Citrus Sinensis ID: 042449

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90
MASQQGRQELDTRPRQGETVVPGGTGGKSLEAQEHLAEGFSGKNHVVAKRLVANDSISTSVHSTCRVSHARLVHMNRGPQLLTIFFGSPS
cccHHHHHHHHHcccccccccccccccccHHHHHHHHcccccccHHHHHHHcccccHHHHHccccHHHHHHHHcccccccEEEEEccccc
************************T******************************SISTSVHSTCRVSHARLVHMNRGPQLLTIFFGS**
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASQQGRQELDTRPRQGETVVPGGTGGKSLEAQEHLAEGFSGKNHVVAKRLVANDSISTSVHSTCRVSHARLVHMNRGPQLLTIFFGSPS

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Em-like protein GEA6 It is thought to provide protection for the cytoplasm during the desiccation stage of embryo development.probableQ02973
Embryonic abundant protein 1 Em protein may act as a cytoplasm protectant during desiccation.probableP46520

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!

Spatial Structural Prediction

No confident structure templates for the query are predicted