Citrus Sinensis ID: 042485

Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MASSSSSSTASSSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRHA
cccccccccccccccEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEECccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccEEECccccccccEEEccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccccCEEEEEEEccccEEEEccccccEEECccHHcccccccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHcHHHHHHHccc
****************TLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIE*********
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSSSTASSSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDxxxxxxxxxxxxxxxxxxxxxLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRHA

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Ubiquitin-like domain-containing CTD phosphatase Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome.confidentQ8W3M6
Ubiquitin-like domain-containing CTD phosphatase 1 Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome.probableQ2KJD7
Ubiquitin-like domain-containing CTD phosphatase 1 Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome.probableQ5FWT7

Prediction of Enzyme Commission Number ?

EC Number ?Description ?Confidence Level ?
3.-.-.-Hydrolases.probable
3.1.-.-Acting on ester bonds.probable
3.1.3.-Phosphoric monoester hydrolases.probable
3.1.3.16Phosphoprotein phosphatase.probable

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3SHQ, chain A
Confidence level:very confident
Coverage over the Query: 14-323
View the alignment between query and template
View the model in PyMOL