Citrus Sinensis ID: 042367

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330-------340-------350-------360-------370-------380-------390-------400-------410-------420-------43
MAQHSETDSNIEMWKMKKLIKTLSAVKGDGTSLISLVVNPRDKIPRVTKMLGEEYQNASKIKKRMNRQSVQAAITYAQSRLKLYKNVPSNGLVLFTGTGVTEDGEEKKFAHDLVPFKPINSSLYVCDSSFHTEAYGYIIIDGNGTLIGTLCGSSREVVLKFTVDLPKKHGRGGQSALRFSRLRVEKRHNYLREAAELATKCFIDPATSQPNVTGLILAGSAEFKTELSQSGMFDPCLMAKILKVLDISYGGVSGFNQAIELSSDVIANVNVLKEKRVIGKFFEEIGQDTGKFVVGVDDSVKALEMGAIHTLIVWEDLDINRYELKQSVTNGIVIKHLNKKQEAEPSNFKDSAAASDLKVEGKMGLLEWLVDHYKQFGCSLEIVTDKSQEGSQFCRGFGGIGGILRYQPDMGSFDEGSGDGEAAANDSE
ccccccccccHHHHHHHHHHHHHHcccccccEEEEEECcccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccCEEEEEEEEEcccccEEEEEEEEcccccccccEEEEccccccccEEEEEEEccEEEEEEEEcccEEEEEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccEEEEcccHHHHHHHHccccccHHHHccccEEEEccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccEEEcHHHHHHHHHcccccEEEEEccccccEEEEEccccccEEEEEccccccccccccccccccccccccccccHHHHHHHHHHHcccEEEEEccccccHHHHHHccccEEEEEEccccccccccccccccccccccc
************MWKMKKLIKTLSAVKGDGTSLISLVVNPRDKIPRVTKM*******************VQAAITYAQSRLKLYKNVPSNGLVLFTGTGVTEDGEEKKFAHDLVPFKPINSSLYVCDSSFHTEAYGYIIIDGNGTLIGTLCGSSREVVLKFTVDLPK********ALRFSRLRVEKRHNYLREAAELATKCFIDPATSQPNVTGLILAGSAEFKTELSQSGMFDPCLMAKILKVLDISYGGVSGFNQAIELSSDVIANVNVLKEKRVIGKFFEEIGQDTGKFVVGVDDSVKALEMGAIHTLIVWEDLDINRYELKQSVTNGIVIKHLNKKQEA*P*NFKDSAAASDLKVEGKMGLLEWLVDHYKQFGCSLEIVTDKSQEGSQFCRGFGGIGGILRYQPDMGSFDEG************
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MAQHSETDSNIEMWKMKKLIKTLSAVKGDGTSLISLVVNPRDKIPRVTKMLGEEYQNASKIKKRMNRQSVQAAITYAQSRLKLYKNVPSNGLVLFTGTGVTEDGEEKKFAHDLVPFKPINSSLYVCDSSFHTEAYGYIIIDGNGTLIGTLCGSSREVVLKFTVDLPKKHGRGGQSALRFSRLRVEKRHNYLREAAELATKCFIDPATSQPNVTGLILAGSAEFKTELSQSGMFDPCLMAKILKVLDISYGGVSGFNQAIELSSDVIANVNVLKEKRVIGKFFEEIGQDTGKFVVGVDDSVKALEMGAIHTLIVWEDLDINRYELKQSVTNGIVIKHLNKKQEAEPSNFKDSAAASDLKVEGKMGLLEWLVDHYKQFGCSLEIVTDKSQEGSQFCRGFGGIGGILRYQPDMGSFDEGSGDGEAAANDSE

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Eukaryotic peptide chain release factor subunit 1-1 Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA.probableQ39097
Eukaryotic peptide chain release factor subunit 1 Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA (By similarity). Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.probableQ8BWY3
Eukaryotic peptide chain release factor subunit 1 Directs the termination of nascent peptide synthesis (translation) in response to the termination codons UAA, UAG and UGA. Component of the transient SURF complex which recruits UPF1 to stalled ribosomes in the context of nonsense-mediated decay (NMD) of mRNAs containing premature stop codons.probableQ5U2Q7

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3E20, chain C
Confidence level:very confident
Coverage over the Query: 7-150
View the alignment between query and template
View the model in PyMOL