escherichia coli} PDB: 2det_A 2deu_A* Back     alignment and structure
>2bmx_A Alkyl hydroperoxidase C; peroxiredoxin, antioxidant defense system, oxidoreductase, structural proteomics in EURO spine; 2.4A {Mycobacterium tuberculosis} SCOP: c.47.1.10 Back     alignment and structure
>1xvw_A Hypothetical protein RV2238C/MT2298; thioredoxin fold, oxidized cystein sulfenic acid, structural genomics, PSI; 1.90A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1xxu_A Back     alignment and structure
>3tqi_A GMP synthase [glutamine-hydrolyzing]; ligase; 2.84A {Coxiella burnetii} Back     alignment and structure
>3cmi_A Peroxiredoxin HYR1; thioredoxin-like fold, oxidoreductase, peroxidase, redox-ACT center; 2.02A {Saccharomyces cerevisiae} Back     alignment and structure
>2v1m_A Glutathione peroxidase; selenium, selenocysteine, oxidoreductase, lipid peroxidase, schistosoma detoxification pathway; 1.00A {Schistosoma mansoni} PDB: 2wgr_A Back     alignment and structure
>2e18_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, NPPSFA, national project on Pro structural and functional analyses; 2.10A {Pyrococcus horikoshii} Back     alignment and structure
>2p5q_A Glutathione peroxidase 5; thioredoxin fold, oxidoreductase; 2.00A {Populus trichocarpa x populusdeltoides} PDB: 2p5r_A Back     alignment and structure
>1we0_A Alkyl hydroperoxide reductase C; peroxiredoxin, AHPC, oxidoreductase; 2.90A {Amphibacillus xylanus} SCOP: c.47.1.10 Back     alignment and structure
>1zof_A Alkyl hydroperoxide-reductase; decamer, toroide-shaped complex, oxidoreductase; 2.95A {Helicobacter pylori} SCOP: c.47.1.10 Back     alignment and structure
>1ego_A Glutaredoxin; electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 1egr_A 1grx_A* 1qfn_A Back     alignment and structure
>2k6v_A Putative cytochrome C oxidase assembly protein; thioredoxin fold, electron transfer protein, metal binding protein, electron transport; NMR {Thermus thermophilus} Back     alignment and structure
>2e7p_A Glutaredoxin; thioredoxin fold, poplar, electron transport; HET: GSH; 2.10A {Populus tremula x populus tremuloides} PDB: 1z7p_A 1z7r_A Back     alignment and structure
>2p31_A CL683, glutathione peroxidase 7; thioredoxin fold, NPGPX, phospholipid hydroperoxidase, struc genomics, structural genomics consortium, SGC; 2.00A {Homo sapiens} Back     alignment and structure
>3p52_A NH(3)-dependent NAD(+) synthetase; structural genomics, center for structural genomics of infec diseases, NADE, CSGI; 2.74A {Campylobacter jejuni} SCOP: c.26.2.0 Back     alignment and structure
>2f8a_A Glutathione peroxidase 1; thioredoxin fold, structural genomics, structural genomics consortium, SGC, oxidoreductase; 1.50A {Homo sapiens} SCOP: c.47.1.10 PDB: 1gp1_A 2he3_A Back     alignment and structure
>2obi_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase (GPX4); human GPX4, selenoprotein, thioredoxin-fold, anti-oxidatve defense system; 1.55A {Homo sapiens} Back     alignment and structure
>1gpm_A GMP synthetase, XMP aminase; class I glutamine amidotransferase, N-type ATP pyrophosphata transferase (glutamine amidotransferase); HET: AMP CIT; 2.20A {Escherichia coli} SCOP: c.23.16.1 c.26.2.1 d.52.2.1 Back     alignment and structure
>2gs3_A PHGPX, GPX-4, phospholipid hydroperoxide glutathione peroxidase; GSHPX-4,phospholipid hydroperoxide; 1.90A {Homo sapiens} Back     alignment and structure
>1uul_A Tryparedoxin peroxidase homologue; peroxiredoxin, oxidoreductase; 2.8A {Trypanosoma cruzi} SCOP: c.47.1.10 Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>1zye_A Thioredoxin-dependent peroxide reductase; catenane, dodecamer, peroxiredoxin, oxidoreductase; 3.30A {Bos taurus} SCOP: c.47.1.10 Back     alignment and structure
>2h01_A 2-Cys peroxiredoxin; thioredoxin peroxidase, structural genomics, SGC, structural genomics consortium, oxidoreductase; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 Back     alignment and structure
>3kij_A Probable glutathione peroxidase 8; human PDI-peroxidase, membrane, oxidoreductase, transmembrane; 1.80A {Homo sapiens} SCOP: c.47.1.0 PDB: 3cyn_A Back     alignment and structure
>2i81_A 2-Cys peroxiredoxin; structural genomics consortium, SGC, oxidoreductase; 2.45A {Plasmodium vivax sai-1} PDB: 2h66_A Back     alignment and structure
>3ztl_A Thioredoxin peroxidase; oxidoreductase, reductase, schistosomiasis, thioredoxin fold; 3.00A {Schistosoma mansoni} PDB: 3zvj_A 3zvj_D Back     alignment and structure
>2c5s_A THII, probable thiamine biosynthesis protein THII; RNA-binding protein, RNA binding protein, tRNA modification, 4-thiouridine synthase; HET: AMP; 2.5A {Bacillus anthracis} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3gkn_A Bacterioferritin comigratory protein; BCP, PRX, atypical 2-Cys, oxidoreduc; HET: BIH; 1.47A {Xanthomonas campestris PV} PDB: 3gkk_A 3gkm_A Back     alignment and structure
>2jsy_A Probable thiol peroxidase; solution structure, antioxidant, oxidoreductase; NMR {Bacillus subtilis} PDB: 2jsz_A Back     alignment and structure
>3gyk_A 27KDA outer membrane protein; APC61738.2, silicibacter pomeroyi DSS-3, thioredoxin-like, oxidoreductase, structural genomics, PSI-2; HET: MSE; 1.76A {Silicibacter pomeroyi} Back     alignment and structure
>1k92_A Argininosuccinate synthase, argininosuccinate SY; N-type ATP pyrophosphatase, ligase; 1.60A {Escherichia coli} SCOP: c.26.2.1 d.210.1.1 PDB: 1k97_A* 1kp2_A* 1kp3_A* Back     alignment and structure
>1eej_A Thiol:disulfide interchange protein; oxidoreductase, protein disulfide isomerase, protein folding, redox protein, redox-active center; HET: MES; 1.90A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1tjd_A 1jzd_A 1jzo_A 1g0t_A 2iyj_A Back     alignment and structure
>2b7k_A SCO1 protein; metallochaperone, cytochrome C oxidase, metal binding protein; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 PDB: 2b7j_A Back     alignment and structure
>2nz2_A Argininosuccinate synthase; amino-acid biosynthesis, aspartate, citrulline, ST genomics, structural genomics consortium, SGC, ligase; HET: CIR; 2.40A {Homo sapiens} Back     alignment and structure
>1xzo_A BSSCO, hypothetical protein YPMQ; thioredoxin-like fold, structural genomics, montreal-kingsto bacterial structural genomics initiative, BSGI; 1.70A {Bacillus subtilis} SCOP: c.47.1.10 PDB: 1on4_A Back     alignment and structure
>1t3b_A Thiol:disulfide interchange protein DSBC; oxidoreductase, protein disulfide isomerase, protein folding, redox protein; 2.50A {Haemophilus influenzae} SCOP: c.47.1.9 d.17.3.1 Back     alignment and structure
>1xvq_A Thiol peroxidase; thioredoxin fold, structural genomics, PSI, protein structur initiative, TB structural genomics consortium, TBSGC; 1.75A {Mycobacterium tuberculosis} SCOP: c.47.1.10 PDB: 1y25_A Back     alignment and structure
>3hd5_A Thiol:disulfide interchange protein DSBA; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 2.35A {Bordetella parapertussis} Back     alignment and structure
>1r7h_A NRDH-redoxin; thioredoxin, glutaredoxin, redox protein, domain swapping, electron transport; 2.69A {Corynebacterium ammoniagenes} SCOP: c.47.1.1 Back     alignment and structure
