Citrus Sinensis ID: 042337


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230------
MFTSSSKFSISCLFRQRYNHVPKFGNWETEEHVPYSLYFDEARKRRNAAKINPNDTHENQNTISDNLASIKTSTFETETKSGAQNGREDGDLRRPTESPWYHHTVNIEVAINSLVHRPGRKMTTRQQNAGFDSRIGRSPISPWRNYSTGCSQRRSVTQGAETTDHTAAVPEFGDWDEPDPTSADGYTYIFNQVREERLKGTGNVAAAATPGKPHYKDLKKHKNGAFKKCCCFPVPW
ccccccccHHHHHHHHccccccccccccccccccccHHHHHHHHHcccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccccEEHHHHHHHHHHcccccccccccccccccccccccccccccEEECccccc
********SISCLFRQRYNHVPKFGNWETEEHVPYSLYFD***********************************************************************************************************************************FGDWDEPDPTSADGYTYIFNQVRE******************************FKKCCCFPVPW
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MFTSSSKFSISCLFRQRYNHVPKFGNWETEEHVPYSLYFDEARKRRNAAKINPNDTHENQNTISDNLASIKTSTFETETKSGAQNGREDGDLRRPTESPWYHHTVNIEVAINSLVHRPGRKMTTRQQNAGFDSRIGRSPISPWRNYSTGCSQRRSVTQGAETTDHTAAVPEFGDWDEPDPTSADGYTYIFNQVREERLKGTGNVAAAATPGKPHYKDLKKHKNGAFKKCCCFPVPW

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
RPM1-interacting protein 4 Essential regulator of plant defense, which plays a central role in resistance in case of infection by a pathogen. It is a common target for both type III avirulence proteins from P.syringae (AvrB, AvrRpm1 and AvrRpt2) and for the plant Resistance (R) proteins RPM1 and RPS2. In strains carrying the appropriate R gene for avirulence proteins of the pathogen, its association with avirulence proteins triggers a defense system including the hypersensitive response, which limits the spread of disease. In contrast, in plants lacking appropriate R genes, its association with avirulence proteins of the pathogen impairs the defense system and leads to the pathogen multiplication.probableQ8GYN5

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 2NUD, chain C
Confidence level:very confident
Coverage over the Query: 171-193
View the alignment between query and template
View the model in PyMOL
Template: 2NUD, chain C
Confidence level:confident
Coverage over the Query: 23-42
View the alignment between query and template
View the model in PyMOL