Citrus Sinensis ID: 042331

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------38
MRIVRKDLIPNGPGSVKMIPVDSDDLWFAYNLVNAGDSVLAVTVRKVVRQTKSGGKDAERVKLKLEIKVEALDYDKEGSALRISGKNILENEHVKIGAFHSLEIELHRPFVLTKDVWDSVALDTLHQASDSAATADLAVVLMQEGLANIFLVGRSMTITRSRIETSIPRKHGPAVARYESALNKFFDSVLHAFLKHVDFNVVRCAVIASPGFTKDQFHRYLLLEAERTQLRPIIANKSRIVIVHTSSGYKHSLREVLDASNVMNLIKETKAAQEVKVLKEFFNMLSNDPTRACYGPKHVEVAHERMAVQTLLITDDLFRNFEIATRKKYVDLVNSVKDSGGTAHIFSSMHFSGEQLGQLTGVAAILRFPLPDLEDIEM
cEEEEEEccccccEEEEEEcccccHHHHHHHccccccEEEEEEEEEEEEcccccccccEEEEEEEEEEEEEEEccccccEEEEEEEEEEccccccccEEEEEEEcccccEEEEECcccHHHHHHHHHHccccccccEEEEEEEccEEEEEEEEccEEEEEEEEEECcccccccccHHHHHHHHHHHHHHHHHHHHHcccccccEEEEEcccccHHHHHHHHHHHHHHccccHHHHccccEEEEEcccccccHHHHHHHcHHHHHHHHHHHHHHHHHHHHHHHHHHHccccCEECcHHHHHHHHHccccEEEEEccccccccHHHHHHHHHHHHHHHHHcccEEEEEccccccHHHHcccccEEEEEEccccccccccc
MRIVR**L**NGPGSVKMIPVDSDDLWFAYNLVNAGDSVLAVTVRKVV***************KLEIKVEALDYDKEGSALRISGKNILENEHVKIGAFHSLEIELHRPFVLTKDVWDSVALDTLHQASDSAATADLAVVLMQEGLANIFLVGRSMTITRSRIETSIPRKHGPAVARYESALNKFFDSVLHAFLKHVDFNVVRCAVIASPGFTKDQFHRYLLLEAERTQLRPIIANKSRIVIVHTSSGYKHSLREVLDASNVMNLIKETKAAQEVKVLKEFFNMLSNDPTRACYGPKHVEVAHERMAVQTLLITDDLFRNFEIATRKKYVDLVNSVKDSGGTAHIFSSMHFSGEQLGQLTGVAAILRFPLPDLED*E*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MRIVRKDLIPNGPGSVKMIPVDSDDLWFAYNLVNAGDSVLAVTVRKVVRQTKSGGKDAERVKLKLEIKVEALDYDKEGSALRISGKNILENEHVKIGAFHSLEIELHRPFVLTKDVWDSVALDTLHQASDSAATADLAVVLMQEGLANIFLVGRSMTITRSRIETSIPRKHGPAVARYESALNKFFDSVLHAFLKHVDFNVVRCAVIASPGFTKDQFHRYLLLEAERTQLRPIIANKSRIVIVHTSSGYKHSLREVLDASNVMNLIKETKAAQEVKVLKEFFNMLSNDPTRACYGPKHVEVAHERMAVQTLLITDDLFRNFEIATRKKYVDLVNSVKDSGGTAHIFSSMHFSGEQLGQLTGVAAILRFPLPDLEDIEM

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Protein pelota homolog Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.probableQ7ZWC4
Protein pelota homolog Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.probableQ5XIP1
Protein pelota homolog Required for normal chromosome segregation during cell division and genomic stability (By similarity). May function in recognizing stalled ribosomes and triggering endonucleolytic cleavage of the mRNA, a mechanism to release non-functional ribosomes and degrade damaged mRNAs. May have ribonuclease activity.probableQ9BRX2

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 1X52, chain A
Confidence level:very confident
Coverage over the Query: 256-376
View the alignment between query and template
View the model in PyMOL
Template: 3MCA, chain B
Confidence level:very confident
Coverage over the Query: 8-46,67-378
View the alignment between query and template
View the model in PyMOL