>1h75_A Glutaredoxin-like protein NRDH; electron transport, thioredoxin, redox protein; 1.7A {Escherichia coli} SCOP: c.47.1.1 Back     alignment and structure
>2a4v_A Peroxiredoxin DOT5; yeast nuclear thiol peroxidase, atypical 2-Cys peroxiredoxin, oxidoreductase; 1.80A {Saccharomyces cerevisiae} SCOP: c.47.1.10 Back     alignment and structure
>2c0d_A Thioredoxin peroxidase 2; peroxiredoxin, 2-Cys, thioredoxin dependant, mitochondrial, antioxidant, oxidoreductase, redox-active center; 1.78A {Plasmodium falciparum} Back     alignment and structure
>3ixr_A Bacterioferritin comigratory protein; alpha beta protein, oxidoreductase; 1.60A {Xylella fastidiosa} Back     alignment and structure
>3uow_A GMP synthetase; structural genomics consortium, SGC, purine nucleotide biosy process, ligase; HET: XMP; 2.72A {Plasmodium falciparum} Back     alignment and structure
>2i3y_A Epididymal secretory glutathione peroxidase; thioredoxin fold, epididymal androgen related protein, struc genomics, structural genomics consortium; 2.00A {Homo sapiens} Back     alignment and structure
>3a2v_A Probable peroxiredoxin; thioredoxin peroxidase, hydrogen peroxide, antioxidant, oxidoreductase, redox-active center; 1.65A {Aeropyrum pernix} PDB: 1x0r_A 2zct_A 2nvl_A 2e2g_A 2cv4_A* 3a5w_A 2e2m_A 3a2x_A 3a2w_A Back     alignment and structure
>2l4c_A Endoplasmic reticulum resident protein 27; ERP27, PDI, B domain, peptide binding; NMR {Homo sapiens} Back     alignment and structure
>2pn8_A Peroxiredoxin-4; thioredoxin, oxidoreductase, structural genomics consortium, SGC; 1.80A {Homo sapiens} Back     alignment and structure
>1n8j_A AHPC, alkyl hydroperoxide reductase C22 protein; peroxiredoxin, decamer, antioxidant, peroxidase, AHPF, oxidoreductase; 2.17A {Salmonella typhimurium} SCOP: c.47.1.10 PDB: 1yep_A 1yf1_A 1yf0_A 1yex_A 3emp_A Back     alignment and structure
>2r37_A Glutathione peroxidase 3; plasma, structural genomics consort oxidoreductase, secreted, selenium, selenocysteine; 1.85A {Homo sapiens} Back     alignment and structure
>3h93_A Thiol:disulfide interchange protein DSBA; disulfide bond, redox-active center, transcription regulator; HET: MSE GOL; 1.50A {Pseudomonas aeruginosa PAO1} SCOP: c.47.1.0 Back     alignment and structure
>4g2e_A Peroxiredoxin; redox protein, structural genomics, NPPSFA, national project protein structural and functional analyses; 1.40A {Sulfolobus tokodaii} PDB: 2ywn_A 3hjp_A Back     alignment and structure
>1v58_A Thiol:disulfide interchange protein DSBG; reduced DSBG, redox protein, protein disulfide isomerase, thioredoxin fold; 1.70A {Escherichia coli} SCOP: c.47.1.9 d.17.3.1 PDB: 1v57_A 2h0i_A 2h0h_A 2h0g_A 2iy2_A Back     alignment and structure
>1vl2_A Argininosuccinate synthase; TM1780, structural genomics, JCS protein structure initiative, PSI, joint center for structu genomics, ligase; 1.65A {Thermotoga maritima} SCOP: c.26.2.1 d.210.1.1 Back     alignment and structure
>3me7_A Putative uncharacterized protein; electron transfer protein, electron transport, structural GE PSI-2, protein structure initiative; 1.50A {Aquifex aeolicus} PDB: 3me8_A Back     alignment and structure
>3us3_A Calsequestrin-1; calcium-binding protein; 1.74A {Oryctolagus cuniculus} PDB: 1a8y_A 3v1w_A* 3trq_A* 3trp_A* 3uom_A Back     alignment and structure
>3qpm_A Peroxiredoxin; oxidoreductase, thioredoxin fold, peroxidase; 1.90A {Larimichthys crocea} Back     alignment and structure
>4f9z_D Endoplasmic reticulum resident protein 27; thioredoxin fold, ER foldase, ERP57, binding protein; HET: PE3 PE4; 2.20A {Homo sapiens} PDB: 2l4c_A Back     alignment and structure
>2vxo_A GMP synthase [glutamine-hydrolyzing]; proto-oncogene, phosphoprotein, GMP synthetase, guanine monophosphate synthetase, chromosomal rearrangement; HET: XMP; 2.5A {Homo sapiens} Back     alignment and structure
>1psq_A Probable thiol peroxidase; structural genomics, NYSGXRC, PSI, structure initiative, NEW YORK SGX research center for STRU genomics; 2.30A {Streptococcus pneumoniae} SCOP: c.47.1.10 Back     alignment and structure
>4gqc_A Thiol peroxidase, peroxiredoxin Q; CXXXXC motif, fully folded, locally unfolded, peroxide, DTT, structural genomics, riken; 2.00A {Aeropyrum pernix} PDB: 2cx3_A 2cx4_A 4gqf_A Back     alignment and structure
>1sji_A Calsequestrin 2, calsequestrin, cardiac muscle isoform; glycoprotein, calcium-binding, muscle protein, metal binding protein; 2.40A {Canis lupus familiaris} PDB: 2vaf_A Back     alignment and structure
>1kte_A Thioltransferase; redox-active center, electron transport, acetylation; 2.20A {Sus scrofa} SCOP: c.47.1.1 PDB: 1jhb_A 1b4q_A* Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>2hze_A Glutaredoxin-1; thioredoxin fold, arsenic, dimethylarsenite., electron trans oxidoreductase; 1.80A {Ectromelia virus} PDB: 2hzf_A 2hze_B Back     alignment and structure
>3tjj_A Peroxiredoxin-4; thioredoxin fold, sulfenylation, endoplasmic reticulum, oxidoreductase; HET: CSO; 1.91A {Homo sapiens} PDB: 3tjk_A 3tjb_A 3tjf_A 3tjg_A 3tkq_A 3tkp_A 3tks_A 3tkr_A 3tks_C Back     alignment and structure
>3uma_A Hypothetical peroxiredoxin protein; nysgrc, PSI biology, structural genomics, NEW YORK structura genomics research consortium; 2.20A {Sinorhizobium meliloti} Back     alignment and structure
>3p7x_A Probable thiol peroxidase; thioredoxin fold, oxidoreductase; HET: PG4; 1.96A {Staphylococcus aureus} SCOP: c.47.1.0 Back     alignment and structure
>1q98_A Thiol peroxidase, TPX; structural genomics, NYSGXRC, PSI, protein structure initiative; 1.90A {Haemophilus influenzae} SCOP: c.47.1.10 Back     alignment and structure
>1prx_A HORF6; peroxiredoxin, hydrogen peroxide, redox regulation, cellular signaling, antioxidant; 2.00A {Homo sapiens} SCOP: c.47.1.10 Back     alignment and structure
>1tp9_A Peroxiredoxin, PRX D (type II); oligomer, thioredoxin fold, oxidoreductase; 1.62A {Populus trichocarpa} SCOP: c.47.1.10 Back     alignment and structure
>2wfc_A Peroxiredoxin 5, PRDX5; oxidoreductase, antioxidant enzymes; 1.75A {Arenicola marina} Back     alignment and structure
>2yzh_A Probable thiol peroxidase; redox protein, antioxidant, oxidoreductase, STRU genomics, NPPSFA; 1.85A {Aquifex aeolicus} Back     alignment and structure
>3n05_A NH(3)-dependent NAD(+) synthetase; ligase, structural genomics, protein structure initiative, P nysgrc; 2.35A {Streptomyces avermitilis} Back     alignment and structure
>2v2g_A Peroxiredoxin 6; oxidoreductase, antioxidant enzymes; 1.60A {Arenicola marina} PDB: 2v32_A 2v41_A Back     alignment and structure
>2ec4_A FAS-associated factor 1; UAS domain, protein FAF1, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>1un2_A DSBA, thiol-disulfide interchange protein; disulfide oxidoreductase, oxidoreductase, protein disulfide isomerase, protein folding, thioredoxin; 2.4A {Escherichia coli} SCOP: c.47.1.13 Back     alignment and structure
>2klx_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Bartonella henselae} Back     alignment and structure
>3q4g_A NH(3)-dependent NAD(+) synthetase; structural genomics, csgid, center for structural genomics O infectious diseases, alpha beta; 2.40A {Vibrio cholerae} SCOP: c.26.2.0 Back     alignment and structure
>3bj5_A Protein disulfide-isomerase; thioredoxin fold, chaperone, endoplasmic reticulum, isomeras membrane, redox-active center; 2.20A {Homo sapiens} Back     alignment and structure
>2znm_A Thiol:disulfide interchange protein DSBA; thioredoxin fold, DSBA-like, oxidoreductase; 2.30A {Neisseria meningitidis serogroup B} PDB: 3dvx_A Back     alignment and structure
>3mng_A Peroxiredoxin-5, mitochondrial; peroxidase, PRXV, substrate analog, DTT, oxidoreductase; 1.45A {Homo sapiens} SCOP: c.47.1.10 PDB: 2vl3_A 1oc3_A 2vl2_A 2vl9_A 1urm_A 1hd2_A 1h4o_A Back     alignment and structure
>3dpi_A NAD+ synthetase; ssgcid, decode, structural genomics, PSI, protein structure initiative; 2.20A {Burkholderia pseudomallei} SCOP: c.26.2.0 Back     alignment and structure
>3zrd_A Thiol peroxidase; oxidoreductase, 2Cys peroxiredoxin, thioredoxin-fold, ROS PR; 1.74A {Yersinia pseudotuberculosis} PDB: 2xpe_A 2xpd_A 3zre_A 2yjh_A 4af2_A 3hvs_A* 1qxh_A* 3i43_A* 3hvv_A 3hvx_A Back     alignment and structure
>2lqo_A Putative glutaredoxin RV3198.1/MT3292; TRX fold, oxidoreductase; NMR {Mycobacterium tuberculosis} Back     alignment and structure
>1kqp_A NAD+ synthase, NH(3)-dependent NAD(+) synthetase, SPOR; ligase, amidotransferase, ATP pyrophosphatase, NAD-adenylate; HET: ADJ; 1.03A {Bacillus subtilis} SCOP: c.26.2.1 PDB: 1fyd_A* 1ifx_A* 1ee1_A* 1ih8_A* 1nsy_A* 2nsy_A* 2pzb_A 2pza_A* 2pz8_A Back     alignment and structure
>2cq9_A GLRX2 protein, glutaredoxin 2; glutathione-S-transferase, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>2yan_A Glutaredoxin-3; oxidoreductase; HET: GSH; 1.90A {Homo sapiens} Back     alignment and structure
>3c1r_A Glutaredoxin-1; oxidized form, oxidoreductase, cytoplasm, electron transport, redox-active center, transport; HET: MES; 2.00A {Saccharomyces cerevisiae} PDB: 3c1s_A* 2jac_A* Back     alignment and structure
>3ic4_A Glutaredoxin (GRX-1); structural genomics, PSI, MCSG, protein structure initiative, midwest center for structural genomic oxidoreductase; 1.70A {Archaeoglobus fulgidus} Back     alignment and structure
>2ht9_A Glutaredoxin-2; thioredoxin fold, iron-sulfur cluster, 2Fe2S, structural genomics, structural genomics consortium, SGC, oxidoreductase; HET: GSH; 1.90A {Homo sapiens} PDB: 2fls_A* Back     alignment and structure
>3qmx_A Glutaredoxin A, glutaredoxin 3; electron transport; 1.82A {Synechocystis SP} SCOP: c.47.1.0 Back     alignment and structure
>1xcc_A 1-Cys peroxiredoxin; unknown function, structural genomics, structural genomics consortium, SGC; 2.30A {Plasmodium yoelii} SCOP: c.47.1.10 PDB: 3tb2_A Back     alignment and structure
>4hde_A SCO1/SENC family lipoprotein; structural genomics, the center for structural genomics of I diseases, csgid, niaid; HET: MSE; 1.32A {Bacillus anthracis} Back     alignment and structure
>2rem_A Disulfide oxidoreductase; disulfide oxidoreductase, DSBA, thioredoxin fold, redox- active center; 1.90A {Xylella fastidiosa} Back     alignment and structure
>1z6m_A Conserved hypothetical protein; structural genomics, MCSG,, protein structure initiative, midwest center for structural genomics; HET: MSE; 1.30A {Enterococcus faecalis} SCOP: c.47.1.13 Back     alignment and structure
>3gv1_A Disulfide interchange protein; neisseria gonorrhoeae (strain 700825 / FA 1090), DSBC, structural genomics, unknown funct 2; 2.00A {Neisseria gonorrhoeae} Back     alignment and structure
>1wxi_A NH(3)-dependent NAD(+) synthetase; NADE, E.coli, ligase; HET: AMP; 1.70A {Escherichia coli} SCOP: c.26.2.1 PDB: 1wxf_A 1wxg_A* 1wxh_A* 1wxe_A* 3hmq_A* Back     alignment and structure
>2pwj_A Mitochondrial peroxiredoxin; alpha and beta protein, oxidoreductase; 2.80A {Pisum sativum} Back     alignment and structure
>4dvc_A Thiol:disulfide interchange protein DSBA; pilus assembly, oxidoreductase, thioredoxin fold, D disulfide bond, DSBB; HET: DMS; 1.20A {Vibrio cholerae} PDB: 2ijy_A 1bed_A Back     alignment and structure
>3nzn_A Glutaredoxin; structural genomics, PSI2, MCSG, protein structure initiativ midwest center for structural genomics, rossmann fold; 1.10A {Methanosarcina mazei} Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>1fov_A Glutaredoxin 3, GRX3; active site disulfide, CIS Pro 53, electron transport; NMR {Escherichia coli} SCOP: c.47.1.1 PDB: 3grx_A* Back     alignment and structure
>2r2j_A Thioredoxin domain-containing protein 4; CRFS motif, chaperone, endoplasmic reticulum, S response; 2.60A {Homo sapiens} Back     alignment and structure
>2khp_A Glutaredoxin; thioredoxin type domain, ssgcid, electron TRAN structural genomics, seattle structural genomics center for infectious disease; NMR {Brucella melitensis} Back     alignment and structure
>3rhb_A ATGRXC5, glutaredoxin-C5, chloroplastic; thioredoxin fold, thiol-disulfide oxidoreductase, glutaredox oxidoreductase; HET: GSH; 1.20A {Arabidopsis thaliana} PDB: 3rhc_A* 3fz9_A* 3fza_A* Back     alignment and structure
>3rjz_A N-type ATP pyrophosphatase superfamily; structural genomics, PSI-biology, northeast structural genom consortium, NESG, alpha-beta protein; 2.30A {Pyrococcus furiosus} SCOP: c.26.2.1 PDB: 3h7e_A 3rk0_A* 3rk1_A* 1ru8_A 2d13_A Back     alignment and structure
>1vbk_A Hypothetical protein PH1313; structural genomics, riken structural genomics/proteomics initiative, RSGI, NPPSFA; 1.90A {Pyrococcus horikoshii} SCOP: c.26.2.6 d.308.1.1 Back     alignment and structure
>3msz_A Glutaredoxin 1; alpha-beta sandwich, center for structural genomics of infec diseases, csgid, oxidoreductase; HET: GSH; 2.05A {Francisella tularensis subsp} PDB: 3lgc_A* Back     alignment and structure
>3hz8_A Thiol:disulfide interchange protein DSBA; thiol-oxidoreductase, disulfide bond; 1.45A {Neisseria meningitidis MC58} PDB: 3dvw_A 3a3t_A Back     alignment and structure
>3l9s_A Thiol:disulfide interchange protein; thioredoxin-fold, DSBA, thiol-disulfide oxidoreductase, DISU bond, redox-active center; 1.58A {Salmonella enterica subsp} SCOP: c.47.1.13 PDB: 1a23_A 1a24_A 1a2j_A 1a2l_A 1a2m_A 1dsb_A 1fvk_A 3dks_A 1bq7_A 1fvj_A 1acv_A 1u3a_A* 1ti1_A* 2hi7_A* 2leg_A* 2zup_A* 3e9j_B* 1ac1_A 2b6m_A 2b3s_A Back     alignment and structure
>1wik_A Thioredoxin-like protein 2; picot homology 2 domain, picot protein, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: c.47.1.1 Back     alignment and structure
>3ctg_A Glutaredoxin-2; reduced form, electron transport, mitochondrion, redox-activ transit peptide, transport, oxidoreductase; 1.50A {Saccharomyces cerevisiae} PDB: 3ctf_A 3d4m_A 3d5j_A* Back     alignment and structure
>3h8q_A Thioredoxin reductase 3; oxidoreductase, structural genomics, structural genomics CON SGC, developmental protein, differentiation; 2.21A {Homo sapiens} SCOP: c.47.1.0 Back     alignment and structure
>3sdb_A Glutamine-dependent NAD(+) synthetase; glutamine-amidotransferase, glutaminase, glutamine-dependent synthetase, ligase; 2.00A {Mycobacterium tuberculosis} PDB: 3seq_A* 3sez_A* 3szg_A* 3dla_A* 3syt_A* Back     alignment and structure
>2h8l_A Protein disulfide-isomerase A3; thioredoxin-like fold; 2.00A {Homo sapiens} Back     alignment and structure
>3keb_A Probable thiol peroxidase; structural genomics, APC40679, PSI-2, Pro structure initiative; HET: MSE; 1.80A {Chromobacterium violaceum} Back     alignment and structure
>3sbc_A Peroxiredoxin TSA1; alpha-beta fold, peroxidase, cytosol, oxidoreductase; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>3ilv_A Glutamine-dependent NAD(+) synthetase; protein structure initiative II(PSI II), NYSGXRC, structural genomics; 1.79A {Cytophaga hutchinsonii atcc 33406} Back     alignment and structure
>3ed3_A Protein disulfide-isomerase MPD1; thioredoxin-like domain, CXXC, endoplasmic reticulum, glycoprotein, redox-active center; 2.00A {Saccharomyces cerevisiae} Back     alignment and structure
>3ec3_A Protein disulfide-isomerase A4; thioredoxin-like fold, endoplasmic reticulum, glycoprotein, redox-active center; 1.92A {Rattus norvegicus} Back     alignment and structure
>3l9v_A Putative thiol-disulfide isomerase or thioredoxin; thioredoxin-fold, SRGA, thiol-disulfide oxidoreductase, ISOM oxidoreductase; HET: PE8 P4C P6G; 2.15A {Salmonella enterica subsp} SCOP: c.47.1.0 Back     alignment and structure
>2wci_A Glutaredoxin-4; redox-active center, iron-sulfur cluster scaffolder, Fe2S2, homodimer, transport, glutathione, thioredoxin fold; HET: GSH; 1.90A {Escherichia coli} PDB: 1yka_A Back     alignment and structure
>3gha_A Disulfide bond formation protein D; BDBD, DSBA-like, TRX-like, oxidoreductase, competence, redox-active center; 1.40A {Bacillus subtilis} PDB: 3eu4_A 3gh9_A 3eu3_A Back     alignment and structure
>4f82_A Thioredoxin reductase; structural genomics, niaid, national institute of allergy AN infectious diseases; 1.85A {Burkholderia cenocepacia} Back     alignment and structure
>3feu_A Putative lipoprotein; alpha-beta structure, structural genomics, PSI-2, protein ST initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Vibrio fischeri} SCOP: c.47.1.0 Back     alignment and structure
>3l4n_A Monothiol glutaredoxin-6; C-terminal domain of GRX6, oxidoreductase; HET: GSH; 1.50A {Saccharomyces cerevisiae} Back     alignment and structure
>4eo3_A Bacterioferritin comigratory protein/NADH dehydro; thioredoxin-fold, alpha-beta-aplha sandwich fold, antioxidan oxidoreductase, FMN binding; HET: FMN; 1.65A {Thermotoga maritima} Back     alignment and structure
>3f4s_A Alpha-DSBA1, putative uncharacterized protein; thioredoxin-fold, oxidoreductase; HET: PGE; 1.55A {Wolbachia pipientis} PDB: 3f4r_A* 3f4t_A* Back     alignment and structure
>3tue_A Tryparedoxin peroxidase; thioredoxin fold, peroxiredoxin, oxidoreductase; 3.00A {Leishmania major} PDB: 1e2y_A Back     alignment and structure
>3zyw_A Glutaredoxin-3; metal binding protein; 1.84A {Homo sapiens} Back     alignment and structure
>3ipz_A Monothiol glutaredoxin-S14, chloroplastic; electron transport, PL redox-active center, transit peptide, transport, oxidoreduc; 2.40A {Arabidopsis thaliana} PDB: 2lku_A Back     alignment and structure
>1nm3_A Protein HI0572; hybrid, peroxiredoxin, glutaredoxin, electron transport; 2.80A {Haemophilus influenzae} SCOP: c.47.1.1 c.47.1.10 Back     alignment and structure
>1jgt_A Beta-lactam synthetase; asparagine synthetase, clavulanic AC AMPCPP, CEA, carboxyethylarginine, hydrolase; HET: APC CMA; 1.95A {Streptomyces clavuligerus} SCOP: c.26.2.1 d.153.1.1 PDB: 1m1z_A 1mb9_A* 1mbz_A* 1mc1_A* Back     alignment and structure
>2axo_A Hypothetical protein ATU2684; alpha beta protein., structural genomics, PSI, protein struc initiative; 1.80A {Agrobacterium tumefaciens str} SCOP: c.47.1.19 Back     alignment and structure
>1ct9_A Asparagine synthetase B; amidotransferase, substrate channeling, asparagine biosynthesis, ligase; HET: AMP GLN; 2.00A {Escherichia coli} SCOP: c.26.2.1 d.153.1.1 Back     alignment and structure
>1aba_A Glutaredoxin; electron transport; HET: MES; 1.45A {Enterobacteria phage T4} SCOP: c.47.1.1 PDB: 1aaz_A 1de1_A 1de2_A Back     alignment and structure
>1q15_A CARA; CMPR, (2S,5S)-5-carboxymethylproline, B-LS, B-lactam synthetase, AS-B, class B asparagine synthetase, AMP-CPP; 2.30A {Pectobacterium carotovorum} SCOP: c.26.2.1 d.153.1.1 PDB: 1q19_A* Back     alignment and structure
>3q6o_A Sulfhydryl oxidase 1; protein disulfide isomerase, thioredoxin, thioredoxin fold, oxidoreductase, reductive methylation; HET: MLY; 2.05A {Homo sapiens} Back     alignment and structure
>4f4h_A Glutamine dependent NAD+ synthetase; structural genomics, seattle structural genomics center for infectious disease, ssgcid, ligase; 1.75A {Burkholderia thailandensis} Back     alignment and structure
>3gx8_A Monothiol glutaredoxin-5, mitochondrial; TRX fold, electron transport, mitochondrion, redox-active center, transit peptide, transport; 1.67A {Saccharomyces cerevisiae} Back     alignment and structure
>2ct6_A SH3 domain-binding glutamic acid-rich-like protein 2; SH3BGRL2,FASH3, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>1t1v_A SH3BGRL3, SH3 domain-binding glutamic acid-rich protein-LIK; glutaredoxin, thioredoxin fold, protein 3D-structure, X-RAY crystallography; 1.60A {Mus musculus} SCOP: c.47.1.14 PDB: 1j0f_A 1sj6_A Back     alignment and structure
>3c7m_A Thiol:disulfide interchange protein DSBA-like; redox protein, periplasm, redox-active center, oxidoreductase; HET: PGE; 1.55A {Escherichia coli} PDB: 3l9u_A Back     alignment and structure
>3t58_A Sulfhydryl oxidase 1; oxidoreductase; HET: FAD; 2.40A {Mus musculus} PDB: 3t59_A* Back     alignment and structure
>1xiy_A Peroxiredoxin, pfaop; alpha-aneurysm, thioredoxin fold, peroxiredoxin fold, oxidoreductase; 1.80A {Plasmodium falciparum} SCOP: c.47.1.10 Back     alignment and structure
>3kzq_A Putative uncharacterized protein VP2116; protein with unknown function, STRU genomics, PSI, MCSG, protein structure initiative; HET: PG6; 2.10A {Vibrio parahaemolyticus} Back     alignment and structure
>1t4y_A Adaptive-response sensory-kinase SASA; alpha/beta protein, thioredoxin fold, transferase; NMR {Synechococcus elongatus} SCOP: c.47.1.15 PDB: 1t4z_A Back     alignment and structure
>1u6t_A SH3 domain-binding glutamic acid-rich-like protein; SH3-binding, glutaredoxin, thioredoxin fold, crystallography, protein binding; HET: CIT; 1.90A {Homo sapiens} PDB: 1wry_A Back     alignment and structure
>2wul_A Glutaredoxin related protein 5; chromosome 14 open reading frame 87, oxidoreductase, thiored family, GLRX5, FLB4739; HET: GSH; 2.40A {Homo sapiens} Back     alignment and structure
>3gn3_A Putative protein-disulfide isomerase; MCSG, PSI, structural GEN protein structure initiative, midwest center for structural genomics; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
>2kok_A Arsenate reductase; brucellosis, zoonotic, oxidoreductase, S genomics, seattle structural genomics center for infectious ssgcid; NMR {Brucella abortus} Back     alignment and structure
>3bci_A Disulfide bond protein A; thiol-disulfide oxidoreductase, redox protein, protein folding, redox active centre; 1.81A {Staphylococcus aureus} PDB: 3bd2_A 3bck_A Back     alignment and structure
>2xhf_A Peroxiredoxin 5; oxidoreductase, antioxidant enzymes; 1.30A {Alvinella pompejana} Back     alignment and structure
>2jad_A Yellow fluorescent protein glutaredoxin fusion protein; electron transport, redox- active center, yeast, GRX1P, transport; HET: PIA; 2.7A {Aequorea victoria} Back     alignment and structure
>2in3_A Hypothetical protein; DSBA family, FRNE-like subfamily, disulfide isomerase, struc genomics, PSI-2, protein structure initiative; 1.85A {Nitrosomonas europaea} Back     alignment and structure
>3gmf_A Protein-disulfide isomerase; oxidoreductase, PSI-2, NYSGXRC, structu genomics, protein structure initiative; 1.76A {Novosphingobium aromaticivorans} Back     alignment and structure
>3tdg_A DSBG, putative uncharacterized protein; thioredoxin fold, reductase, oxidoreductase; HET: P6G; 2.10A {Helicobacter pylori} Back     alignment and structure
>2x8g_A Thioredoxin glutathione reductase; redox-active center, detoxification pathway, oxidoreductase, flavoprotein; HET: FAD PG4; 1.90A {Schistosoma mansoni} PDB: 2x8c_A* 2x8h_A* 2x99_A* 3h4k_A* 2v6o_A* Back     alignment and structure
>2g2q_A Glutaredoxin-2; thioredoxin-fold, oxidoreductase, poxvirus; 2.50A {Vaccinia virus} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 430
d1sura_215 c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) redu 2e-47
d1zuna1211 c.26.2.2 (A:1-211) Sulfate adenylyltransferase sub 6e-28
d2c0ga2122 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal doma 6e-13
d1a8ya1124 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctola 2e-10
d1g7ea_122 c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, 1e-08
d2hfda1132 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein H 1e-08
d2djja1116 c.47.1.2 (A:6-121) Protein disulfide isomerase, PD 2e-08
d1meka_120 c.47.1.2 (A:) Protein disulfide isomerase, PDI {Hu 3e-08
d2es7a1119 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein H 1e-07
d2trxa_108 c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId 8e-07
d1thxa_108 c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 1e-06
d2b5ea1140 c.47.1.2 (A:365-504) Protein disulfide isomerase, 9e-06
d1nw2a_105 c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidoc 5e-05
d1sena_135 c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 1e-04
d1zmaa1115 c.47.1.1 (A:1-115) Bacterocin transport accessory 1e-04
d1nhoa_85 c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-lik 1e-04
d1ti3a_113 c.47.1.1 (A:) Thioredoxin {European aspen (Populus 1e-04
d1dbya_107 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 0.001
d1ep7a_112 c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardt 0.001
d2b5ea4119 c.47.1.2 (A:23-141) Protein disulfide isomerase, P 0.001
d1f9ma_112 c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia olera 0.002
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Length = 215 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PAPS reductase-like
domain: Phosphoadenylyl sulphate (PAPS) reductase
species: Escherichia coli [TaxId: 562]
 Score =  159 bits (404), Expect = 2e-47
 Identities = 47/204 (23%), Positives = 83/204 (40%), Gaps = 14/204 (6%)

Query: 50  EKLARGMESASPLEIMDKAFQKFGNDIAIAFS-GAEDVVLIEYAKLTGRPFRVFSLDTGR 108
            +    +E       +  A      +  ++ S G +  V +           V   DTG 
Sbjct: 21  AETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGY 80

Query: 109 LNPETHQFFDTVEKHYGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLK 168
           L PET++F D +     + ++             R   L+    +G ++   I KV P+ 
Sbjct: 81  LFPETYRFIDELTDKLKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMN 140

Query: 169 RALKGLRA--WITGQRKDQSPGTRAEIPVVQIDTSFEGIDGGKGSLVKWNPLANVKGQDI 226
           RALK L A  W  G R++QS  +RA +PV+ I             + K  P+ +   + I
Sbjct: 141 RALKELNAQTWFAGLRREQSG-SRANLPVLAIQ----------RGVFKVLPIIDWDNRTI 189

Query: 227 WNFLRAMNIPINSLHSQGYISIGC 250
           + +L+   +  + L  +GY+S+G 
Sbjct: 190 YQYLQKHGLKYHPLWDEGYLSVGD 213


>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Length = 211 Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Length = 122 Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Length = 124 Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Length = 122 Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Length = 132 Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Length = 116 Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Length = 120 Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Length = 119 Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Length = 108 Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Length = 108 Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 140 Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Length = 105 Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Length = 135 Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Length = 115 Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Length = 85 Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Length = 113 Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 107 Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Length = 112 Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 119 Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Length = 112 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query430
d1sura_215 Phosphoadenylyl sulphate (PAPS) reductase {Escheri 100.0
d1zuna1211 Sulfate adenylyltransferase subunit 2, CysD {Pseud 99.94
d2b5ea4119 Protein disulfide isomerase, PDI {Baker's yeast (S 99.88
d1nw2a_105 Thioredoxin {Alicyclobacillus acidocaldarius, form 99.88
d1thxa_108 Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} 99.87
d2trxa_108 Thioredoxin {Escherichia coli [TaxId: 562]} 99.87
d1fb6a_104 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.87
d1dbya_107 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.86
d1f9ma_112 Thioredoxin {Spinach (Spinacia oleracea), thioredo 99.84
d1a8ya1124 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 99.83
d1meka_120 Protein disulfide isomerase, PDI {Human (Homo sapi 99.83
d1ep7a_112 Thioredoxin {Chlamydomonas reinhardtii [TaxId: 305 99.83
d2ifqa1105 Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} 99.82
d1xwaa_111 Thioredoxin {Fruit fly (Drosophila melanogaster) [ 99.81
d1r26a_113 Thioredoxin {Trypanosoma brucei [TaxId: 5691]} 99.81
d1xfla_114 Thioredoxin {Thale cress (Arabidopsis thaliana) [T 99.81
d1gh2a_107 Thioredoxin-like protein, N-terminal domain {Human 99.81
d1syra_103 Thioredoxin {Malarial parasite (Plasmodium falcipa 99.81
d2b5ea1140 Protein disulfide isomerase, PDI {Baker's yeast (S 99.8
d1ti3a_113 Thioredoxin {European aspen (Populus tremula), thi 99.8
d2c0ga2122 Windbeutel, N-terminal domain {Fruit fly (Drosophi 99.78
d1qgva_137 spliceosomal protein U5-15Kd {Human (Homo sapiens) 99.78
d2djja1116 Protein disulfide isomerase, PDI {Fungi (Humicola 99.78
d1a8la2107 Protein disulfide isomerase, PDI {Archaeon Pyrococ 99.74
d2es7a1119 Hydrogenase-1 operon protein HyaE {Salmonella typh 99.73
d2hfda1132 Hydrogenase-1 operon protein HyaE {Escherichia col 99.73
d1fo5a_85 MJ0307, thioredoxin/glutaredoxin-like protein {Arc 99.69
d1woua_119 Putative 42-9-9 protein (thioredoxin containing pr 99.69
d1zmaa1115 Bacterocin transport accessory protein Bta {Strept 99.67
d1g7ea_122 Endoplasmic reticulum protein ERP29, N-terminal do 99.66
d1nhoa_85 MTH807, thioredoxin/glutaredoxin-like protein {Arc 99.64
d1hyua496 Alkyl hydroperoxide reductase subunit F (AhpF), N- 99.62
d2fwha1117 Thiol:disulfide interchange protein DsbD, C-termin 99.61
d2trcp_217 Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} 99.46
d1wy5a1216 TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId 99.33
d2fy6a1143 Peptide methionine sulfoxide reductase MsrA/MsrB, 99.32
d1zzoa1134 Lipoprotein DsbF {Mycobacterium tuberculosis [TaxI 99.3
d1lu4a_134 Soluble secreted antigen MPT53 {Mycobacterium tube 99.29
d1z5ye1136 Thioredoxin-like protein CcmG (CycY, DsbE) {Escher 99.28
d2b5xa1143 thiol:disulfide oxidoreductase YkuV {Bacillus subt 99.25
d2dlxa1147 UBX domain-containing protein 7 {Human (Homo sapie 99.21
d1i5ga_144 Tryparedoxin II {Crithidia fasciculata [TaxId: 565 99.21
d1st9a_137 Thiol-disulfide oxidoreductase ResA {Bacillus subt 99.19
d1ni5a1227 tRNA-Ile-lysidine synthetase, TilS, N-terminal dom 99.17
d1sena_135 Thioredoxin-like protein p19, TLP19 {Human (Homo s 99.16
d1knga_144 Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyr 99.16
d1o73a_144 Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 99.13
d1wjka_100 Thioredoxin-like structure containing protein C330 99.11
d2c5sa1218 Thiamine biosynthesis protein ThiI, C-terminal dom 99.08
d1o8xa_144 Tryparedoxin I {Crithidia fasciculata [TaxId: 5656 99.02
d2cvba1187 Probable thiol-disulfide isomerase/thioredoxin TTH 99.01
d1jfua_176 Membrane-anchored thioredoxin-like protein TlpA, s 98.87
d1k92a1188 Argininosuccinate synthetase, N-terminal domain {E 98.77
d1vl2a1168 Argininosuccinate synthetase, N-terminal domain {T 98.7
d1z6na1166 Hypothetical protein PA1234 {Pseudomonas aeruginos 98.69
d1j20a1165 Argininosuccinate synthetase, N-terminal domain {T 98.5
d1xnga1255 NH3-dependent NAD+-synthetase {Helicobacter pylori 98.49
d1gpma1197 GMP synthetase, central domain {Escherichia coli [ 98.37
d2cx4a1160 Bacterioferritin comigratory protein {Archaeon Aer 98.23
d2bmxa1169 Alkyl hydroperoxide reductase AhpC {Mycobacterium 98.2
d2djka1133 Protein disulfide isomerase, PDI {Fungi (Humicola 98.18
d2a4va1156 Peroxiredoxin dot5 {Baker's yeast (Saccharomyces c 98.04
d1e2ya_167 Tryparedoxin peroxidase (thioredoxin peroxidase ho 98.03
d2pg3a1230 Queuosine biosynthesis protein QueC {Erwinia carot 97.98
d1uula_194 Tryparedoxin peroxidase (thioredoxin peroxidase ho 97.92
d2b5ea3125 Protein disulfide isomerase, PDI {Baker's yeast (S 97.89
d2zcta1237 Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} 97.87
d1we0a1166 Alkyl hydroperoxide reductase AhpC {Amphibacillus 97.82
d1eeja1156 Disulfide bond isomerase, DsbC, C-terminal domain 97.79
d1t3ba1150 Disulfide bond isomerase, DsbC, C-terminal domain 97.69
d1a8la1119 Protein disulfide isomerase, PDI {Archaeon Pyrococ 97.65
d1xvwa1153 Putative peroxiredoxin Rv2238c/MT2298 {Mycobacteri 97.65
d2f8aa1184 Glutathione peroxidase {Human (Homo sapiens) [TaxI 97.61
d1zofa1170 Thioredoxin reductase TsaA {Helicobacter pylori [T 97.6
d1zyea1158 Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [ 97.57
d1beda_181 Disulfide-bond formation facilitator (DsbA) {Vibri 97.56
d1ttza_75 Hypothetical protein XCC2852 {Xanthomonas campestr 97.48
d1v58a1169 Thiol:disulfide interchange protein DsbG, C-termin 97.48
d1z6ma1172 Hypothetical protein EF0770 {Enterococcus faecalis 97.47
d1n8ja_186 Alkyl hydroperoxide reductase AhpC {Salmonella typ 97.31
d2h01a1170 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 97.29
d1iloa_77 MTH985, a thioredoxin {Archaeon Methanobacterium t 97.27
d1r7ha_74 Glutaredoxin-like NRDH-redoxin {Corynebacterium am 97.26
d1prxa_220 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 97.16
d1kqpa_271 NH3-dependent NAD+-synthetase {Bacillus subtilis [ 97.08
d1qmva_197 Thioredoxin peroxidase 2 (thioredoxin peroxidase B 97.05
d1qxha_164 Thiol peroxidase Tpx {Escherichia coli [TaxId: 562 97.01
d1xzoa1172 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.99
d1h75a_76 Glutaredoxin-like NRDH-redoxin {Escherichia coli [ 96.96
d1wp0a1160 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 96.93
d1psqa_163 Probable thiol peroxidase PsaD {Streptococcus pneu 96.88
d1a8ya2102 Calsequestrin {Rabbit (Oryctolagus cuniculus) [Tax 96.88
d1bjxa_110 Protein disulfide isomerase, PDI {Human (Homo sapi 96.8
d1egoa_85 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.69
d1fvka_188 Disulfide-bond formation facilitator (DsbA) {Esche 96.64
d2d13a1226 Hypothetical protein PH1257 {Archaeon Pyrococcus h 96.59
d1fova_82 Glutaredoxin (Grx, thioltransferase) {Escherichia 96.44
d1nm3a174 C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus 96.34
d1wxia1274 NH3-dependent NAD+-synthetase {Escherichia coli [T 96.3
d1ktea_105 Glutaredoxin (Grx, thioltransferase) {Pig (Sus scr 96.1
d1xcca_219 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [Tax 95.98
d1vbka1132 Hypothetical protein PH1313, C-terminal domain {Ar 95.97
d1q15a1296 beta-Lactam synthetase {Pectobacterium carotovorum 95.63
d1xvqa_166 Thiol peroxidase Tpx {Mycobacterium tuberculosis [ 95.39
d1q98a_164 Thiol peroxidase Tpx {Haemophilus influenzae [TaxI 95.18
d1jgta1299 beta-Lactam synthetase {Streptomyces clavuligerus 95.17
d2b7ka1169 Thioredoxin-like protein Sco1 (YpmQ), soluble doma 94.73
d1wika_109 Thioredoxin-like protein 2 {Mouse (Mus musculus) [ 94.36
d1ct9a1324 Asparagine synthetase B, C-terminal domain {Escher 94.01
d1t4za_105 Adaptive-response sensory-kinase SasA, N-terminal 89.03
d1un2a_195 Disulfide-bond formation facilitator (DsbA) {Esche 87.46
d1hyua3102 Alkyl hydroperoxide reductase subunit F (AhpF), N- 86.41
d2axoa1 225 Hypothetical protein Atu2684 {Agrobacterium tumefa 82.1
>d1sura_ c.26.2.2 (A:) Phosphoadenylyl sulphate (PAPS) reductase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: Adenine nucleotide alpha hydrolase-like
superfamily: Adenine nucleotide alpha hydrolases-like
family: PAPS reductase-like
domain: Phosphoadenylyl sulphate (PAPS) reductase
species: Escherichia coli [TaxId: 562]
Probab=100.00  E-value=1.4e-49  Score=364.13  Aligned_cols=197  Identities=22%  Similarity=0.347  Sum_probs=173.5

Q ss_pred             ChhhHHHHHHhccCCCHHHHHHHHHHHcCCcEEEEechhHHHHHH-HHHHhcCCCcEEEEecCCCCCHHHHHHHHHHHHH
Q 042284           45 DHEDYEKLARGMESASPLEIMDKAFQKFGNDIAIAFSGAEDVVLI-EYAKLTGRPFRVFSLDTGRLNPETHQFFDTVEKH  123 (430)
Q Consensus        45 ~~~~~~~l~~~l~~~~~~~~i~~~~~~~~~~i~vs~SGGKDS~vl-~l~~~~~~~i~vi~~DTg~~fpet~~~~~~~~~~  123 (430)
                      ....+.++|++|+.++|+++|+|++++|+++++|++||||||+|| ||+.+++++++|+|+|||.+||||++|+++++++
T Consensus        16 ~~~~l~~~~~~l~~~~~~~~i~~~~~~~~~~v~vs~SgGkDS~vllhl~~~~~~~~~vvf~DTg~~fpeT~e~~~~~~~~   95 (215)
T d1sura_          16 RILALAETNAELEKLDAEGRVAWALDNLPGEYVLSSSFGIQAAVSLHLVNQIRPDIPVILTDTGYLFPETYRFIDELTDK   95 (215)
T ss_dssp             HHHHHHHHHHHHTTSCHHHHHHHHHHHCCSEEEEECCCCTTHHHHHHHHHHHSTTCEEEEEECSCBCHHHHHHHHHHHHH
T ss_pred             HHHHHHHHHHHHhCCCHHHHHHHHHHHCCCCEEEEecCChHHHHHHHHHHhcCCCccEEEEECCcCcHHHHHHHHHHHHh
Confidence            334477889999999999999999999998899999999999776 9999999999999999999999999999999999


Q ss_pred             hCCcEEEEccCchHHHHHHHhcCCCCCCccchhhhhhhhchHHHHHHHhcCc--eEEEeeeccCCcccccCCCeeeecCC
Q 042284          124 YGIRIEYTFPNAVEVQALVRTKGLFSFYEDGHQECCRIRKVRPLKRALKGLR--AWITGQRKDQSPGTRAEIPVVQIDTS  201 (430)
Q Consensus       124 ~gl~i~~~~p~~~~~~~~~~~~g~~~~~~~~~~~cc~~~K~~pl~~~~~~~~--~~i~G~R~~Es~~~R~~~~~~~~d~~  201 (430)
                      ||++++++.|............+.+..+....++||.++|+.|+++++++++  +|++|+|++||. .|+.++.++.+. 
T Consensus        96 ~~l~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~c~~~K~~P~~~~l~~~~~~~~i~G~Rr~Es~-~Ra~~~~~~~~~-  173 (215)
T d1sura_          96 LKLNLKVYRATESAAWQEARYGKLWEQGVEGIEKYNDINKVEPMNRALKELNAQTWFAGLRREQSG-SRANLPVLAIQR-  173 (215)
T ss_dssp             TTCEEEEEECSSCHHHHHHHHCCGGGSHHHHHHHHHHHHTHHHHHHHHHHTTEEEEECCCCTTSSS-TTTTCCSEEEET-
T ss_pred             cCceeeEEeccchHHHHHhhcCCcccCCcchhhhhhcchhccchhhhhhccCceehHHHHhhcchH-hHhcCCceeecC-
Confidence            9999999988766444433333333333345679999999999999999654  699999999997 999999988763 


Q ss_pred             CCcccCCCCCeEEEecccccchHHHHHHHHHcCCCCccccccCCcccCCcC
Q 042284          202 FEGIDGGKGSLVKWNPLANVKGQDIWNFLRAMNIPINSLHSQGYISIGCEP  252 (430)
Q Consensus       202 ~~~~~~~~~~~~~~~Pi~dWt~~dVw~yi~~~~lp~~pLY~~Gy~siGC~~  252 (430)
                               +.++++||++|+.+|||+||+++||||||||++||+||||||
T Consensus       174 ---------~~~kv~Pi~~Wt~~dVw~Yi~~~~lP~npLY~~Gy~siGC~h  215 (215)
T d1sura_         174 ---------GVFKVLPIIDWDNRTIYQYLQKHGLKYHPLWDEGYLSVGDTH  215 (215)
T ss_dssp             ---------TEEEECTTTTCCHHHHHHHHHHHTCCCCGGGGGTCSCCCBCC
T ss_pred             ---------CEEEEechHhCCHHHHHHHHHHcCCCCCchhhcCCCCCCccC
Confidence                     689999999999999999999999999999999999999997



>d1zuna1 c.26.2.2 (A:1-211) Sulfate adenylyltransferase subunit 2, CysD {Pseudomonas syringae pv. tomato [TaxId: 323]} Back     information, alignment and structure
>d2b5ea4 c.47.1.2 (A:23-141) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1nw2a_ c.47.1.1 (A:) Thioredoxin {Alicyclobacillus acidocaldarius, formerly Bacillus acidocaldarius [TaxId: 405212]} Back     information, alignment and structure
>d1thxa_ c.47.1.1 (A:) Thioredoxin {Anabaena sp., pcc 7120 [TaxId: 1167]} Back     information, alignment and structure
>d2trxa_ c.47.1.1 (A:) Thioredoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fb6a_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin M [TaxId: 3562]} Back     information, alignment and structure
>d1dbya_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d1f9ma_ c.47.1.1 (A:) Thioredoxin {Spinach (Spinacia oleracea), thioredoxin F [TaxId: 3562]} Back     information, alignment and structure
>d1a8ya1 c.47.1.3 (A:3-126) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1meka_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ep7a_ c.47.1.1 (A:) Thioredoxin {Chlamydomonas reinhardtii [TaxId: 3055]} Back     information, alignment and structure
>d2ifqa1 c.47.1.1 (A:1-105) Thioredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xwaa_ c.47.1.1 (A:) Thioredoxin {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1r26a_ c.47.1.1 (A:) Thioredoxin {Trypanosoma brucei [TaxId: 5691]} Back     information, alignment and structure
>d1xfla_ c.47.1.1 (A:) Thioredoxin {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1gh2a_ c.47.1.1 (A:) Thioredoxin-like protein, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1syra_ c.47.1.1 (A:) Thioredoxin {Malarial parasite (Plasmodium falciparum) [TaxId: 5833]} Back     information, alignment and structure
>d2b5ea1 c.47.1.2 (A:365-504) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1ti3a_ c.47.1.1 (A:) Thioredoxin {European aspen (Populus tremula), thioredoxin H [TaxId: 113636]} Back     information, alignment and structure
>d2c0ga2 c.47.1.7 (A:1024-1145) Windbeutel, N-terminal domain {Fruit fly (Drosophila melanogaster) [TaxId: 7227]} Back     information, alignment and structure
>d1qgva_ c.47.1.8 (A:) spliceosomal protein U5-15Kd {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2djja1 c.47.1.2 (A:6-121) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d1a8la2 c.47.1.2 (A:120-226) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2es7a1 c.47.1.20 (A:7-125) Hydrogenase-1 operon protein HyaE {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2hfda1 c.47.1.20 (A:1-132) Hydrogenase-1 operon protein HyaE {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fo5a_ c.47.1.1 (A:) MJ0307, thioredoxin/glutaredoxin-like protein {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1woua_ c.47.1.16 (A:) Putative 42-9-9 protein (thioredoxin containing protein Txnl5) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zmaa1 c.47.1.1 (A:1-115) Bacterocin transport accessory protein Bta {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1g7ea_ c.47.1.7 (A:) Endoplasmic reticulum protein ERP29, N-terminal domain {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1nhoa_ c.47.1.1 (A:) MTH807, thioredoxin/glutaredoxin-like protein {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1hyua4 c.47.1.2 (A:103-198) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2fwha1 c.47.1.1 (A:428-544) Thiol:disulfide interchange protein DsbD, C-terminal domain (DsbD-gamma) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2trcp_ c.47.1.6 (P:) Phosducin {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wy5a1 c.26.2.5 (A:1-216) TilS-like protein Aq_1887 {Aquifex aeolicus [TaxId: 63363]} Back     information, alignment and structure
>d2fy6a1 c.47.1.10 (A:33-175) Peptide methionine sulfoxide reductase MsrA/MsrB, N-terminal domain {Neisseria meningitidis serogroup A [TaxId: 65699]} Back     information, alignment and structure
>d1zzoa1 c.47.1.10 (A:45-178) Lipoprotein DsbF {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1lu4a_ c.47.1.10 (A:) Soluble secreted antigen MPT53 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1z5ye1 c.47.1.10 (E:49-184) Thioredoxin-like protein CcmG (CycY, DsbE) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b5xa1 c.47.1.10 (A:1-143) thiol:disulfide oxidoreductase YkuV {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2dlxa1 c.47.1.24 (A:1-147) UBX domain-containing protein 7 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i5ga_ c.47.1.10 (A:) Tryparedoxin II {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d1st9a_ c.47.1.10 (A:) Thiol-disulfide oxidoreductase ResA {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1ni5a1 c.26.2.5 (A:0-226) tRNA-Ile-lysidine synthetase, TilS, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1sena_ c.47.1.1 (A:) Thioredoxin-like protein p19, TLP19 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1knga_ c.47.1.10 (A:) Thioredoxin-like protein CcmG (CycY, DsbE) {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1o73a_ c.47.1.10 (A:) Tryparedoxin I {Trypanosoma brucei brucei [TaxId: 5702]} Back     information, alignment and structure
>d1wjka_ c.47.1.1 (A:) Thioredoxin-like structure containing protein C330018D20Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2c5sa1 c.26.2.6 (A:174-391) Thiamine biosynthesis protein ThiI, C-terminal domain {Bacillus anthracis [TaxId: 1392]} Back     information, alignment and structure
>d1o8xa_ c.47.1.10 (A:) Tryparedoxin I {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2cvba1 c.47.1.10 (A:2-188) Probable thiol-disulfide isomerase/thioredoxin TTHA0593 {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1jfua_ c.47.1.10 (A:) Membrane-anchored thioredoxin-like protein TlpA, soluble domain {Bradyrhizobium japonicum [TaxId: 375]} Back     information, alignment and structure
>d1k92a1 c.26.2.1 (A:1-188) Argininosuccinate synthetase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vl2a1 c.26.2.1 (A:2-169) Argininosuccinate synthetase, N-terminal domain {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1z6na1 c.47.1.1 (A:1-166) Hypothetical protein PA1234 {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1j20a1 c.26.2.1 (A:1-165) Argininosuccinate synthetase, N-terminal domain {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xnga1 c.26.2.1 (A:3-257) NH3-dependent NAD+-synthetase {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1gpma1 c.26.2.1 (A:208-404) GMP synthetase, central domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2cx4a1 c.47.1.10 (A:4-163) Bacterioferritin comigratory protein {Archaeon Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d2bmxa1 c.47.1.10 (A:2-170) Alkyl hydroperoxide reductase AhpC {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2djka1 c.47.1.2 (A:1-133) Protein disulfide isomerase, PDI {Fungi (Humicola insolens) [TaxId: 34413]} Back     information, alignment and structure
>d2a4va1 c.47.1.10 (A:59-214) Peroxiredoxin dot5 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1e2ya_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Crithidia fasciculata [TaxId: 5656]} Back     information, alignment and structure
>d2pg3a1 c.26.2.1 (A:1-230) Queuosine biosynthesis protein QueC {Erwinia carotovora [TaxId: 554]} Back     information, alignment and structure
>d1uula_ c.47.1.10 (A:) Tryparedoxin peroxidase (thioredoxin peroxidase homologue) {Trypanosoma cruzi [TaxId: 5693]} Back     information, alignment and structure
>d2b5ea3 c.47.1.2 (A:240-364) Protein disulfide isomerase, PDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2zcta1 c.47.1.10 (A:6-242) Peroxiredoxin {Aeropyrum pernix [TaxId: 56636]} Back     information, alignment and structure
>d1we0a1 c.47.1.10 (A:1-166) Alkyl hydroperoxide reductase AhpC {Amphibacillus xylanus [TaxId: 1449]} Back     information, alignment and structure
>d1eeja1 c.47.1.9 (A:61-216) Disulfide bond isomerase, DsbC, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t3ba1 c.47.1.9 (A:61-210) Disulfide bond isomerase, DsbC, C-terminal domain {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1a8la1 c.47.1.2 (A:1-119) Protein disulfide isomerase, PDI {Archaeon Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d1xvwa1 c.47.1.10 (A:1-153) Putative peroxiredoxin Rv2238c/MT2298 {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d2f8aa1 c.47.1.10 (A:12-195) Glutathione peroxidase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zofa1 c.47.1.10 (A:1-170) Thioredoxin reductase TsaA {Helicobacter pylori [TaxId: 210]} Back     information, alignment and structure
>d1zyea1 c.47.1.10 (A:6-163) Peroxiredoxin-3 (AOP-1, SP-22) {Cow (Bos taurus) [TaxId: 9913]} Back     information, alignment and structure
>d1beda_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d1ttza_ c.47.1.1 (A:) Hypothetical protein XCC2852 {Xanthomonas campestris [TaxId: 339]} Back     information, alignment and structure
>d1v58a1 c.47.1.9 (A:62-230) Thiol:disulfide interchange protein DsbG, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1z6ma1 c.47.1.13 (A:1-172) Hypothetical protein EF0770 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1n8ja_ c.47.1.10 (A:) Alkyl hydroperoxide reductase AhpC {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2h01a1 c.47.1.10 (A:2-171) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Plasmodium yoelii [TaxId: 5861]} Back     information, alignment and structure
>d1iloa_ c.47.1.1 (A:) MTH985, a thioredoxin {Archaeon Methanobacterium thermoautotrophicum [TaxId: 145262]} Back     information, alignment and structure
>d1r7ha_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Corynebacterium ammoniagenes [TaxId: 1697]} Back     information, alignment and structure
>d1prxa_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1kqpa_ c.26.2.1 (A:) NH3-dependent NAD+-synthetase {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1qmva_ c.47.1.10 (A:) Thioredoxin peroxidase 2 (thioredoxin peroxidase B, 2-cys peroxiredoxin) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qxha_ c.47.1.10 (A:) Thiol peroxidase Tpx {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xzoa1 c.47.1.10 (A:3-174) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1h75a_ c.47.1.1 (A:) Glutaredoxin-like NRDH-redoxin {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wp0a1 c.47.1.10 (A:138-297) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1psqa_ c.47.1.10 (A:) Probable thiol peroxidase PsaD {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1a8ya2 c.47.1.3 (A:127-228) Calsequestrin {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1bjxa_ c.47.1.2 (A:) Protein disulfide isomerase, PDI {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1egoa_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1fvka_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2d13a1 c.26.2.1 (A:2-227) Hypothetical protein PH1257 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1fova_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Escherichia coli, Grx3 [TaxId: 562]} Back     information, alignment and structure
>d1nm3a1 c.47.1.1 (A:166-239) C-terminal, Grx domain of Hybrid-Prx5 {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1wxia1 c.26.2.1 (A:2-275) NH3-dependent NAD+-synthetase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1ktea_ c.47.1.1 (A:) Glutaredoxin (Grx, thioltransferase) {Pig (Sus scrofa) [TaxId: 9823]} Back     information, alignment and structure
>d1xcca_ c.47.1.10 (A:) 1-Cys peroxiredoxin {Plasmodium yoelii yoelii [TaxId: 73239]} Back     information, alignment and structure
>d1vbka1 c.26.2.6 (A:176-307) Hypothetical protein PH1313, C-terminal domain {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1q15a1 c.26.2.1 (A:206-501) beta-Lactam synthetase {Pectobacterium carotovorum [TaxId: 554]} Back     information, alignment and structure
>d1xvqa_ c.47.1.10 (A:) Thiol peroxidase Tpx {Mycobacterium tuberculosis [TaxId: 1773]} Back     information, alignment and structure
>d1q98a_ c.47.1.10 (A:) Thiol peroxidase Tpx {Haemophilus influenzae [TaxId: 727]} Back     information, alignment and structure
>d1jgta1 c.26.2.1 (A:210-508) beta-Lactam synthetase {Streptomyces clavuligerus [TaxId: 1901]} Back     information, alignment and structure
>d2b7ka1 c.47.1.10 (A:111-279) Thioredoxin-like protein Sco1 (YpmQ), soluble domain {Baker's yeast(Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wika_ c.47.1.1 (A:) Thioredoxin-like protein 2 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1ct9a1 c.26.2.1 (A:193-516) Asparagine synthetase B, C-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1t4za_ c.47.1.15 (A:) Adaptive-response sensory-kinase SasA, N-terminal domain {Synechococcus elongatus [TaxId: 32046]} Back     information, alignment and structure
>d1un2a_ c.47.1.13 (A:) Disulfide-bond formation facilitator (DsbA) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1hyua3 c.47.1.2 (A:1-102) Alkyl hydroperoxide reductase subunit F (AhpF), N-terminal domain {Salmonella typhimurium [TaxId: 90371]} Back     information, alignment and structure
>d2axoa1 c.47.1.19 (A:38-262) Hypothetical protein Atu2684 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure