Citrus Sinensis ID: 042288


Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------430-------440-------450-------460-------470-------480-------490-------500-------510-----
MAKPEELDYGDSFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRALAGNDGTVVEKPAKLAANKIMGC
cccccccccccccccccccccccccccccEEEEEcccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccHHHHHHHHHHHHHccccHHHHHHHHHHHccHHHHccccHHHHHHHHccccEEEEccccHHHHHHHHHHHccccEEEEEEEEEEcEEEEEEEEccccccHHHHHHHHHHHHcccccccEEEEccccccHHHHHHHcccccccccccccccccccccccEEEccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHcccHHHHHHHHHHHcEEEEEEcccccccccccccccEEEEEcccccccHHHHHHHccccccEEEEccccccccccccccccccccHHHHHHHHHHHHHcccccccccccccccccEEEccccccccccccEEEEEEccccccccccccccccHHHHHHHcccccEEEEEEcccccccccccccccHHHHHHHHHHHHHHHHccccccccHHHHHHHHcccccccccccccccccccccc
cccccccccccccccccccccccccccccEEEEEcccEEEccccccHHHHHHHHHHcHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHEEEHHccccHHHHHHHHHHHcHHHHHHHccHHHHHHHHHcccEEEEEccccEHHHHHHHHHHcccEEEccEEEEEccEEEEEEcccccEccHHHHHHHHHHHcccccccccccccccccHHHHHHHHHEEEcccccccccccHccccccEEEEcccEEccccHHHHHHHHHHHHHHHHHHHHHHHHHHHccHHHHHHHHHHcccEEEEEccccccccccccccEEEEEEcccccccHHHHHHHccccccEEEEEHHHHHHHHcccccEEccccHHHHHHHHHHHHHcccEEEccccccccccEEEEEcHHHHHHHccccEEEEEEEEccEcccccccccccccEEEEcccccEEEEEEcccccHHHcccccccHHHHHHHHHHHHHHHcccEcccccHHHHHHHHccccccEccccccccccccccc
makpeeldygdsfnfptidkcasigrekdtvvadvdgtllrgrssfpYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATfagmkvpsiESVARAvlpkfysgdlhpetwrvfsscgrrcvltanpRIMVEAFLKDFLGADMVIGTEICVykgrstgfvkspgvlvgkNKAGALMKMlgddeempdiglgdrktDSLFLNLCkesymvppnpkvdpvsqdklpkpivfhdgrlvqkptpFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYikgtppppaqkssgqtgvLFICShrtlldpiflstalgrpipavTYSLSRLSElispiktvrltrdrATDASMIEKLLEkgdlvicpegttcrepFLLRFSALFAELTDEVVPVAmsnrmsmfhgttargwkgmdpfyffmnpspayevTFLNKLPYeltcsagkssHDVANYIQRLIATSLSyectsftrkDKYRalagndgtvvekpAKLAANKIMGC
makpeeldygdsfnfpTIDKcasigrekdtvvADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGrstgfvkspgvlvgKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSrlselispiktvrltrdrATDASMIEKllekgdlvicpEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRalagndgtvvekpaklaankimgc
MAKPEELDYGDSFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVlrlllllllsplagflYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRALAGNDGTVVEKPAKLAANKIMGC
**********DSFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKML**********LG*RKTDSLFLNLCKESYMV***************KPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKG************TGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRALAGNDGTV***************
*************************REKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDR***************LVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNK**************DVANYIQRLIATSLSYECTSFTRKDKYRALAGN*******************
********YGDSFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPP*********TGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRALAGNDGTVVEKPAKLAANKIMGC
***********SFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPP*****GQTGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRALAGNDGTVV**************
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHiiiiiiHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
ooooooooooooooooooooooooooooooooooooooooooooooooooooooooooHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiHHHHHHHHHHHHHHHHHHHHHHHoooooHHHHHHHHHHHHHHHHHiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiii
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAKPEELDYGDSFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRALAGNDGTVVEKPAKLAANKIMGC
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query515 2.2.26 [Sep-21-2011]
O80437501 Glycerol-3-phosphate 2-O- yes no 0.951 0.978 0.541 1e-153
Q5XF03500 Probable glycerol-3-phosp no no 0.937 0.966 0.550 1e-145
Q9CAY3502 Glycerol-3-phosphate acyl no no 0.910 0.934 0.541 1e-144
Q9LMM0503 Glycerol-3-phosphate 2-O- no no 0.937 0.960 0.537 1e-143
Q9LHS7500 Glycerol-3-phosphate acyl no no 0.902 0.93 0.533 1e-139
Q9SHJ5585 Glycerol-3-phosphate acyl no no 0.904 0.796 0.460 1e-119
Q9FZ22530 Probable glycerol-3-phosp no no 0.914 0.888 0.401 1e-96
Q9SYJ2520 Probable glycerol-3-phosp no no 0.895 0.886 0.409 8e-95
P0CAV6222 Protein CicA OS=Caulobact yes no 0.388 0.900 0.290 0.0004
B8GX15222 Protein CicA OS=Caulobact yes no 0.388 0.900 0.290 0.0004
>sp|O80437|GPAT6_ARATH Glycerol-3-phosphate 2-O-acyltransferase 6 OS=Arabidopsis thaliana GN=GPAT6 PE=1 SV=1 Back     alignment and function desciption
 Score =  540 bits (1391), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 268/495 (54%), Positives = 357/495 (72%), Gaps = 5/495 (1%)

Query: 14  NFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAG 73
            F  I KC    R   TV AD+DGTLL  RS+FPY+ LVA E G +LR L+LL+  P   
Sbjct: 9   RFEQISKCDVKDRSNHTVAADLDGTLLISRSAFPYYFLVALEAGSLLRALILLVSVPFVY 68

Query: 74  FLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCV 133
             Y  +SE+  I V +F TFAG+K+  +E V R+VLP+FY+ D+ P+TWR+F++ G+R +
Sbjct: 69  LTYLTISETLAINVFVFITFAGLKIRDVELVVRSVLPRFYAEDVRPDTWRIFNTFGKRYI 128

Query: 134 LTANPRIMVEAFLKDFLGADMVIGTEICVYK-GRSTGFVKSPGVLVGKNKAGALMKMLGD 192
           +TA+PRIMVE F+K FLG D V+GTE+ V K GR+TGF + PG+LVG+ K   +++  G 
Sbjct: 129 ITASPRIMVEPFVKTFLGVDKVLGTELEVSKSGRATGFTRKPGILVGQYKRDVVLREFGG 188

Query: 193 -DEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTP 251
              ++PD+GLGD KTD  F+++CKE YMVP   K +P+ ++KL  PI+FH+GRLVQ+PTP
Sbjct: 189 LASDLPDLGLGDSKTDHDFMSICKEGYMVP-RTKCEPLPRNKLLSPIIFHEGRLVQRPTP 247

Query: 252 FMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQT 311
            +ALLT LW+PVGF+L+ +R+     LP  +  Y +   G+++ + G PPPP +      
Sbjct: 248 LVALLTFLWLPVGFVLSIIRVYTNIPLPERIARYNYKLTGIKLVVNGHPPPPPKPGQPGH 307

Query: 312 GVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEK 371
             L +C+HRT+LDP+  + ALGR I  VTYS+S+ SELISPIK V LTR R  DA+ I++
Sbjct: 308 --LLVCNHRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALTRQREKDAANIKR 365

Query: 372 LLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDP 431
           LLE+GDLVICPEGTTCREPFLLRFSALFAELTD +VPVA++ + SMF+GTT RG+K +DP
Sbjct: 366 LLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFNGTTTRGYKLLDP 425

Query: 432 FYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYR 491
           ++ FMNP P YE+TFL ++P ELTC  GKS  +VANYIQR++  +L +ECT+FTRKDKY 
Sbjct: 426 YFAFMNPRPTYEITFLKQIPAELTCKGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYA 485

Query: 492 ALAGNDGTVVEKPAK 506
            LAG DG V  K  K
Sbjct: 486 MLAGTDGRVPVKKEK 500




Esterifies acyl-group from acyl-ACP to the sn-1 position of glycerol-3-phosphate, an essential step in glycerolipid biosynthesis.
Arabidopsis thaliana (taxid: 3702)
EC: 2EC: .EC: 3EC: .EC: 1EC: .EC: 1EC: 5
>sp|Q5XF03|GPAT8_ARATH Probable glycerol-3-phosphate acyltransferase 8 OS=Arabidopsis thaliana GN=GPAT8 PE=2 SV=1 Back     alignment and function description
>sp|Q9CAY3|GPAT5_ARATH Glycerol-3-phosphate acyltransferase 5 OS=Arabidopsis thaliana GN=GPAT5 PE=1 SV=1 Back     alignment and function description
>sp|Q9LMM0|GPAT4_ARATH Glycerol-3-phosphate 2-O-acyltransferase 4 OS=Arabidopsis thaliana GN=GPAT4 PE=1 SV=1 Back     alignment and function description
>sp|Q9LHS7|GPAT7_ARATH Glycerol-3-phosphate acyltransferase 7 OS=Arabidopsis thaliana GN=GPAT7 PE=1 SV=1 Back     alignment and function description
>sp|Q9SHJ5|GPAT1_ARATH Glycerol-3-phosphate acyltransferase 1 OS=Arabidopsis thaliana GN=GPAT1 PE=1 SV=1 Back     alignment and function description
>sp|Q9FZ22|GPAT2_ARATH Probable glycerol-3-phosphate acyltransferase 2 OS=Arabidopsis thaliana GN=GPAT2 PE=2 SV=1 Back     alignment and function description
>sp|Q9SYJ2|GPAT3_ARATH Probable glycerol-3-phosphate acyltransferase 3 OS=Arabidopsis thaliana GN=GPAT3 PE=2 SV=1 Back     alignment and function description
>sp|P0CAV6|CICA_CAUCR Protein CicA OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=cicA PE=4 SV=1 Back     alignment and function description
>sp|B8GX15|CICA_CAUCN Protein CicA OS=Caulobacter crescentus (strain NA1000 / CB15N) GN=cicA PE=4 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
224138190501 predicted protein [Populus trichocarpa] 0.968 0.996 0.826 0.0
225452611510 PREDICTED: glycerol-3-phosphate acyltran 0.965 0.974 0.839 0.0
224091505501 predicted protein [Populus trichocarpa] 0.968 0.996 0.822 0.0
255558288504 ER glycerol-phosphate acyltransferase [R 0.968 0.990 0.812 0.0
388894442526 required for arbuscular mycorrhization 2 0.970 0.950 0.788 0.0
449459508511 PREDICTED: glycerol-3-phosphate 2-O-acyl 0.963 0.970 0.803 0.0
255552790512 ER glycerol-phosphate acyltransferase [R 0.990 0.996 0.781 0.0
357439161568 ER glycerol-phosphate acyltransferase [M 0.970 0.880 0.788 0.0
356577516512 PREDICTED: glycerol-3-phosphate acyltran 0.970 0.976 0.788 0.0
356533281509 PREDICTED: glycerol-3-phosphate acyltran 0.970 0.982 0.786 0.0
>gi|224138190|ref|XP_002322752.1| predicted protein [Populus trichocarpa] gi|222867382|gb|EEF04513.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
 Score =  868 bits (2243), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/502 (82%), Positives = 462/502 (92%), Gaps = 3/502 (0%)

Query: 14  NFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAG 73
           +FPT+DKCASIGREK TVVAD+DGTLLRGRSSFPYFAL+AFE GG+ RL+ LLL SPLAG
Sbjct: 3   SFPTVDKCASIGREKHTVVADMDGTLLRGRSSFPYFALLAFEAGGIFRLIFLLLASPLAG 62

Query: 74  FLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCV 133
            LYY+VSESAGI+VLIFAT AGMKV  IESVARAVLPKFYS DLH E+WRVFSSCG+RCV
Sbjct: 63  LLYYFVSESAGIKVLIFATCAGMKVSDIESVARAVLPKFYSSDLHSESWRVFSSCGKRCV 122

Query: 134 LTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKMLGDD 193
           LTANPRIMVEAFLKDFLGAD+V+GTE+  YKGR+TGFV+SPGVLVGKNKA AL K  G  
Sbjct: 123 LTANPRIMVEAFLKDFLGADLVLGTEMSTYKGRATGFVQSPGVLVGKNKADALKKAFGMT 182

Query: 194 EEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPFM 253
           +  P+IGLGDR TD+ F+ LCKE Y+VPP P+V+ V+ DKLPKP++FHDGRLVQKPTP  
Sbjct: 183 Q--PEIGLGDRHTDAPFMALCKEGYIVPPKPEVEAVTTDKLPKPVIFHDGRLVQKPTPLS 240

Query: 254 ALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTGV 313
           ALLTILWIP+GF+LACLR+AAG+LLPMP+VYYAFWALGVRV IKGTPPPPA+KS GQ+GV
Sbjct: 241 ALLTILWIPIGFILACLRIAAGSLLPMPMVYYAFWALGVRVIIKGTPPPPAKKSIGQSGV 300

Query: 314 LFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLL 373
           LFICSHRTLLDPIFLSTALGRPIPAVTYS+SRLSE+ISPIKTVRL+RDRATDASMI+KLL
Sbjct: 301 LFICSHRTLLDPIFLSTALGRPIPAVTYSVSRLSEIISPIKTVRLSRDRATDASMIKKLL 360

Query: 374 EKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPFY 433
           E+GDL ICPEGTTCREPFLLRFSALFAELTD++VPVA+ NRMSMFHGTTARGWKGMDPFY
Sbjct: 361 EEGDLAICPEGTTCREPFLLRFSALFAELTDQLVPVAVVNRMSMFHGTTARGWKGMDPFY 420

Query: 434 FFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRAL 493
           FFMNPSPAYEVTFLN+LP ELTC+ GKSSH+VANYIQR+IA +LSYECTSFTR+DKYRAL
Sbjct: 421 FFMNPSPAYEVTFLNRLPQELTCTGGKSSHEVANYIQRVIAATLSYECTSFTRRDKYRAL 480

Query: 494 AGNDGTVVEKPAKLAANKIMGC 515
           AGNDGTVVEK  KL ANK+MGC
Sbjct: 481 AGNDGTVVEK-TKLQANKVMGC 501




Source: Populus trichocarpa

Species: Populus trichocarpa

Genus: Populus

Family: Salicaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota

>gi|225452611|ref|XP_002276032.1| PREDICTED: glycerol-3-phosphate acyltransferase 6 [Vitis vinifera] Back     alignment and taxonomy information
>gi|224091505|ref|XP_002309276.1| predicted protein [Populus trichocarpa] gi|222855252|gb|EEE92799.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255558288|ref|XP_002520171.1| ER glycerol-phosphate acyltransferase [Ricinus communis] gi|223540663|gb|EEF42226.1| ER glycerol-phosphate acyltransferase [Ricinus communis] Back     alignment and taxonomy information
>gi|388894442|gb|AFK81970.1| required for arbuscular mycorrhization 2 [Medicago truncatula] gi|388894446|gb|AFK81972.1| required for arbuscular mycorrhization 2 [Medicago truncatula] Back     alignment and taxonomy information
>gi|449459508|ref|XP_004147488.1| PREDICTED: glycerol-3-phosphate 2-O-acyltransferase 6-like [Cucumis sativus] gi|449515732|ref|XP_004164902.1| PREDICTED: glycerol-3-phosphate 2-O-acyltransferase 6-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|255552790|ref|XP_002517438.1| ER glycerol-phosphate acyltransferase [Ricinus communis] gi|223543449|gb|EEF44980.1| ER glycerol-phosphate acyltransferase [Ricinus communis] Back     alignment and taxonomy information
>gi|357439161|ref|XP_003589857.1| ER glycerol-phosphate acyltransferase [Medicago truncatula] gi|355478905|gb|AES60108.1| ER glycerol-phosphate acyltransferase [Medicago truncatula] Back     alignment and taxonomy information
>gi|356577516|ref|XP_003556870.1| PREDICTED: glycerol-3-phosphate acyltransferase 6-like [Glycine max] Back     alignment and taxonomy information
>gi|356533281|ref|XP_003535194.1| PREDICTED: glycerol-3-phosphate acyltransferase 6-like [Glycine max] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query515
TAIR|locus:2042947501 GPAT6 "GLYCEROL-3-PHOSPHATE sn 0.949 0.976 0.536 1.2e-143
TAIR|locus:2126101500 GPAT8 "GLYCEROL-3-PHOSPHATE sn 0.937 0.966 0.538 4.7e-135
TAIR|locus:2025381503 GPAT4 "GLYCEROL-3-PHOSPHATE sn 0.937 0.960 0.531 3e-133
TAIR|locus:2080687502 GPAT5 "GLYCEROL-3-PHOSPHATE sn 0.908 0.932 0.536 2.5e-129
TAIR|locus:2152825500 GPAT7 "GLYCEROL-3-PHOSPHATE sn 0.900 0.928 0.522 1.9e-124
TAIR|locus:2009225585 GPAT1 "GLYCEROL-3-PHOSPHATE sn 0.904 0.796 0.441 7.2e-107
TAIR|locus:2204818530 GPAT2 "GLYCEROL-3-PHOSPHATE sn 0.904 0.879 0.400 1.7e-89
TAIR|locus:2141410520 GPAT3 "GLYCEROL-3-PHOSPHATE sn 0.899 0.890 0.398 3e-85
ZFIN|ZDB-GENE-030131-3375 423 aup1 "ancient ubiquitous prote 0.444 0.541 0.280 0.00037
TAIR|locus:2042947 GPAT6 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 6" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1404 (499.3 bits), Expect = 1.2e-143, P = 1.2e-143
 Identities = 265/494 (53%), Positives = 352/494 (71%)

Query:    15 FPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVXXXXXXXXXXXXXXX 74
             F  I KC    R   TV AD+DGTLL  RS+FPY+ LVA E G +               
Sbjct:    10 FEQISKCDVKDRSNHTVAADLDGTLLISRSAFPYYFLVALEAGSLLRALILLVSVPFVYL 69

Query:    75 XYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVL 134
              Y  +SE+  I V +F TFAG+K+  +E V R+VLP+FY+ D+ P+TWR+F++ G+R ++
Sbjct:    70 TYLTISETLAINVFVFITFAGLKIRDVELVVRSVLPRFYAEDVRPDTWRIFNTFGKRYII 129

Query:   135 TANPRIMVEAFLKDFLGADMVIGTEICVYK-GRSTGFVKSPGVLVGKNKAGALMKMLGD- 192
             TA+PRIMVE F+K FLG D V+GTE+ V K GR+TGF + PG+LVG+ K   +++  G  
Sbjct:   130 TASPRIMVEPFVKTFLGVDKVLGTELEVSKSGRATGFTRKPGILVGQYKRDVVLREFGGL 189

Query:   193 DEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQKPTPF 252
               ++PD+GLGD KTD  F+++CKE YMVP   K +P+ ++KL  PI+FH+GRLVQ+PTP 
Sbjct:   190 ASDLPDLGLGDSKTDHDFMSICKEGYMVP-RTKCEPLPRNKLLSPIIFHEGRLVQRPTPL 248

Query:   253 MALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTG 312
             +ALLT LW+PVGF+L+ +R+     LP  +  Y +   G+++ + G PPPP +   GQ G
Sbjct:   249 VALLTFLWLPVGFVLSIIRVYTNIPLPERIARYNYKLTGIKLVVNGHPPPPPKP--GQPG 306

Query:   313 VLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKL 372
              L +C+HRT+LDP+  + ALGR I  VTYS+S+ SELISPIK V LTR R  DA+ I++L
Sbjct:   307 HLLVCNHRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALTRQREKDAANIKRL 366

Query:   373 LEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKGMDPF 432
             LE+GDLVICPEGTTCREPFLLRFSALFAELTD +VPVA++ + SMF+GTT RG+K +DP+
Sbjct:   367 LEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFNGTTTRGYKLLDPY 426

Query:   433 YFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKDKYRA 492
             + FMNP P YE+TFL ++P ELTC  GKS  +VANYIQR++  +L +ECT+FTRKDKY  
Sbjct:   427 FAFMNPRPTYEITFLKQIPAELTCKGGKSPIEVANYIQRVLGGTLGFECTNFTRKDKYAM 486

Query:   493 LAGNDGTVVEKPAK 506
             LAG DG V  K  K
Sbjct:   487 LAGTDGRVPVKKEK 500




GO:0005739 "mitochondrion" evidence=ISM
GO:0008152 "metabolic process" evidence=IEA;ISS
GO:0016746 "transferase activity, transferring acyl groups" evidence=ISS
GO:0009908 "flower development" evidence=IMP
GO:0010143 "cutin biosynthetic process" evidence=IMP
GO:0016791 "phosphatase activity" evidence=IDA
GO:0006655 "phosphatidylglycerol biosynthetic process" evidence=RCA
GO:0090447 "glycerol-3-phosphate 2-O-acyltransferase activity" evidence=IDA
TAIR|locus:2126101 GPAT8 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2025381 GPAT4 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2080687 GPAT5 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 5" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2152825 GPAT7 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2009225 GPAT1 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 1" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2204818 GPAT2 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2141410 GPAT3 "GLYCEROL-3-PHOSPHATE sn-2-ACYLTRANSFERASE 3" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-030131-3375 aup1 "ancient ubiquitous protein 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
O80437GPAT6_ARATH2, ., 3, ., 1, ., 1, 50.54140.95140.9780yesno

EC Number Prediction by Ezypred Server ?

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer2.3.1.150.946
3rd Layer2.3.10.963

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Fail to connect to STRING server


Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
PLN02177497 PLN02177, PLN02177, glycerol-3-phosphate acyltrans 0.0
PLN02499498 PLN02499, PLN02499, glycerol-3-phosphate acyltrans 0.0
PLN02588525 PLN02588, PLN02588, glycerol-3-phosphate acyltrans 1e-124
cd06551187 cd06551, LPLAT, Lysophospholipid acyltransferases 6e-24
COG0560212 COG0560, SerB, Phosphoserine phosphatase [Amino ac 2e-13
cd07989184 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltr 4e-13
smart00563118 smart00563, PlsC, Phosphate acyltransferases 3e-12
pfam01553131 pfam01553, Acyltransferase, Acyltransferase 3e-10
TIGR01490202 TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfami 1e-09
COG0204255 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyl 5e-08
cd07991211 cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acylt 7e-08
TIGR01488177 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superf 0.004
>gnl|CDD|215118 PLN02177, PLN02177, glycerol-3-phosphate acyltransferase Back     alignment and domain information
 Score =  651 bits (1680), Expect = 0.0
 Identities = 295/498 (59%), Positives = 379/498 (76%), Gaps = 6/498 (1%)

Query: 10  GDSFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLS 69
           G S  F  I KC+S GR   TV AD+DGTLL  RS+FPY+ LVA E G +LR L+LLL  
Sbjct: 4   GASRRFEPISKCSSEGRSNQTVAADLDGTLLISRSAFPYYLLVALEAGSLLRALILLLSV 63

Query: 70  PLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCG 129
           P   F Y ++SES  I+  +F  FAG+K+  IE V+R+VLPKFY+ D+HPETWRVF+S G
Sbjct: 64  PFVYFTYLFISESLAIKTFVFIAFAGLKIRDIELVSRSVLPKFYAEDVHPETWRVFNSFG 123

Query: 130 RRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYK-GRSTGFVKSPGVLVGKNKAGALMK 188
           +R ++TA+PRIMVE F+K FLGAD V+GTE+ V K GR+TGF+K PGVLVG +K  A++K
Sbjct: 124 KRYIITASPRIMVEPFVKTFLGADKVLGTELEVSKSGRATGFMKKPGVLVGDHKRDAVLK 183

Query: 189 MLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLVQK 248
             GD   +PD+GLGDR+TD  F+++CKE YMVP   K +P+ ++KL  P++FH+GRLVQ+
Sbjct: 184 EFGDA--LPDLGLGDRETDHDFMSICKEGYMVP-RTKCEPLPRNKLLSPVIFHEGRLVQR 240

Query: 249 PTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSS 308
           PTP +ALLT LW+P+GF+L+ LR+     LP  +  Y +  LG+R+ +KG PPPP +K  
Sbjct: 241 PTPLVALLTFLWMPIGFILSLLRVYLNIPLPERIARYNYKLLGIRLIVKGNPPPPPKK-- 298

Query: 309 GQTGVLFICSHRTLLDPIFLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASM 368
           GQ GVLF+C+HRT+LDP+  + ALGR I  VTYS+S+ SELISPIK V L+R+R  DA+ 
Sbjct: 299 GQPGVLFVCNHRTVLDPVVTAVALGRKISCVTYSISKFSELISPIKAVALSREREKDAAN 358

Query: 369 IEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEVVPVAMSNRMSMFHGTTARGWKG 428
           I++LLE+GDLVICPEGTTCREPFLLRFSALFAELTD +VPVA++ + SMFHGTT RG+K 
Sbjct: 359 IKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRIVPVAINTKQSMFHGTTVRGYKL 418

Query: 429 MDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTRKD 488
           +DP++ FMNP P YE+TFLN+LP ELTC  GKS  +VANYIQR++A +L +ECT+ TRKD
Sbjct: 419 LDPYFVFMNPRPTYEITFLNQLPKELTCKGGKSPIEVANYIQRVLAGTLGFECTNLTRKD 478

Query: 489 KYRALAGNDGTVVEKPAK 506
           KY  LAG DG V  K  K
Sbjct: 479 KYAILAGTDGRVPSKKEK 496


Length = 497

>gnl|CDD|178115 PLN02499, PLN02499, glycerol-3-phosphate acyltransferase Back     alignment and domain information
>gnl|CDD|215320 PLN02588, PLN02588, glycerol-3-phosphate acyltransferase Back     alignment and domain information
>gnl|CDD|153244 cd06551, LPLAT, Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis Back     alignment and domain information
>gnl|CDD|223634 COG0560, SerB, Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>gnl|CDD|153251 cd07989, LPLAT_AGPAT-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like Back     alignment and domain information
>gnl|CDD|214724 smart00563, PlsC, Phosphate acyltransferases Back     alignment and domain information
>gnl|CDD|216567 pfam01553, Acyltransferase, Acyltransferase Back     alignment and domain information
>gnl|CDD|233436 TIGR01490, HAD-SF-IB-hyp1, HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>gnl|CDD|223282 COG0204, PlsC, 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] Back     alignment and domain information
>gnl|CDD|153253 cd07991, LPLAT_LPCAT1-like, Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like Back     alignment and domain information
>gnl|CDD|233435 TIGR01488, HAD-SF-IB, Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 515
PLN02177497 glycerol-3-phosphate acyltransferase 100.0
PLN02499498 glycerol-3-phosphate acyltransferase 100.0
PLN02588525 glycerol-3-phosphate acyltransferase 100.0
KOG2848276 consensus 1-acyl-sn-glycerol-3-phosphate acyltrans 100.0
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 100.0
cd07991211 LPLAT_LPCAT1-like Lysophospholipid Acyltransferase 100.0
PRK15018245 1-acyl-sn-glycerol-3-phosphate acyltransferase; Pr 100.0
PRK11590211 hypothetical protein; Provisional 99.97
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 99.97
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 99.97
PLN02833376 glycerol acyltransferase family protein 99.96
PLN02901214 1-acyl-sn-glycerol-3-phosphate acyltransferase 99.95
PTZ00261355 acyltransferase; Provisional 99.94
cd07992203 LPLAT_AAK14816-like Lysophospholipid Acyltransfera 99.93
cd07988163 LPLAT_ABO13168-like Lysophospholipid Acyltransfera 99.91
COG0204255 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferas 99.9
PRK08043 718 bifunctional acyl-[acyl carrier protein] synthetas 99.9
cd07986210 LPLAT_ACT14924-like Lysophospholipid Acyltransfera 99.9
PRK06814 1140 acylglycerophosphoethanolamine acyltransferase; Pr 99.89
PRK08633 1146 2-acyl-glycerophospho-ethanolamine acyltransferase 99.89
PLN02783315 diacylglycerol O-acyltransferase 99.88
cd07993205 LPLAT_DHAPAT-like Lysophospholipid Acyltransferase 99.86
cd07987212 LPLAT_MGAT-like Lysophospholipid Acyltransferases 99.86
PRK14014301 putative acyltransferase; Provisional 99.86
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 99.86
TIGR00530130 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltra 99.83
cd07985235 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLA 99.82
cd06551187 LPLAT Lysophospholipid acyltransferases (LPLATs) o 99.82
PRK11133322 serB phosphoserine phosphatase; Provisional 99.81
PRK03355 783 glycerol-3-phosphate acyltransferase; Validated 99.81
cd07983189 LPLAT_DUF374-like Lysophospholipid Acyltransferase 99.81
PF01553132 Acyltransferase: Acyltransferase; InterPro: IPR002 99.79
PRK08238479 hypothetical protein; Validated 99.79
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 99.79
TIGR03703 799 plsB glycerol-3-phosphate O-acyltransferase. Membe 99.76
PRK04974 818 glycerol-3-phosphate acyltransferase; Validated 99.76
cd07989184 LPLAT_AGPAT-like Lysophospholipid Acyltransferases 99.76
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 99.73
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 99.72
PLN02510374 probable 1-acyl-sn-glycerol-3-phosphate acyltransf 99.7
PF12710192 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P 99.68
cd07990193 LPLAT_LCLAT1-like Lysophospholipid Acyltransferase 99.67
PLN02380376 1-acyl-sn-glycerol-3-phosphate acyltransferase 99.64
PTZ00374 1108 dihydroxyacetone phosphate acyltransferase; Provis 99.64
smart00563118 PlsC Phosphate acyltransferases. Function in phosp 99.64
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 99.58
cd07984192 LPLAT_LABLAT-like Lysophospholipid Acyltransferase 99.56
PRK11915 621 glycerol-3-phosphate acyltransferase; Reviewed 99.54
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 99.5
PLN02954224 phosphoserine phosphatase 99.49
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 99.48
PRK13582205 thrH phosphoserine phosphatase; Provisional 99.39
KOG2847286 consensus Phosphate acyltransferase [Lipid transpo 99.23
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 99.22
KOG4666 412 consensus Predicted phosphate acyltransferase, con 99.09
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 98.9
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 98.87
KOG1505346 consensus Lysophosphatidic acid acyltransferase LP 98.77
KOG2898354 consensus Predicted phosphate acyltransferase, con 98.77
COG4359220 Uncharacterized conserved protein [Function unknow 98.74
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 98.74
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.71
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 98.7
PRK13222226 phosphoglycolate phosphatase; Provisional 98.68
PRK13223272 phosphoglycolate phosphatase; Provisional 98.55
COG2937 810 PlsB Glycerol-3-phosphate O-acyltransferase [Lipid 98.54
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 98.48
PRK12702302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 98.46
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 98.41
PRK13226229 phosphoglycolate phosphatase; Provisional 98.37
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 98.36
PRK13288214 pyrophosphatase PpaX; Provisional 98.36
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 98.35
PF00702215 Hydrolase: haloacid dehalogenase-like hydrolase; I 98.35
KOG3729 715 consensus Mitochondrial glycerol-3-phosphate acylt 98.33
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 98.33
PRK08419298 lipid A biosynthesis lauroyl acyltransferase; Revi 98.32
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.29
PRK13225273 phosphoglycolate phosphatase; Provisional 98.23
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 98.23
COG0546220 Gph Predicted phosphatases [General function predi 98.21
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 98.21
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.21
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 98.18
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 98.18
PLN02770248 haloacid dehalogenase-like hydrolase family protei 98.16
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 98.14
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 98.14
TIGR01497675 kdpB K+-transporting ATPase, B subunit. One sequen 98.14
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 98.1
PLN02349426 glycerol-3-phosphate acyltransferase 98.09
PLN02575381 haloacid dehalogenase-like hydrolase 98.08
PRK11587218 putative phosphatase; Provisional 98.07
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 98.04
KOG3730 685 consensus Acyl-CoA:dihydroxyactetone-phosphate acy 98.0
PRK14988224 GMP/IMP nucleotidase; Provisional 97.98
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 97.97
PHA02597197 30.2 hypothetical protein; Provisional 97.96
PRK10563221 6-phosphogluconate phosphatase; Provisional 97.96
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 97.94
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 97.93
PLN02940382 riboflavin kinase 97.87
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 97.78
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 97.77
COG2121214 Uncharacterized protein conserved in bacteria [Fun 97.77
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 97.75
PRK07920298 lipid A biosynthesis lauroyl acyltransferase; Prov 97.74
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 97.73
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 97.72
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 97.71
PLN02779286 haloacid dehalogenase-like hydrolase family protei 97.68
PRK10671834 copA copper exporting ATPase; Provisional 97.67
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.64
COG4030315 Uncharacterized protein conserved in archaea [Func 97.63
PRK09449224 dUMP phosphatase; Provisional 97.61
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 97.57
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 97.56
COG2217713 ZntA Cation transport ATPase [Inorganic ion transp 97.55
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 97.5
PRK01122679 potassium-transporting ATPase subunit B; Provision 97.5
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.47
TIGR01512536 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translo 97.45
COG1560308 HtrB Lauroyl/myristoyl acyltransferase [Cell envel 97.38
TIGR01525556 ATPase-IB_hvy heavy metal translocating P-type ATP 97.34
PRK14010673 potassium-transporting ATPase subunit B; Provision 97.32
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 97.29
PRK10748238 flavin mononucleotide phosphatase; Provisional 97.11
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 97.09
TIGR01524867 ATPase-IIIB_Mg magnesium-translocating P-type ATPa 97.08
PRK10976266 putative hydrolase; Provisional 97.03
COG0637221 Predicted phosphatase/phosphohexomutase [General f 97.01
PRK10513270 sugar phosphate phosphatase; Provisional 97.0
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 96.99
PF03279295 Lip_A_acyltrans: Bacterial lipid A biosynthesis ac 96.89
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 96.89
KOG0207951 consensus Cation transport ATPase [Inorganic ion t 96.86
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 96.83
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 96.8
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 96.79
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 96.78
PRK11033741 zntA zinc/cadmium/mercury/lead-transporting ATPase 96.78
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 96.74
COG1778170 Low specificity phosphatase (HAD superfamily) [Gen 96.68
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 96.62
TIGR01116917 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium 96.61
TIGR01522884 ATPase-IIA2_Ca golgi membrane calcium-translocatin 96.61
PRK15122903 magnesium-transporting ATPase; Provisional 96.58
PRK06628290 lipid A biosynthesis lauroyl acyltransferase; Prov 96.57
PRK10517902 magnesium-transporting ATPase MgtA; Provisional 96.56
PRK06553308 lipid A biosynthesis lauroyl acyltransferase; Prov 96.55
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.54
TIGR01647755 ATPase-IIIA_H plasma-membrane proton-efflux P-type 96.52
TIGR01517941 ATPase-IIB_Ca plasma-membrane calcium-translocatin 96.47
PLN02887580 hydrolase family protein 96.46
TIGR01663526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 96.41
TIGR015231053 ATPase-IID_K-Na potassium and/or sodium efflux P-t 96.4
PRK06946293 lipid A biosynthesis lauroyl acyltransferase; Prov 96.39
COG4087152 Soluble P-type ATPase [General function prediction 96.35
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 96.32
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 96.31
PRK01158230 phosphoglycolate phosphatase; Provisional 96.3
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 96.16
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 96.12
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 96.01
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 95.88
PRK06860309 lipid A biosynthesis lauroyl acyltransferase; Prov 95.85
COG2216681 KdpB High-affinity K+ transport system, ATPase cha 95.83
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 95.82
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 95.73
TIGR02207303 lipid_A_htrB lipid A biosynthesis lauroyl (or palm 95.71
TIGR01106997 ATPase-IIC_X-K sodium or proton efflux -- potassiu 95.65
TIGR01494499 ATPase_P-type ATPase, P-type (transporting), HAD s 95.63
PLN02382413 probable sucrose-phosphatase 95.59
PRK08943314 lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA ac 95.57
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 95.49
TIGR02208305 lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl) 95.48
COG3700237 AphA Acid phosphatase (class B) [General function 95.45
PRK08905289 lipid A biosynthesis lauroyl acyltransferase; Vali 95.37
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 95.3
COG0474917 MgtA Cation transport ATPase [Inorganic ion transp 95.16
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 95.14
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 95.09
PF03982297 DAGAT: Diacylglycerol acyltransferase ; InterPro: 95.08
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 95.03
PRK05646310 lipid A biosynthesis lauroyl acyltransferase; Prov 95.03
PTZ00174247 phosphomannomutase; Provisional 95.0
PRK08734305 lipid A biosynthesis lauroyl acyltransferase; Prov 94.92
PLN02811220 hydrolase 94.85
PRK08733306 lipid A biosynthesis lauroyl acyltransferase; Prov 94.62
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 94.44
PRK08706289 lipid A biosynthesis lauroyl acyltransferase; Prov 94.38
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 94.36
PRK05906454 lipid A biosynthesis lauroyl acyltransferase; Prov 94.26
PRK08025305 lipid A biosynthesis palmitoleoyl acyltransferase; 93.99
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 93.85
TIGR016571054 P-ATPase-V P-type ATPase of unknown pump specifici 93.62
PRK05645295 lipid A biosynthesis lauroyl acyltransferase; Prov 93.35
PRK15174656 Vi polysaccharide export protein VexE; Provisional 92.38
KOG0202972 consensus Ca2+ transporting ATPase [Inorganic ion 92.27
TIGR016521057 ATPase-Plipid phospholipid-translocating P-type AT 91.09
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 90.97
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 90.86
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 90.24
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 90.22
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 90.11
TIGR01675229 plant-AP plant acid phosphatase. This model explic 88.87
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 88.08
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 88.02
PLN031901178 aminophospholipid translocase; Provisional 87.46
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 87.19
PHA02530300 pseT polynucleotide kinase; Provisional 86.88
COG3176292 Putative hemolysin [General function prediction on 85.58
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 84.99
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 84.87
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 84.7
TIGR01684301 viral_ppase viral phosphatase. These proteins also 84.62
PRK05446354 imidazole glycerol-phosphate dehydratase/histidino 84.33
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 84.24
PLN02423245 phosphomannomutase 84.0
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 83.22
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 83.15
KOG4666412 consensus Predicted phosphate acyltransferase, con 82.94
PLN02423245 phosphomannomutase 81.91
TIGR02244343 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hyd 81.91
PRK01158230 phosphoglycolate phosphatase; Provisional 81.81
PTZ00174247 phosphomannomutase; Provisional 81.69
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 81.63
PRK06769173 hypothetical protein; Validated 81.19
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 80.87
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 80.63
KOG3128298 consensus Uncharacterized conserved protein [Funct 80.25
>PLN02177 glycerol-3-phosphate acyltransferase Back     alignment and domain information
Probab=100.00  E-value=7.6e-94  Score=757.64  Aligned_cols=492  Identities=59%  Similarity=1.063  Sum_probs=445.6

Q ss_pred             CCCCCCCCCccccccCCCCCeEEEEecCCccccCCCchHHHHHHHHHhccHHHHHHHHhhhHHHHHhcccCcccHHHHHH
Q 042288            9 YGDSFNFPTIDKCASIGREKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVL   88 (515)
Q Consensus         9 ~~~~~~~~~~~~~~~~~~~~~lavFD~DgTL~~~ds~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~   88 (515)
                      .|-|-.||+|++|+.+.++..+++|||||||++++|+|.+|++++.+.+++.+.+..+..+|.+...+....++..++.+
T Consensus         3 ~~~~~~~~~~~~~~~~~~~~~~~~FDfDGTLt~~~s~f~~Fll~A~~~~~~~r~lllll~~P~~~l~~~~~~~~~~~~~l   82 (497)
T PLN02177          3 MGASRRFEPISKCSSEGRSNQTVAADLDGTLLISRSAFPYYLLVALEAGSLLRALILLLSVPFVYFTYLFISESLAIKTF   82 (497)
T ss_pred             ccccCCCCccccCCcccccccEEEEecCCcccCCCCccHHHHHHHcccchHHHHHHHHHHhHHHHHHHhcCCchhHHHHH
Confidence            36788899999999999999999999999999999999999988887778888887777677776654334455557788


Q ss_pred             HHHHHcCCCHHHHHHHHHHHhchhhcCCCcHHHHHHHHhCCCEEEEecCcHHHHHHHHHhhcCCcEEEeceEEE-eCcee
Q 042288           89 IFATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSCGRRCVLTANPRIMVEAFLKDFLGADMVIGTEICV-YKGRS  167 (515)
Q Consensus        89 ~~~~~~G~~~~~l~~~~~~~~~~~~~~~~~~~~~~~l~~~G~~vivSaS~~~~v~~ia~~~lGid~vigt~l~~-~~G~~  167 (515)
                      +...|+|++++++++++++|+++++...++++++++++++|+++|||||++.+|+||++++||+|+|+||++++ .||++
T Consensus        83 ~~~~f~G~~~~el~~~~r~~l~~f~~~~l~~~a~~~~~~~g~~vvVSASp~~~Vepfa~~~LGid~VIgTeLev~~~G~~  162 (497)
T PLN02177         83 VFIAFAGLKIRDIELVSRSVLPKFYAEDVHPETWRVFNSFGKRYIITASPRIMVEPFVKTFLGADKVLGTELEVSKSGRA  162 (497)
T ss_pred             HHHHHcCCCHHHHHHHHHHHHHHHHHHhcCHHHHHHHHhCCCEEEEECCcHHHHHHHHHHcCCCCEEEecccEECcCCEE
Confidence            88899999999999999999999888889999999999999889999999999999998668999999999999 59999


Q ss_pred             eeEEecCC-ccccccHHHHHHHHhcCCCCCceEEEeCCcCcHHHHhccccceeeCCCCCCCcccccCCCCceEEccCccc
Q 042288          168 TGFVKSPG-VLVGKNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIVFHDGRLV  246 (515)
Q Consensus       168 tG~i~~~~-~~~g~~K~~~l~~~~~~~~~~~~~aygDS~~DlpmL~~a~~~~~Vnp~~~l~~~A~~~~~W~i~f~~~r~~  246 (515)
                      ||++.|+| | +|++|++++++.++.  ....+|||||.+|+|||++|+++++||+++ ++.+.+++.--|++|||||++
T Consensus       163 TG~i~g~~~c-~Ge~Kv~rl~~~~g~--~~~~~aYgDS~sD~plL~~a~e~y~V~~~~-~~~~~~~~~~~~~~fhdgrl~  238 (497)
T PLN02177        163 TGFMKKPGVL-VGDHKRDAVLKEFGD--ALPDLGLGDRETDHDFMSICKEGYMVPRTK-CEPLPRNKLLSPVIFHEGRLV  238 (497)
T ss_pred             eeeecCCCCC-ccHHHHHHHHHHhCC--CCceEEEECCccHHHHHHhCCccEEeCCCC-CCcCCcccCCCceeeeCCccc
Confidence            99999985 6 999999999988774  234599999999999999999999999966 999998667778999999999


Q ss_pred             CCcchhhHHHHhhhHHHHHHHHHHHHHhhccccHHHHHHHhHhcceEEEEcCCCCCCCCCCCCCCcEEEEeCCCCCCcHH
Q 042288          247 QKPTPFMALLTILWIPVGFLLACLRMAAGALLPMPLVYYAFWALGVRVYIKGTPPPPAQKSSGQTGVLFICSHRTLLDPI  326 (515)
Q Consensus       247 ~~p~~~~~l~~~l~~p~~l~~~~~r~~~~~~~~~~~~~~l~~~~Gvrv~v~G~e~~p~~~~~~~~~~IiVaNH~S~lD~~  326 (515)
                      ++|++.++|++++|+|+|++++++|+++++.+|.+|++.+++++|++++|+|.+|+|..  ..++|+|+||||+|++|++
T Consensus       239 ~~p~~~~~l~~~~~~p~g~~l~~~r~~~~~~lp~~~~~~~~~~~Gv~v~v~G~e~~p~~--~~~~~~l~v~NHqS~lD~~  316 (497)
T PLN02177        239 QRPTPLVALLTFLWMPIGFILSLLRVYLNIPLPERIARYNYKLLGIRLIVKGNPPPPPK--KGQPGVLFVCNHRTVLDPV  316 (497)
T ss_pred             CCCCHHHHHHHHHHHHHHHHHHHHHHHHhhhhHHHHHHHHHHHcCcEEEEEcCCCCCcc--cCCCCeEEEECCCCcchHH
Confidence            99999999999999999999999999999999999999999999999999999998721  0147999999999999999


Q ss_pred             HHHHhcCCCccEEEecccchhhhhhcCCeeEEecCChhhHHHHHHHHHcCCeEEecCCeeeCCCccccccchhhccCCcE
Q 042288          327 FLSTALGRPIPAVTYSLSRLSELISPIKTVRLTRDRATDASMIEKLLEKGDLVICPEGTTCREPFLLRFSALFAELTDEV  406 (515)
Q Consensus       327 ~l~~~~~~~~~~v~k~~~~~g~~~~~~~~i~idR~~~~~~~~~~~~l~~G~l~IFPEGTrs~~~~l~~Fk~Gf~~~~~pV  406 (515)
                      ++...+++++.++++++..++++++.++++++||++.++..++++.+++|+++|||||||++++.+++||+||+++.+||
T Consensus       317 ~l~~al~~~~~~v~~~~~~l~~~l~~i~~~~ldR~r~~~~~~~~~lL~~g~lvIFPEGTrs~~~~l~~Fk~~fa~l~~pI  396 (497)
T PLN02177        317 VTAVALGRKISCVTYSISKFSELISPIKAVALSREREKDAANIKRLLEEGDLVICPEGTTCREPFLLRFSALFAELTDRI  396 (497)
T ss_pred             HHHHHcCCCeEEEeehHHHHHHHHHhcCEEEEeCCChHHHHHHHHHHhcCCEEECcCcCCCCCCCcchHHHHHHHHCCcE
Confidence            99999998889999887778999999999999999877767788889999999999999999999999999998888999


Q ss_pred             EEEEEEcCccCccCcccCCCccCCccccccCCCCeEEEEEeccccCccccCCCCCHHHHHHHHHHHHHHHcCCCcCCCCH
Q 042288          407 VPVAMSNRMSMFHGTTARGWKGMDPFYFFMNPSPAYEVTFLNKLPYELTCSAGKSSHDVANYIQRLIATSLSYECTSFTR  486 (515)
Q Consensus       407 vPV~i~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~v~V~~l~pi~~~~~~~~~~~~~~la~~v~~~ia~~l~~~~t~~t~  486 (515)
                      |||+|.++..++.+++..+|+++|++|++++|.+.++|+||+|+++++.+..+++..|+|++||+.|++.|++++|.+|+
T Consensus       397 VPVAI~~~~~~f~~~t~~~~~~~d~~~~~~~p~~~y~V~fL~~l~~~~~~~~~~~~~evAn~Vq~~i~~~lg~~~t~~tr  476 (497)
T PLN02177        397 VPVAINTKQSMFHGTTVRGYKLLDPYFVFMNPRPTYEITFLNQLPKELTCKGGKSPIEVANYIQRVLAGTLGFECTNLTR  476 (497)
T ss_pred             EEEEEEcccccccccccccceecchhhhhcCCCceEEEEECCCCChhhcccCCCCHHHHHHHHHHHHHHhhCceeccccH
Confidence            99999998888898888999999999999999999999999999998654468999999999999999999999999999


Q ss_pred             HHHHHHHccCCCccccchhh
Q 042288          487 KDKYRALAGNDGTVVEKPAK  506 (515)
Q Consensus       487 ~d~~~~~~~~~~~~~~~~~~  506 (515)
                      +|||+.||||||+|..++-|
T Consensus       477 ~dk~~~l~gn~g~v~~~~~~  496 (497)
T PLN02177        477 KDKYAILAGTDGRVPSKKEK  496 (497)
T ss_pred             HHHHHHhcCCCccccCCCCC
Confidence            99999999999999877643



>PLN02499 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PLN02588 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>KOG2848 consensus 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>cd07991 LPLAT_LPCAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LPCAT1-like Back     alignment and domain information
>PRK15018 1-acyl-sn-glycerol-3-phosphate acyltransferase; Provisional Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PLN02833 glycerol acyltransferase family protein Back     alignment and domain information
>PLN02901 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PTZ00261 acyltransferase; Provisional Back     alignment and domain information
>cd07992 LPLAT_AAK14816-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown AAK14816-like Back     alignment and domain information
>cd07988 LPLAT_ABO13168-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ABO13168 Back     alignment and domain information
>COG0204 PlsC 1-acyl-sn-glycerol-3-phosphate acyltransferase [Lipid metabolism] Back     alignment and domain information
>PRK08043 bifunctional acyl-[acyl carrier protein] synthetase/2-acylglycerophosphoethanolamine acyltransferase; Validated Back     alignment and domain information
>cd07986 LPLAT_ACT14924-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: Unknown ACT14924 Back     alignment and domain information
>PRK06814 acylglycerophosphoethanolamine acyltransferase; Provisional Back     alignment and domain information
>PRK08633 2-acyl-glycerophospho-ethanolamine acyltransferase; Validated Back     alignment and domain information
>PLN02783 diacylglycerol O-acyltransferase Back     alignment and domain information
>cd07993 LPLAT_DHAPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT-like Back     alignment and domain information
>cd07987 LPLAT_MGAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: MGAT-like Back     alignment and domain information
>PRK14014 putative acyltransferase; Provisional Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR00530 AGP_acyltrn 1-acyl-sn-glycerol-3-phosphate acyltransferases Back     alignment and domain information
>cd07985 LPLAT_GPAT Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: GPAT Back     alignment and domain information
>cd06551 LPLAT Lysophospholipid acyltransferases (LPLATs) of glycerophospholipid biosynthesis Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK03355 glycerol-3-phosphate acyltransferase; Validated Back     alignment and domain information
>cd07983 LPLAT_DUF374-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: DUF374 Back     alignment and domain information
>PF01553 Acyltransferase: Acyltransferase; InterPro: IPR002123 This family contains acyltransferases involved in phospholipid biosynthesis and other proteins of unknown function [] Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>TIGR03703 plsB glycerol-3-phosphate O-acyltransferase Back     alignment and domain information
>PRK04974 glycerol-3-phosphate acyltransferase; Validated Back     alignment and domain information
>cd07989 LPLAT_AGPAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: AGPAT-like Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>PLN02510 probable 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PF12710 HAD: haloacid dehalogenase-like hydrolase; PDB: 3P96_A 3N28_A 3FVV_A 1RKU_A 1RKV_A 1Y8A_A 2FEA_B 3KD3_B Back     alignment and domain information
>cd07990 LPLAT_LCLAT1-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LCLAT1-like Back     alignment and domain information
>PLN02380 1-acyl-sn-glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PTZ00374 dihydroxyacetone phosphate acyltransferase; Provisional Back     alignment and domain information
>smart00563 PlsC Phosphate acyltransferases Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>cd07984 LPLAT_LABLAT-like Lysophospholipid Acyltransferases (LPLATs) of Glycerophospholipid Biosynthesis: LABLAT-like Back     alignment and domain information
>PRK11915 glycerol-3-phosphate acyltransferase; Reviewed Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>KOG2847 consensus Phosphate acyltransferase [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>KOG1505 consensus Lysophosphatidic acid acyltransferase LPAAT and related acyltransferases [Lipid transport and metabolism] Back     alignment and domain information
>KOG2898 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG2937 PlsB Glycerol-3-phosphate O-acyltransferase [Lipid metabolism] Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PF00702 Hydrolase: haloacid dehalogenase-like hydrolase; InterPro: IPR005834 This group of hydrolase enzymes is structurally different from the alpha/beta hydrolase family (abhydrolase) Back     alignment and domain information
>KOG3729 consensus Mitochondrial glycerol-3-phosphate acyltransferase GPAT [Lipid transport and metabolism] Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>PRK08419 lipid A biosynthesis lauroyl acyltransferase; Reviewed Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>TIGR01497 kdpB K+-transporting ATPase, B subunit Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PLN02349 glycerol-3-phosphate acyltransferase Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>KOG3730 consensus Acyl-CoA:dihydroxyactetone-phosphate acyltransferase DHAPAT [Lipid transport and metabolism] Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>COG2121 Uncharacterized protein conserved in bacteria [Function unknown] Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PRK07920 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10671 copA copper exporting ATPase; Provisional Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>COG4030 Uncharacterized protein conserved in archaea [Function unknown] Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>COG2217 ZntA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PRK01122 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01512 ATPase-IB2_Cd heavy metal-(Cd/Co/Hg/Pb/Zn)-translocating P-type ATPase Back     alignment and domain information
>COG1560 HtrB Lauroyl/myristoyl acyltransferase [Cell envelope biogenesis, outer membrane] Back     alignment and domain information
>TIGR01525 ATPase-IB_hvy heavy metal translocating P-type ATPase Back     alignment and domain information
>PRK14010 potassium-transporting ATPase subunit B; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>TIGR01524 ATPase-IIIB_Mg magnesium-translocating P-type ATPase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>PF03279 Lip_A_acyltrans: Bacterial lipid A biosynthesis acyltransferase; InterPro: IPR004960 Bacterial lipopolysachharides (LPS) are glycolipids that make up the outer monolayer of the outer membranes of most Gram-negative bacteria Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>KOG0207 consensus Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>PRK11033 zntA zinc/cadmium/mercury/lead-transporting ATPase; Provisional Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>COG1778 Low specificity phosphatase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>TIGR01116 ATPase-IIA1_Ca sarco/endoplasmic reticulum calcium-translocating P-type ATPase Back     alignment and domain information
>TIGR01522 ATPase-IIA2_Ca golgi membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PRK15122 magnesium-transporting ATPase; Provisional Back     alignment and domain information
>PRK06628 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK10517 magnesium-transporting ATPase MgtA; Provisional Back     alignment and domain information
>PRK06553 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR01647 ATPase-IIIA_H plasma-membrane proton-efflux P-type ATPase Back     alignment and domain information
>TIGR01517 ATPase-IIB_Ca plasma-membrane calcium-translocating P-type ATPase Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>TIGR01523 ATPase-IID_K-Na potassium and/or sodium efflux P-type ATPase, fungal-type Back     alignment and domain information
>PRK06946 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>COG4087 Soluble P-type ATPase [General function prediction only] Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>PRK06860 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>COG2216 KdpB High-affinity K+ transport system, ATPase chain B [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>TIGR02207 lipid_A_htrB lipid A biosynthesis lauroyl (or palmitoleoyl) acyltransferase Back     alignment and domain information
>TIGR01106 ATPase-IIC_X-K sodium or proton efflux -- potassium uptake antiporter, P-type ATPase, alpha subunit Back     alignment and domain information
>TIGR01494 ATPase_P-type ATPase, P-type (transporting), HAD superfamily, subfamily IC Back     alignment and domain information
>PLN02382 probable sucrose-phosphatase Back     alignment and domain information
>PRK08943 lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase; Validated Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>TIGR02208 lipid_A_msbB lipid A biosynthesis (KDO)2-(lauroyl)-lipid IVA acyltransferase Back     alignment and domain information
>COG3700 AphA Acid phosphatase (class B) [General function prediction only] Back     alignment and domain information
>PRK08905 lipid A biosynthesis lauroyl acyltransferase; Validated Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>COG0474 MgtA Cation transport ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>PF03982 DAGAT: Diacylglycerol acyltransferase ; InterPro: IPR007130 The terminal step of triacylglycerol (TAG) formation is catalysed by the enzyme diacylglycerol acyltransferase (DAGAT) [, ] Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>PRK05646 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK08734 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK08733 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PRK08706 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>PRK05906 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK08025 lipid A biosynthesis palmitoleoyl acyltransferase; Reviewed Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01657 P-ATPase-V P-type ATPase of unknown pump specificity (type V) Back     alignment and domain information
>PRK05645 lipid A biosynthesis lauroyl acyltransferase; Provisional Back     alignment and domain information
>PRK15174 Vi polysaccharide export protein VexE; Provisional Back     alignment and domain information
>KOG0202 consensus Ca2+ transporting ATPase [Inorganic ion transport and metabolism] Back     alignment and domain information
>TIGR01652 ATPase-Plipid phospholipid-translocating P-type ATPase, flippase Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>PLN03190 aminophospholipid translocase; Provisional Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>COG3176 Putative hemolysin [General function prediction only] Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>KOG4666 consensus Predicted phosphate acyltransferase, contains PlsC domain [Lipid transport and metabolism] Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>TIGR02244 HAD-IG-Ncltidse HAD superfamily (subfamily IG) hydrolase, 5'-nucleotidase Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>KOG3128 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query515
3fvv_A232 Uncharacterized protein; unknown function, structu 5e-10
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 3e-04
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 5e-04
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Length = 232 Back     alignment and structure
 Score = 58.5 bits (142), Expect = 5e-10
 Identities = 26/164 (15%), Positives = 44/164 (26%), Gaps = 12/164 (7%)

Query: 34  DVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGI---RVLIF 90
           D+D TLL   S +  +A      G                 +  Y             + 
Sbjct: 10  DLDHTLLPLDSDY-QWADFLARTGRAGDPAEAR--RRNDDLMERYNRGELTAEQAAEFML 66

Query: 91  ATFAGMKVPSIESVARAVLPKFYSGDLHPETWRVFSSC---GRRCVL-TANPRIMVEAFL 146
              A      + +     +       L  +   V       G  C L TA    +    +
Sbjct: 67  GLLAAHSPVELAAWHEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAP-I 125

Query: 147 KDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGKNKAGALMKML 190
               G   +I T+     GR TG ++       + K   + + L
Sbjct: 126 ARAFGVQHLIATDPEYRDGRYTGRIEGT-PSFREGKVVRVNQWL 168


>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure

Structure Templates Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
3fvv_A232 Uncharacterized protein; unknown function, structu 99.93
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 99.88
1iuq_A367 Glycerol-3-phosphate acyltransferase; open twisted 99.86
4gxt_A385 A conserved functionally unknown protein; structur 99.86
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 99.65
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 99.63
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 99.62
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 99.54
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 99.5
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 99.48
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 99.39
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.27
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 99.2
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 99.14
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 99.09
3mmz_A176 Putative HAD family hydrolase; structural genomics 99.07
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 98.96
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.95
1y8a_A332 Hypothetical protein AF1437; structural genomics, 98.95
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.91
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.91
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.9
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.89
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 98.89
3mn1_A189 Probable YRBI family phosphatase; structural genom 98.86
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.84
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.83
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 98.82
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.82
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.81
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.79
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.78
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 98.78
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 98.76
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 98.76
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 98.76
2hsz_A243 Novel predicted phosphatase; structural genomics, 98.76
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 98.75
1te2_A226 Putative phosphatase; structural genomics, phospha 98.75
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.74
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.74
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.72
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 98.72
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 98.7
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.7
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 98.69
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.68
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 98.66
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.66
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.66
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.65
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 98.65
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.64
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 98.63
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.63
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 98.63
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 98.62
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 98.6
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 98.59
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 98.58
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 98.58
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 98.58
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 98.54
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 98.53
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 98.52
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.52
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 98.52
2p11_A231 Hypothetical protein; putative haloacid dehalogena 98.51
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 98.49
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.49
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 98.48
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.45
3dao_A283 Putative phosphatse; structural genomics, joint ce 98.44
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 98.44
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 98.4
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 98.4
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 98.38
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 98.37
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.35
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 98.32
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 98.29
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.28
3dnp_A290 Stress response protein YHAX; structural PSI-2, pr 98.25
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 98.23
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 98.18
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 98.18
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 98.13
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.12
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 98.1
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.09
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 98.07
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 98.06
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 97.99
3j08_A645 COPA, copper-exporting P-type ATPase A; copper tra 97.76
1l6r_A227 Hypothetical protein TA0175; structural genomics, 97.76
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 97.74
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 97.68
3rfu_A736 Copper efflux ATPase; alpha helical, CPC, CXXC, AT 97.68
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 97.67
3j09_A723 COPA, copper-exporting P-type ATPase A; copper tra 97.67
3i28_A555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.57
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 97.55
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 97.54
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 97.27
3ixz_A1034 Potassium-transporting ATPase alpha; ION pump, H+, 97.17
3ar4_A995 Sarcoplasmic/endoplasmic reticulum calcium ATPase; 97.13
1mhs_A920 Proton pump, plasma membrane ATPase; ION transport 97.06
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 97.03
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 97.03
2zxe_A1028 Na, K-ATPase alpha subunit; membrane protein, ION 96.95
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 96.89
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 95.94
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 96.88
3b8c_A885 ATPase 2, plasma membrane-type; P-type ATPase, pro 96.84
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 96.78
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 96.74
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 96.66
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 96.59
3zvl_A416 Bifunctional polynucleotide phosphatase/kinase; hy 96.37
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 96.31
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 96.28
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 95.55
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 95.49
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 95.29
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 95.28
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 95.21
2o2x_A218 Hypothetical protein; structural genomics, joint c 95.2
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 95.17
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 95.15
1nrw_A288 Hypothetical protein, haloacid dehalogenase-like h 94.87
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 94.86
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 94.43
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 94.22
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 94.11
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 93.85
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 93.85
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 93.81
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 93.77
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 93.77
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 93.7
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 93.26
3ib6_A189 Uncharacterized protein; structural genomics, unkn 93.1
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 91.95
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 91.74
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 90.71
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 90.67
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 89.8
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 88.04
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 87.46
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 85.5
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 84.76
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 83.9
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 83.62
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 83.19
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 83.04
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 82.82
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 82.69
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 82.26
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 82.2
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 81.94
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 81.48
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 81.22
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 80.94
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
Probab=99.93  E-value=1.5e-25  Score=214.74  Aligned_cols=211  Identities=13%  Similarity=0.083  Sum_probs=157.6

Q ss_pred             CeEEEEecCCccccCCCchHHHHHHHHHhccH--HHHHH-HHhhhHHHHHhcccCcccHHHHHHHHHHHcCCCHHHHHHH
Q 042288           28 KDTVVADVDGTLLRGRSSFPYFALVAFEVGGV--LRLLL-LLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESV  104 (515)
Q Consensus        28 ~~lavFD~DgTL~~~ds~~~~~~~~~~~~~~~--~~~~~-~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~G~~~~~l~~~  104 (515)
                      .++++|||||||+++++.+.+.. +....+..  ..... ........+..+.+. .. ...+.....+.|.+.++++++
T Consensus         4 ~k~viFDlDGTL~d~~~~~~~~~-~~~~~~~~~~~~~~~~~~~~~~~~~~~g~~~-~~-~~~~~~~~~~~~~~~~~~~~~   80 (232)
T 3fvv_A            4 RRLALFDLDHTLLPLDSDYQWAD-FLARTGRAGDPAEARRRNDDLMERYNRGELT-AE-QAAEFMLGLLAAHSPVELAAW   80 (232)
T ss_dssp             CEEEEECCBTTTBSSCHHHHHHH-HHHHTTSSSSHHHHHHHHHHHHHHHHHTCSC-HH-HHHHHHHHHHHTSCHHHHHHH
T ss_pred             CcEEEEeCCCCCcCCchHHHHHH-HHHHcCCCCccHHHHHHHHHHHHHHHCCCCC-HH-HHHHHHHHHhcCCCHHHHHHH
Confidence            57999999999999887553332 22221111  11111 000111111122222 22 133445567789999999999


Q ss_pred             HHHHhchhhcCCCcHHHHH---HHHhCC-CEEEEecCcHHHHHHHHHhhcCCcEEEeceEEEeCceeeeEEecCCccccc
Q 042288          105 ARAVLPKFYSGDLHPETWR---VFSSCG-RRCVLTANPRIMVEAFLKDFLGADMVIGTEICVYKGRSTGFVKSPGVLVGK  180 (515)
Q Consensus       105 ~~~~~~~~~~~~~~~~~~~---~l~~~G-~~vivSaS~~~~v~~ia~~~lGid~vigt~l~~~~G~~tG~i~~~~~~~g~  180 (515)
                      .++++.+.+.+.++|.+.+   .++++| .++|+|+|+..+++++++. +|+++++++.+.+.+|.++|++.+++| .+.
T Consensus        81 ~~~~~~~~~~~~~~~g~~~~l~~l~~~g~~~~ivS~~~~~~~~~~~~~-~g~~~~~~~~~~~~~~~~~g~~~~~~~-~~~  158 (232)
T 3fvv_A           81 HEEFMRDVIRPSLTVQAVDVVRGHLAAGDLCALVTATNSFVTAPIARA-FGVQHLIATDPEYRDGRYTGRIEGTPS-FRE  158 (232)
T ss_dssp             HHHHHHHTTGGGCCHHHHHHHHHHHHTTCEEEEEESSCHHHHHHHHHH-TTCCEEEECEEEEETTEEEEEEESSCS-STH
T ss_pred             HHHHHHHhhhhhcCHHHHHHHHHHHHCCCEEEEEeCCCHHHHHHHHHH-cCCCEEEEcceEEECCEEeeeecCCCC-cch
Confidence            9999888776678888776   456799 5678999999999999998 999999999999999999999998888 899


Q ss_pred             cHHHHHHHHhcCCC-----CCceEEEeCCcCcHHHHhccccceeeCCCCCCCcccccCCCCceE-EccCc
Q 042288          181 NKAGALMKMLGDDE-----EMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIV-FHDGR  244 (515)
Q Consensus       181 ~K~~~l~~~~~~~~-----~~~~~aygDS~~DlpmL~~a~~~~~Vnp~~~l~~~A~~~~~W~i~-f~~~r  244 (515)
                      +|.+.+++++...+     ...+++||||.+|++|++.|+.+++|||++.+++.|+ ++||+++ |...|
T Consensus       159 ~K~~~~~~~~~~~~~~~~~~~~~~~vGDs~~D~~~~~~ag~~~~~~~~~~l~~~a~-~~~w~~~~~~~~~  227 (232)
T 3fvv_A          159 GKVVRVNQWLAGMGLALGDFAESYFYSDSVNDVPLLEAVTRPIAANPSPGLREIAQ-ARGWQVIDLFDHL  227 (232)
T ss_dssp             HHHHHHHHHHHHTTCCGGGSSEEEEEECCGGGHHHHHHSSEEEEESCCHHHHHHHH-HHTCEEECCC---
T ss_pred             HHHHHHHHHHHHcCCCcCchhheEEEeCCHhhHHHHHhCCCeEEECcCHHHHHHHH-HCCCcEeehhhhh
Confidence            99999988876533     2347999999999999999999999999999999999 9999998 76543



>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>1iuq_A Glycerol-3-phosphate acyltransferase; open twisted alpha/beta, four helix bundle; 1.55A {Cucurbita moschata} SCOP: c.112.1.1 PDB: 1k30_A Back     alignment and structure
>4gxt_A A conserved functionally unknown protein; structural genomics, PSI-biology; 1.82A {Anaerococcus prevotii} Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>3j08_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>3rfu_A Copper efflux ATPase; alpha helical, CPC, CXXC, ATP-binding, hydrolase, ION transp magnesium, Cu+, membrane, metal-binding; 3.20A {Legionella pneumophila subsp} Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>3j09_A COPA, copper-exporting P-type ATPase A; copper transporter, adenosine triphosph archaeal proteins, cation transport proteins; 10.00A {Archaeoglobus fulgidus} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3ixz_A Potassium-transporting ATPase alpha; ION pump, H+, K+-ATPase, P-type ATPase, membrane protein, hydrolase, aluminium fluoride, ATP-binding; 6.50A {Sus scrofa} PDB: 2yn9_A 2xzb_A 1iwc_A 1iwf_A Back     alignment and structure
>3ar4_A Sarcoplasmic/endoplasmic reticulum calcium ATPase; P-type ATPase, hydrolase, calcium transport, calcium binding binding; HET: ATP TG1 PTY; 2.15A {Oryctolagus cuniculus} PDB: 2ear_A* 2eas_A* 2eat_A* 2eau_A* 2dqs_A* 2zbe_A 2zbf_A* 2zbg_A* 3ar2_A* 2zbd_A* 3ar3_A* 3ar5_A* 3ar6_A* 3ar7_A* 3ar8_A* 3ar9_A* 3n5k_A* 1kju_A 1iwo_A 1t5s_A* ... Back     alignment and structure
>1mhs_A Proton pump, plasma membrane ATPase; ION transport, membrane protein, P-type ATPase, active transport, cryo-electron microscopy; 8.00A {Neurospora crassa} SCOP: i.18.1.1 Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>2zxe_A Na, K-ATPase alpha subunit; membrane protein, ION pump, ATPase, K+ binding, haloacid dehydrogenease superfamily, phosphate analogue; HET: CLR NAG NDG; 2.40A {Squalus acanthias} PDB: 3a3y_A* 3b8e_A* 3kdp_A* 3n2f_A* 3n23_A* 1mo7_A 1mo8_A* 1q3i_A Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>3b8c_A ATPase 2, plasma membrane-type; P-type ATPase, proton pump, ATP-binding, hydrogen ION transport, hydrolase, ION transport; HET: ACP; 3.60A {Arabidopsis thaliana} Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query515
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 99.86
d1iuqa_367 Glycerol-3-phosphate (1)-acyltransferase {Cushaw s 99.73
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 99.68
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 99.57
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 99.46
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 99.21
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 98.56
d1nrwa_285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 98.55
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.42
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 98.28
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.23
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 98.2
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 98.15
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.13
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 98.09
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 98.01
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 97.99
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 97.97
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 97.82
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 97.8
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 97.75
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 97.69
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 97.67
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 97.66
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 97.63
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 97.6
d1y8aa1308 Hypothetical protein AF1437 {Archaeon Archaeoglobu 97.52
d1k1ea_177 Probable phosphatase YrbI {Haemophilus influenzae, 97.45
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 97.41
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 97.29
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 97.26
d1wpga2168 Calcium ATPase, catalytic domain P {Rabbit (Orycto 97.2
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 97.19
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 96.94
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 96.81
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 96.8
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 96.73
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 96.67
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 96.57
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 96.54
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 96.52
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 96.38
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 95.96
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 95.14
d1qyia_380 Hypothetical protein MW1667 (SA1546) {Staphylococc 94.48
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 93.51
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 93.31
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 93.27
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 89.31
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 87.33
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 85.54
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 85.2
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 84.77
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 84.11
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 84.08
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 84.07
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 83.3
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 82.81
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 82.75
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 82.69
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 80.33
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: Phosphoserine phosphatase
domain: Phosphoserine phosphatase
species: Human (Homo sapiens) [TaxId: 9606]
Probab=99.86  E-value=1.4e-22  Score=191.59  Aligned_cols=195  Identities=17%  Similarity=0.106  Sum_probs=134.4

Q ss_pred             CCeEEEEecCCccccCCCchHHHHHHHHHhccHHHHHHHHhhhHHHHHhcccCcccHHHHHHHHHHHcCCCHHHHHHHHH
Q 042288           27 EKDTVVADVDGTLLRGRSSFPYFALVAFEVGGVLRLLLLLLLSPLAGFLYYYVSESAGIRVLIFATFAGMKVPSIESVAR  106 (515)
Q Consensus        27 ~~~lavFD~DgTL~~~ds~~~~~~~~~~~~~~~~~~~~~l~~~~~~~~~~~l~~~~~~~~~~~~~~~~G~~~~~l~~~~~  106 (515)
                      .++.++|||||||+++++ +..+... .+.......+.      ..+..+.+...+. +++ ....++|...+.++.+.+
T Consensus         9 ~~~aV~FD~DGTLi~~e~-~~~l~~~-~g~~~~~~~~~------~~~~~g~~~~~~~-~~~-~~~~~~~~~~~~~~~~~~   78 (217)
T d1nnla_           9 SADAVCFDVDSTVIREEG-IDELAKI-CGVEDAVSEMT------RRAMGGAVPFKAA-LTE-RLALIQPSREQVQRLIAE   78 (217)
T ss_dssp             HCSEEEEETBTTTBSSCH-HHHHHHH-TTCTTTC------------------CHHHH-HHH-HHHHHCCCHHHHHHHHHH
T ss_pred             CCCEEEEcCccccCCccH-HHHHHHH-cCChHHHHHHH------HHHHcCCCCHHHH-HHH-HHHhcccchHHHHHHHHh
Confidence            356789999999999765 5555432 22111111110      1111111221221 222 235678876666554433


Q ss_pred             HHhchhhcCCCcH---HHHHHHHhCC-CEEEEecCcHHHHHHHHHhhcCCc--EEEeceEEEe-CceeeeEEecCCcccc
Q 042288          107 AVLPKFYSGDLHP---ETWRVFSSCG-RRCVLTANPRIMVEAFLKDFLGAD--MVIGTEICVY-KGRSTGFVKSPGVLVG  179 (515)
Q Consensus       107 ~~~~~~~~~~~~~---~~~~~l~~~G-~~vivSaS~~~~v~~ia~~~lGid--~vigt~l~~~-~G~~tG~i~~~~~~~g  179 (515)
                      .-      ..++|   ++++.|+++| .++||||+++.+++++++. ||+|  +++|+++.++ +|.+||...+.++..+
T Consensus        79 ~~------~~l~pg~~~~i~~lk~~G~~~~ivS~~~~~~v~~i~~~-lgi~~~~v~an~~~~~~~G~~~g~~~~~p~~~~  151 (217)
T d1nnla_          79 QP------PHLTPGIRELVSRLQERNVQVFLISGGFRSIVEHVASK-LNIPATNVFANRLKFYFNGEYAGFDETQPTAES  151 (217)
T ss_dssp             SC------CCBCTTHHHHHHHHHHTTCEEEEEEEEEHHHHHHHHHH-TTCCGGGEEEECEEECTTSCEEEECTTSGGGST
T ss_pred             hc------cccCHHHHHHHHHHHhCCCEEEEECCCchHHHHHHHHH-hCCcccceeeeeeeeeehhccccceeeeeeecc
Confidence            21      22444   4555788999 5678999999999999998 9996  6999999987 8999998877655467


Q ss_pred             ccHHHHHHHHhcCCCCCceEEEeCCcCcHHHHhccccceeeCCCCCCCcccccCCCCceE
Q 042288          180 KNKAGALMKMLGDDEEMPDIGLGDRKTDSLFLNLCKESYMVPPNPKVDPVSQDKLPKPIV  239 (515)
Q Consensus       180 ~~K~~~l~~~~~~~~~~~~~aygDS~~DlpmL~~a~~~~~Vnp~~~l~~~A~~~~~W~i~  239 (515)
                      .+|++.++++..+.+...+++||||.||++|++.|+.++++||++.++.+++ +..|.|.
T Consensus       152 ~~K~~~v~~~~~~~~~~~~~~vGDs~~Di~~~~~ag~~va~~~~~~~~~~~~-~ad~~i~  210 (217)
T d1nnla_         152 GGKGKVIKLLKEKFHFKKIIMIGDGATDMEACPPADAFIGFGGNVIRQQVKD-NAKWYIT  210 (217)
T ss_dssp             THHHHHHHHHHHHHCCSCEEEEESSHHHHTTTTTSSEEEEECSSCCCHHHHH-HCSEEES
T ss_pred             chHHHHHHHHHhccCccccEEEEeCHhhHHHHHhCCceEEECCCHHHHHHHH-hCCCEeC
Confidence            8899998887544223458999999999999999999999999999988887 8889873



>d1iuqa_ c.112.1.1 (A:) Glycerol-3-phosphate (1)-acyltransferase {Cushaw squash (Cucurbita moschata) [TaxId: 3662]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d1y8aa1 c.108.1.24 (A:1-308) Hypothetical protein AF1437 {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1k1ea_ c.108.1.5 (A:) Probable phosphatase YrbI {Haemophilus influenzae, HI1679 [TaxId: 727]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1wpga2 c.108.1.7 (A:344-360,A:600-750) Calcium ATPase, catalytic domain P {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1qyia_ c.108.1.13 (A:) Hypothetical protein MW1667 (SA1546) {Staphylococcus aureus [TaxId: 1280]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure