Citrus Sinensis ID: 042485

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------290-------300-------310-------320-------330--
MASSSSSSTASSSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRHA
cccccccccccccccEEEEEEEccEEEEEEEcccccHHHHHHHHHHHHccccccccccccccccccccccccccccccccccEEEEEEccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHccccccccccccEEEEEEcccEEEEccccccccEEEccccHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHcccccccEEEEEEEEccccEEEEccccccEEEEccHHcccccccccccccEEEEEcccccccccccccccccccccccccccccHHHHHHHHHHHHcccccccccccccHHHHHcHHHHHHHccc
cccccccccccccccEEEEEEEccEEEEEEEcccccHHHHHHHHHHHccccHHHHHHHcccccccccccHHHHHHcccccccEEEEEccccHHHccccccccccccccccccHHHHHcccHHHHHHHHHHHHHHccccEccccccccEEEEEEcccEEEccccccccHHHHHcccHHHHHHHHHHHccEEEEEcccHHHHHHHHHHHccccccccEEEEEEEcccEEEEEcccccEEEcccHHHHHHHcccccccccEEEEEcccccccccccccEEEccccccccccccHHHHHHHHHHHHHHHccccHHHccHHHHHHHHHHHHHHHccc
masssssstassseeltltvkwsgkeytvrvcgddSVAELKRRICELTNVLpkrqkllypkignkladdtvllsqlplksslkmtmigtvedeiivdpvdspeiiddfelgqeeavdIKDKEVNKQKLRRRLSQYKIklrnpsregkklLVLDIDYtlfdhrstaenplqLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEElgvltnpnykITALLDHLAMITVqsdsrgifdckplgliwdqfpefysskntimfddlrrnfvmnpqnglaikpfrkahanrdsdQELVKLTQYLLAIAdlddlsnldhgrwefyIEDNTKRRRHA
masssssstassseeltltvkwsgkeytvrvcgddsvAELKRRICeltnvlpkrqkllypkignkladdTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFelgqeeavdikdkevnkqklrrrlsqykiklrnpsregkkllVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLddlsnldhgrwefyiedntkrrrha
MasssssstassseeltlTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVllsqlplksslkMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRHA
****************TLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELG***********************************KKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKA*******QELVKLTQYLLAIADLDDLSNLDHGRWEFYIE*********
******************TVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKI**KL*DDTVLLSQLPLKSSLKMT******************IIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWE*************
****************TLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRHA
*************EELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTK*****
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhoooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MASSSSSSTASSSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDxxxxxxxxxxxxxxxxxxxxxLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFYIEDNTKRRRHA
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query332 2.2.26 [Sep-21-2011]
Q8W3M6340 Ubiquitin-like domain-con yes no 0.963 0.941 0.837 1e-156
Q5ZJJ8318 Ubiquitin-like domain-con yes no 0.921 0.962 0.575 1e-95
Q5FWT7318 Ubiquitin-like domain-con yes no 0.921 0.962 0.575 4e-95
Q8BGR9318 Ubiquitin-like domain-con yes no 0.921 0.962 0.575 4e-95
Q641F1318 Ubiquitin-like domain-con N/A no 0.921 0.962 0.565 5e-93
Q6DI37318 Ubiquitin-like domain-con yes no 0.921 0.962 0.536 1e-92
Q28EX9318 Ubiquitin-like domain-con yes no 0.921 0.962 0.562 3e-92
Q8WVY7318 Ubiquitin-like domain-con yes no 0.924 0.965 0.561 2e-91
Q2KJD7318 Ubiquitin-like domain-con yes no 0.924 0.965 0.561 2e-91
Q5R4C4318 Ubiquitin-like domain-con yes no 0.924 0.965 0.558 9e-91
>sp|Q8W3M6|UBCP_ARATH Ubiquitin-like domain-containing CTD phosphatase OS=Arabidopsis thaliana GN=At4g06599 PE=2 SV=1 Back     alignment and function desciption
 Score =  551 bits (1421), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 268/320 (83%), Positives = 290/320 (90%)

Query: 12  SSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTV 71
           + EELTLTVKW+GKEYTVR+C DDSVAELKRRIC LT VLPKRQKLLYPKIGNKL+DD++
Sbjct: 20  TEEELTLTVKWNGKEYTVRICADDSVAELKRRICLLTTVLPKRQKLLYPKIGNKLSDDSL 79

Query: 72  LLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRR 131
           LLS +  K SLKMTMIGTVED+IIVD  +SPEI+DDFELG+EEAVD+KDKEVNKQKLRRR
Sbjct: 80  LLSSISFKPSLKMTMIGTVEDDIIVDQAESPEIVDDFELGKEEAVDVKDKEVNKQKLRRR 139

Query: 132 LSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMI 191
           + QYKI LR P R+GKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMI
Sbjct: 140 IDQYKINLRTPCRQGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMI 199

Query: 192 WSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPE 251
           WSATSMKWVELKM ELGVL NPNYK+TALLDHLAMITVQSD+RGIFDCKPLGLIW   PE
Sbjct: 200 WSATSMKWVELKMTELGVLNNPNYKVTALLDHLAMITVQSDTRGIFDCKPLGLIWALLPE 259

Query: 252 FYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLS 311
           FY+  NTIMFDDLRRNFVMNPQNGL IKPFRKAHANRD+DQELVKLTQYLL IA+L DLS
Sbjct: 260 FYNPGNTIMFDDLRRNFVMNPQNGLTIKPFRKAHANRDTDQELVKLTQYLLTIAELSDLS 319

Query: 312 NLDHGRWEFYIEDNTKRRRH 331
           +L H RWE + +DN KRRR 
Sbjct: 320 SLHHSRWESFSQDNVKRRRQ 339
Dephosphorylates 26S nuclear proteasomes, thereby decreasing their proteolytic activity. The dephosphorylation may prevent assembly of the core and regulatory particles (CP and RP) into mature 26S proteasome.
Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 1EC: .EC: 3EC: .EC: 1EC: 6
>sp|Q5ZJJ8|UBCP1_CHICK Ubiquitin-like domain-containing CTD phosphatase 1 OS=Gallus gallus GN=UBLCP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5FWT7|UBCP1_RAT Ubiquitin-like domain-containing CTD phosphatase 1 OS=Rattus norvegicus GN=Ublcp1 PE=2 SV=1 Back     alignment and function description
>sp|Q8BGR9|UBCP1_MOUSE Ubiquitin-like domain-containing CTD phosphatase 1 OS=Mus musculus GN=Ublcp1 PE=1 SV=1 Back     alignment and function description
>sp|Q641F1|UBCP1_XENLA Ubiquitin-like domain-containing CTD phosphatase 1 OS=Xenopus laevis GN=ublcp1 PE=2 SV=1 Back     alignment and function description
>sp|Q6DI37|UBCP1_DANRE Ubiquitin-like domain-containing CTD phosphatase 1 OS=Danio rerio GN=ublcp1 PE=2 SV=1 Back     alignment and function description
>sp|Q28EX9|UBCP1_XENTR Ubiquitin-like domain-containing CTD phosphatase 1 OS=Xenopus tropicalis GN=ublcp1 PE=2 SV=1 Back     alignment and function description
>sp|Q8WVY7|UBCP1_HUMAN Ubiquitin-like domain-containing CTD phosphatase 1 OS=Homo sapiens GN=UBLCP1 PE=1 SV=2 Back     alignment and function description
>sp|Q2KJD7|UBCP1_BOVIN Ubiquitin-like domain-containing CTD phosphatase 1 OS=Bos taurus GN=UBLCP1 PE=2 SV=1 Back     alignment and function description
>sp|Q5R4C4|UBCP1_PONAB Ubiquitin-like domain-containing CTD phosphatase 1 OS=Pongo abelii GN=UBLCP1 PE=2 SV=1 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
255584608339 conserved hypothetical protein [Ricinus 0.966 0.946 0.912 1e-173
225448172327 PREDICTED: ubiquitin-like domain-contain 0.981 0.996 0.871 1e-167
224118474328 predicted protein [Populus trichocarpa] 0.987 1.0 0.853 1e-167
449503281331 PREDICTED: ubiquitin-like domain-contain 0.954 0.957 0.873 1e-165
449435118331 PREDICTED: ubiquitin-like domain-contain 0.954 0.957 0.867 1e-164
359806561329 uncharacterized protein LOC100812010 [Gl 0.984 0.993 0.795 1e-158
356525365329 PREDICTED: ubiquitin-like domain-contain 0.984 0.993 0.792 1e-156
224070408334 predicted protein [Populus trichocarpa] 0.954 0.949 0.839 1e-156
255635977329 unknown [Glycine max] 0.984 0.993 0.786 1e-155
297813183340 ubiquitin family protein [Arabidopsis ly 0.963 0.941 0.840 1e-155
>gi|255584608|ref|XP_002533028.1| conserved hypothetical protein [Ricinus communis] gi|223527190|gb|EEF29359.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
 Score =  613 bits (1581), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 293/321 (91%), Positives = 305/321 (95%)

Query: 12  SSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTV 71
           + EELTLTVKWSGKEYTVRVCGDDSV ELKRRICELTNVLPKRQKLLYPKIGNKLA+DTV
Sbjct: 19  TEEELTLTVKWSGKEYTVRVCGDDSVGELKRRICELTNVLPKRQKLLYPKIGNKLANDTV 78

Query: 72  LLSQLPLKSSLKMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRR 131
           LLSQLPLKSSLKMTMIGTVED+IIVD VDSPEI+DDFELGQ+EAVDIKDKEVNKQKLRRR
Sbjct: 79  LLSQLPLKSSLKMTMIGTVEDDIIVDQVDSPEIVDDFELGQDEAVDIKDKEVNKQKLRRR 138

Query: 132 LSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMI 191
             QYKI +RNP REGKKLLVLDIDYTLFDHRSTAENPL+LMRPYLHEFLTAAYAEYDIMI
Sbjct: 139 ADQYKIVIRNPCREGKKLLVLDIDYTLFDHRSTAENPLELMRPYLHEFLTAAYAEYDIMI 198

Query: 192 WSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPE 251
           WSATSMKWVELKM +LGVL NP+YKITALLDHLAMITVQSDSRGIFDCKPLGLIW QFPE
Sbjct: 199 WSATSMKWVELKMGQLGVLNNPSYKITALLDHLAMITVQSDSRGIFDCKPLGLIWAQFPE 258

Query: 252 FYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLS 311
           FYS KNTIMFDDLRRNFVMNPQNGL IKPFRKAHANRDSDQELVKLTQYLLAIADLDD+S
Sbjct: 259 FYSPKNTIMFDDLRRNFVMNPQNGLTIKPFRKAHANRDSDQELVKLTQYLLAIADLDDIS 318

Query: 312 NLDHGRWEFYIEDNTKRRRHA 332
           +LDH  WEF+ EDNTKRRRH 
Sbjct: 319 SLDHSNWEFFAEDNTKRRRHV 339

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225448172|ref|XP_002265791.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase [Vitis vinifera] Back     alignment and taxonomy information
>gi|224118474|ref|XP_002331491.1| predicted protein [Populus trichocarpa] gi|222873569|gb|EEF10700.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|449503281|ref|XP_004161924.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|449435118|ref|XP_004135342.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase-like [Cucumis sativus] Back     alignment and taxonomy information
>gi|359806561|ref|NP_001241520.1| uncharacterized protein LOC100812010 [Glycine max] gi|255634511|gb|ACU17619.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|356525365|ref|XP_003531295.1| PREDICTED: ubiquitin-like domain-containing CTD phosphatase-like [Glycine max] Back     alignment and taxonomy information
>gi|224070408|ref|XP_002303145.1| predicted protein [Populus trichocarpa] gi|222840577|gb|EEE78124.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|255635977|gb|ACU18334.1| unknown [Glycine max] Back     alignment and taxonomy information
>gi|297813183|ref|XP_002874475.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] gi|297320312|gb|EFH50734.1| ubiquitin family protein [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query332
TAIR|locus:1005716300340 AT4G06599 [Arabidopsis thalian 0.939 0.917 0.820 1.5e-138
UNIPROTKB|Q5ZJJ8318 UBLCP1 "Ubiquitin-like domain- 0.909 0.949 0.560 5.7e-91
RGD|1310386318 Ublcp1 "ubiquitin-like domain 0.909 0.949 0.563 1.2e-90
MGI|MGI:1933105318 Ublcp1 "ubiquitin-like domain 0.909 0.949 0.563 1.5e-90
UNIPROTKB|Q2KJD7318 UBLCP1 "Ubiquitin-like domain- 0.909 0.949 0.557 3.1e-90
UNIPROTKB|E2RR79318 UBLCP1 "Uncharacterized protei 0.909 0.949 0.557 3.1e-90
UNIPROTKB|Q8WVY7318 UBLCP1 "Ubiquitin-like domain- 0.909 0.949 0.557 3.1e-90
UNIPROTKB|F2Z591318 UBLCP1 "Uncharacterized protei 0.909 0.949 0.557 3.1e-90
ZFIN|ZDB-GENE-040718-3318 ublcp1 "ubiquitin-like domain 0.909 0.949 0.527 9.9e-87
FB|FBgn0027526320 Ublcp1 "Ubiquitin-like domain- 0.903 0.937 0.514 3.1e-76
TAIR|locus:1005716300 AT4G06599 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 1356 (482.4 bits), Expect = 1.5e-138, P = 1.5e-138
 Identities = 256/312 (82%), Positives = 276/312 (88%)

Query:    19 TVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVXXXXXXX 78
             TVKW+GKEYTVR+C DDSVAELKRRIC LT VLPKRQKLLYPKIGNKL+DD++       
Sbjct:    27 TVKWNGKEYTVRICADDSVAELKRRICLLTTVLPKRQKLLYPKIGNKLSDDSLLLSSISF 86

Query:    79 XXXXXMTMIGTVEDEIIVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIK 138
                  MTMIGTVED+IIVD  +SPEI+DDFELG+EEAVD+KDKEVNKQKLRRR+ QYKI 
Sbjct:    87 KPSLKMTMIGTVEDDIIVDQAESPEIVDDFELGKEEAVDVKDKEVNKQKLRRRIDQYKIN 146

Query:   139 LRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMK 198
             LR P R+GKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMK
Sbjct:   147 LRTPCRQGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMK 206

Query:   199 WVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNT 258
             WVELKM ELGVL NPNYK+TALLDHLAMITVQSD+RGIFDCKPLGLIW   PEFY+  NT
Sbjct:   207 WVELKMTELGVLNNPNYKVTALLDHLAMITVQSDTRGIFDCKPLGLIWALLPEFYNPGNT 266

Query:   259 IMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHGRW 318
             IMFDDLRRNFVMNPQNGL IKPFRKAHANRD+DQELVKLTQYLL IA+L DLS+L H RW
Sbjct:   267 IMFDDLRRNFVMNPQNGLTIKPFRKAHANRDTDQELVKLTQYLLTIAELSDLSSLHHSRW 326

Query:   319 EFYIEDNTKRRR 330
             E + +DN KRRR
Sbjct:   327 ESFSQDNVKRRR 338
GO:0004721 "phosphoprotein phosphatase activity" evidence=IEA
GO:0005634 "nucleus" evidence=ISM;IEA
UNIPROTKB|Q5ZJJ8 UBLCP1 "Ubiquitin-like domain-containing CTD phosphatase 1" [Gallus gallus (taxid:9031)] Back     alignment and assigned GO terms
RGD|1310386 Ublcp1 "ubiquitin-like domain containing CTD phosphatase 1" [Rattus norvegicus (taxid:10116)] Back     alignment and assigned GO terms
MGI|MGI:1933105 Ublcp1 "ubiquitin-like domain containing CTD phosphatase 1" [Mus musculus (taxid:10090)] Back     alignment and assigned GO terms
UNIPROTKB|Q2KJD7 UBLCP1 "Ubiquitin-like domain-containing CTD phosphatase 1" [Bos taurus (taxid:9913)] Back     alignment and assigned GO terms
UNIPROTKB|E2RR79 UBLCP1 "Uncharacterized protein" [Canis lupus familiaris (taxid:9615)] Back     alignment and assigned GO terms
UNIPROTKB|Q8WVY7 UBLCP1 "Ubiquitin-like domain-containing CTD phosphatase 1" [Homo sapiens (taxid:9606)] Back     alignment and assigned GO terms
UNIPROTKB|F2Z591 UBLCP1 "Uncharacterized protein" [Sus scrofa (taxid:9823)] Back     alignment and assigned GO terms
ZFIN|ZDB-GENE-040718-3 ublcp1 "ubiquitin-like domain containing CTD phosphatase 1" [Danio rerio (taxid:7955)] Back     alignment and assigned GO terms
FB|FBgn0027526 Ublcp1 "Ubiquitin-like domain-containing C-terminal domain phosphatase 1" [Drosophila melanogaster (taxid:7227)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

ID ?Name ?Annotated EC number ?Identity ?Query coverage ?Hit coverage ?RBH(Q2H) ?RBH(H2Q) ?
Q641F1UBCP1_XENLA3, ., 1, ., 3, ., 1, 60.56590.92160.9622N/Ano
Q2KJD7UBCP1_BOVIN3, ., 1, ., 3, ., 1, 60.56120.92460.9654yesno
Q8W3M6UBCP_ARATH3, ., 1, ., 3, ., 1, 60.83750.96380.9411yesno
Q5FWT7UBCP1_RAT3, ., 1, ., 3, ., 1, 60.57550.92160.9622yesno
Q5R4C4UBCP1_PONAB3, ., 1, ., 3, ., 1, 60.55800.92460.9654yesno
Q6DI37UBCP1_DANRE3, ., 1, ., 3, ., 1, 60.53690.92160.9622yesno
Q28EX9UBCP1_XENTR3, ., 1, ., 3, ., 1, 60.56270.92160.9622yesno
Q8BGR9UBCP1_MOUSE3, ., 1, ., 3, ., 1, 60.57550.92160.9622yesno
Q5ZJJ8UBCP1_CHICK3, ., 1, ., 3, ., 1, 60.57550.92160.9622yesno
Q8WVY7UBCP1_HUMAN3, ., 1, ., 3, ., 1, 60.56120.92460.9654yesno

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

Prediction LevelEC numberConfidence of Prediction
3rd Layer3.1.3.160.994
3rd Layer3.1.30.998

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
TIGR02245195 TIGR02245, HAD_IIID1, HAD-superfamily subfamily II 1e-126
cd0181374 cd01813, UBP_N, UBP ubiquitin processing protease 8e-27
pfam03031153 pfam03031, NIF, NLI interacting factor-like phosph 1e-24
smart00577148 smart00577, CPDc, catalytic domain of ctd-like pho 2e-14
smart0021372 smart00213, UBQ, Ubiquitin homologues 1e-08
cd0176969 cd01769, UBL, Ubiquitin-like domain of UBL 2e-08
pfam0024069 pfam00240, ubiquitin, Ubiquitin family 1e-06
cd0181271 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 1e-05
cd0019669 cd00196, UBQ, Ubiquitin-like proteins 6e-04
cd0180774 cd01807, GDX_N, ubiquitin-like domain of GDX 6e-04
>gnl|CDD|131299 TIGR02245, HAD_IIID1, HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information 
 Score =  360 bits (925), Expect = e-126
 Identities = 147/195 (75%), Positives = 165/195 (84%)

Query: 127 KLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAE 186
           KL RR+ QYKIKL NP REGKKLLVLDIDYTLFDHRS AE   +LMRPYLHEFLT+AY +
Sbjct: 1   KLLRRIEQYKIKLLNPPREGKKLLVLDIDYTLFDHRSPAETGEELMRPYLHEFLTSAYED 60

Query: 187 YDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIW 246
           YDI+IWSATSMKW+E+KM ELGVLTNPNYKIT LLD  AMITV +  RG FD KPLG+IW
Sbjct: 61  YDIVIWSATSMKWIEIKMTELGVLTNPNYKITFLLDSTAMITVHTPRRGKFDVKPLGVIW 120

Query: 247 DQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIAD 306
              PEFYS KNTIMFDDLRRNF+MNP+NGL I+PF+KAHANR +DQEL+KLTQYL  IA+
Sbjct: 121 ALLPEFYSMKNTIMFDDLRRNFLMNPKNGLKIRPFKKAHANRGTDQELLKLTQYLKTIAE 180

Query: 307 LDDLSNLDHGRWEFY 321
           L+D S+LDH  WE Y
Sbjct: 181 LEDFSSLDHKEWERY 195

This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains , in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD. Length = 195
>gnl|CDD|176408 cd01813, UBP_N, UBP ubiquitin processing protease Back     alignment and domain information
>gnl|CDD|217328 pfam03031, NIF, NLI interacting factor-like phosphatase Back     alignment and domain information
>gnl|CDD|214729 smart00577, CPDc, catalytic domain of ctd-like phosphatases Back     alignment and domain information
>gnl|CDD|214563 smart00213, UBQ, Ubiquitin homologues Back     alignment and domain information
>gnl|CDD|176364 cd01769, UBL, Ubiquitin-like domain of UBL Back     alignment and domain information
>gnl|CDD|215813 pfam00240, ubiquitin, Ubiquitin family Back     alignment and domain information
>gnl|CDD|176407 cd01812, BAG1_N, Ubiquitin-like domain of BAG1 Back     alignment and domain information
>gnl|CDD|176352 cd00196, UBQ, Ubiquitin-like proteins Back     alignment and domain information
>gnl|CDD|176402 cd01807, GDX_N, ubiquitin-like domain of GDX Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 332
TIGR02245195 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase 100.0
KOG1605262 consensus TFIIF-interacting CTD phosphatase, inclu 100.0
TIGR02251162 HIF-SF_euk Dullard-like phosphatase domain. This d 99.97
PF03031159 NIF: NLI interacting factor-like phosphatase; Inte 99.97
KOG2832393 consensus TFIIF-interacting CTD phosphatase, inclu 99.91
TIGR02250156 FCP1_euk FCP1-like phosphatase, phosphatase domain 99.9
KOG1872 473 consensus Ubiquitin-specific protease [Posttransla 99.88
cd0181374 UBP_N UBP ubiquitin processing protease. The UBP ( 99.85
smart00577148 CPDc catalytic domain of ctd-like phosphatases. 99.85
COG5190390 FCP1 TFIIF-interacting CTD phosphatases, including 99.74
cd0181271 BAG1_N Ubiquitin-like domain of BAG1. BAG1_N N-ter 99.68
cd0179173 Ubl5 UBL5 ubiquitin-like modifier. UBL5 (also know 99.62
cd0180774 GDX_N ubiquitin-like domain of GDX. GDX contains a 99.61
cd0180478 midnolin_N Ubiquitin-like domain of midnolin. midn 99.58
cd0180577 RAD23_N Ubiquitin-like domain of RAD23. RAD23 belo 99.57
cd0179280 ISG15_repeat1 ISG15 ubiquitin-like protein, first 99.56
cd0179778 NIRF_N amino-terminal ubiquitin-like domain of Np9 99.54
cd0179470 DC_UbP_C dendritic cell derived ubiquitin-like pro 99.53
cd0179374 Fubi Fubi ubiquitin-like protein. Fubi is a ubiqui 99.53
cd0180972 Scythe_N Ubiquitin-like domain of Scythe protein. 99.51
cd0179870 parkin_N amino-terminal ubiquitin-like of parkin p 99.5
cd0181074 ISG15_repeat2 ISG15 ubiquitin-like protein, second 99.5
cd0180076 SF3a120_C Ubiquitin-like domain of Mammalian splic 99.49
PF0024069 ubiquitin: Ubiquitin family; InterPro: IPR000626 U 99.49
cd01802103 AN1_N ubiquitin-like domain of AN1. AN1 (also know 99.48
PTZ0004476 ubiquitin; Provisional 99.48
cd0179671 DDI1_N DNA damage inducible protein 1 ubiquitin-li 99.46
cd0180676 Nedd8 Nebb8-like ubiquitin protein. Nedd8 (also kn 99.45
cd0180376 Ubiquitin Ubiquitin. Ubiquitin (includes Ubq/RPL40 99.44
cd0180871 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC 99.43
cd0179079 Herp_N Homocysteine-responsive endoplasmic reticul 99.4
KOG0323 635 consensus TFIIF-interacting CTD phosphatases, incl 99.4
smart0021364 UBQ Ubiquitin homologues. Ubiquitin-mediated prote 99.35
TIGR00601378 rad23 UV excision repair protein Rad23. All protei 99.27
cd0181575 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP. BMSC 99.23
cd0176969 UBL Ubiquitin-like domain of UBL. UBLs function by 99.22
KOG000570 consensus Ubiquitin-like protein [Cell cycle contr 99.21
cd0179975 Hoil1_N Ubiquitin-like domain of HOIL1. HOIL1_N HO 99.21
KOG0010 493 consensus Ubiquitin-like protein [Posttranslationa 99.2
cd0176387 Sumo Small ubiquitin-related modifier (SUMO). Smal 99.07
cd01795107 USP48_C USP ubiquitin-specific protease. The USP ( 99.05
KOG0011340 consensus Nucleotide excision repair factor NEF2, 99.03
TIGR01685174 MDP-1 magnesium-dependent phosphatase-1. This mode 99.01
KOG0003128 consensus Ubiquitin/60s ribosomal protein L40 fusi 98.99
cd0178984 Alp11_N Ubiquitin-like domain of Alp11 tubulin-fol 98.96
KOG0004156 consensus Ubiquitin/40S ribosomal protein S27a fus 98.93
PF1456087 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2K 98.86
cd01814113 NTGP5 Ubiquitin-like NTGP5 and ATGP4. NTGP5 and AT 98.77
TIGR01681128 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily 98.71
PLN03243260 haloacid dehalogenase-like hydrolase; Provisional 98.69
PRK14988224 GMP/IMP nucleotidase; Provisional 98.66
TIGR01662132 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily I 98.65
PF1197672 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; Inter 98.64
COG0637221 Predicted phosphatase/phosphohexomutase [General f 98.59
TIGR01656147 Histidinol-ppas histidinol-phosphate phosphatase f 98.58
PRK13288214 pyrophosphatase PpaX; Provisional 98.57
PLN02575381 haloacid dehalogenase-like hydrolase 98.57
TIGR02253221 CTE7 HAD superfamily (subfamily IA) hydrolase, TIG 98.56
cd01788119 ElonginB Ubiquitin-like domain of Elongin B. Elong 98.56
PLN02770248 haloacid dehalogenase-like hydrolase family protei 98.55
PRK10725188 fructose-1-P/6-phosphogluconate phosphatase; Provi 98.53
PRK11587218 putative phosphatase; Provisional 98.51
TIGR01993184 Pyr-5-nucltdase pyrimidine 5'-nucleotidase. These 98.49
PLN02560308 enoyl-CoA reductase 98.48
TIGR01449213 PGP_bact 2-phosphoglycolate phosphatase, prokaryot 98.47
PRK13226229 phosphoglycolate phosphatase; Provisional 98.47
TIGR01454205 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthes 98.46
TIGR01428198 HAD_type_II 2-haloalkanoic acid dehalogenase, type 98.45
TIGR00213176 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase 98.44
PRK09449224 dUMP phosphatase; Provisional 98.39
PF12689169 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 98.38
TIGR03351220 PhnX-like phosphonatase-like hydrolase. This clade 98.38
cd0180177 Tsc13_N Ubiquitin-like domain of Tsc13. Tsc13_N N- 98.38
PRK08942181 D,D-heptose 1,7-bisphosphate phosphatase; Validate 98.38
TIGR02009185 PGMB-YQAB-SF beta-phosphoglucomutase family hydrol 98.37
PRK13225273 phosphoglycolate phosphatase; Provisional 98.36
COG4996164 Predicted phosphatase [General function prediction 98.36
PRK10826222 2-deoxyglucose-6-phosphatase; Provisional 98.35
TIGR01509183 HAD-SF-IA-v3 haloacid dehalogenase superfamily, su 98.34
PF13419176 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 98.34
TIGR02254224 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase 98.33
TIGR01422253 phosphonatase phosphonoacetaldehyde hydrolase. Thi 98.32
PRK13223272 phosphoglycolate phosphatase; Provisional 98.31
TIGR01684301 viral_ppase viral phosphatase. These proteins also 98.29
PRK10563221 6-phosphogluconate phosphatase; Provisional 98.28
PF1154380 UN_NPL4: Nuclear pore localisation protein NPL4; I 98.25
PRK13222226 phosphoglycolate phosphatase; Provisional 98.24
TIGR01664166 DNA-3'-Pase DNA 3'-phosphatase. The central phosph 98.24
PLN02940 382 riboflavin kinase 98.23
PRK06769173 hypothetical protein; Validated 98.23
TIGR01261161 hisB_Nterm histidinol-phosphatase. This model desc 98.22
KOG000175 consensus Ubiquitin and ubiquitin-like proteins [P 98.22
TIGR00338219 serB phosphoserine phosphatase SerB. Phosphoserine 98.22
cd01427139 HAD_like Haloacid dehalogenase-like hydrolases. Th 98.2
PLN02954224 phosphoserine phosphatase 98.2
PHA03398303 viral phosphatase superfamily protein; Provisional 98.19
TIGR02247211 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-li 98.19
TIGR01990185 bPGM beta-phosphoglucomutase. The enzyme from L. l 98.17
PRK06698459 bifunctional 5'-methylthioadenosine/S-adenosylhomo 98.16
PHA02597197 30.2 hypothetical protein; Provisional 98.15
PRK09456199 ?-D-glucose-1-phosphatase; Provisional 98.15
PRK13478267 phosphonoacetaldehyde hydrolase; Provisional 98.15
KOG4248 1143 consensus Ubiquitin-like protein, regulator of apo 98.14
KOG3109244 consensus Haloacid dehalogenase-like hydrolase [Ge 98.13
TIGR01491201 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPa 98.13
COG1011229 Predicted hydrolase (HAD superfamily) [General fun 98.08
TIGR02252203 DREG-2 REG-2-like, HAD superfamily (subfamily IA) 98.08
TIGR01686 320 FkbH FkbH-like domain. The C-terminal portion of t 98.05
PLN02779286 haloacid dehalogenase-like hydrolase family protei 98.05
cd0019669 UBQ Ubiquitin-like proteins. Ubiquitin homologs; I 98.0
PRK09552219 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosp 97.93
TIGR01663 526 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase 97.91
PF13881111 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB 97.89
PHA02530300 pseT polynucleotide kinase; Provisional 97.88
PLN02919 1057 haloacid dehalogenase-like hydrolase family protei 97.87
TIGR01548197 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, 97.8
TIGR01549154 HAD-SF-IA-v1 haloacid dehalogenase superfamily, su 97.8
TIGR01489188 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopent 97.78
TIGR01672237 AphA HAD superfamily (subfamily IIIB) phosphatase, 97.77
PRK11133322 serB phosphoserine phosphatase; Provisional 97.76
PRK13582205 thrH phosphoserine phosphatase; Provisional 97.75
TIGR01668170 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) ph 97.73
PTZ00445219 p36-lilke protein; Provisional 97.7
TIGR01493175 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, su 97.7
COG0546220 Gph Predicted phosphatases [General function predi 97.65
KOG349373 consensus Ubiquitin-like protein [Posttranslationa 97.63
PRK05446 354 imidazole glycerol-phosphate dehydratase/histidino 97.6
PRK10748238 flavin mononucleotide phosphatase; Provisional 97.52
PF05152297 DUF705: Protein of unknown function (DUF705); Inte 97.49
cd0181180 OASL_repeat1 2'-5' oligoadenylate synthetase-like 97.49
TIGR01670154 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-pho 97.45
PRK08238 479 hypothetical protein; Validated 97.37
PF0881779 YukD: WXG100 protein secretion system (Wss), prote 97.36
KOG4495110 consensus RNA polymerase II transcription elongati 97.36
PF08645159 PNK3P: Polynucleotide kinase 3 phosphatase; InterP 97.34
COG0560212 SerB Phosphoserine phosphatase [Amino acid transpo 97.29
TIGR02137203 HSK-PSP phosphoserine phosphatase/homoserine phosp 97.14
TIGR01488177 HAD-SF-IB Haloacid Dehalogenase superfamily, subfa 97.12
KOG2914222 consensus Predicted haloacid-halidohydrolase and r 97.06
COG2179175 Predicted hydrolase of the HAD superfamily [Genera 97.04
KOG0006 446 consensus E3 ubiquitin-protein ligase (Parkin prot 96.91
TIGR01490202 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrol 96.9
PRK09484183 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 96.82
PF1147065 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: 96.8
PRK11590211 hypothetical protein; Provisional 96.69
PRK11009237 aphA acid phosphatase/phosphotransferase; Provisio 96.63
COG3882 574 FkbH Predicted enzyme involved in methoxymalonyl-A 96.61
TIGR01544277 HAD-SF-IE haloacid dehalogenase superfamily, subfa 96.61
PF13344101 Hydrolase_6: Haloacid dehalogenase-like hydrolase; 96.58
KOG3206234 consensus Alpha-tubulin folding cofactor B [Posttr 96.54
COG0561264 Cof Predicted hydrolases of the HAD superfamily [G 96.53
TIGR01533266 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) famil 96.49
PF09419168 PGP_phosphatase: Mitochondrial PGP phosphatase; In 96.45
TIGR01459242 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolas 96.42
COG541781 Uncharacterized small protein [Function unknown] 96.34
PRK00192273 mannosyl-3-phosphoglycerate phosphatase; Reviewed 96.34
TIGR03333214 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl 96.33
TIGR01689126 EcbF-BcbF capsule biosynthesis phosphatase. Due to 96.23
TIGR01545210 YfhB_g-proteo haloacid dehalogenase superfamily, s 96.1
PF06888234 Put_Phosphatase: Putative Phosphatase; InterPro: I 96.08
TIGR02461225 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphat 96.08
TIGR02463221 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-r 96.07
smart00775157 LNS2 LNS2 domain. This domain is found in Saccharo 95.93
TIGR01487215 SPP-like sucrose-phosphate phosphatase-like hydrol 95.89
PRK10513270 sugar phosphate phosphatase; Provisional 95.84
PF0078982 UBX: UBX domain; InterPro: IPR001012 The UBX domai 95.74
TIGR02726169 phenyl_P_delta phenylphosphate carboxylase, delta 95.73
PRK03669271 mannosyl-3-phosphoglycerate phosphatase; Reviewed 95.73
PF08282254 Hydrolase_3: haloacid dehalogenase-like hydrolase; 95.7
PF1030297 DUF2407: DUF2407 ubiquitin-like domain; InterPro: 95.68
PRK10530272 pyridoxal phosphate (PLP) phosphatase; Provisional 95.67
PRK01158230 phosphoglycolate phosphatase; Provisional 95.63
PRK12702 302 mannosyl-3-phosphoglycerate phosphatase; Reviewed 95.63
PRK10444248 UMP phosphatase; Provisional 95.62
TIGR00099256 Cof-subfamily Cof subfamily of IIB subfamily of ha 95.59
PLN02811220 hydrolase 95.58
PRK10976266 putative hydrolase; Provisional 95.35
KOG176999 consensus Ubiquitin-like proteins [Posttranslation 95.32
TIGR01486256 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosph 95.32
TIGR01458257 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydr 95.3
TIGR01456 321 CECR5 HAD-superfamily class IIA hydrolase, TIGR014 95.3
PLN02645 311 phosphoglycolate phosphatase 95.3
PRK15126272 thiamin pyrimidine pyrophosphate hydrolase; Provis 95.21
COG0241181 HisB Histidinol phosphatase and related phosphatas 95.21
TIGR01691220 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopen 95.2
KOG1639297 consensus Steroid reductase required for elongatio 95.18
smart0016680 UBX Domain present in ubiquitin-regulatory protein 95.16
TIGR01452279 PGP_euk phosphoglycolate/pyridoxal phosphate phosp 95.14
PF11019252 DUF2608: Protein of unknown function (DUF2608); In 95.11
KOG0013231 consensus Uncharacterized conserved protein [Funct 95.01
COG5190 390 FCP1 TFIIF-interacting CTD phosphatases, including 94.83
KOG3085237 consensus Predicted hydrolase (HAD superfamily) [G 94.72
TIGR01484204 HAD-SF-IIB HAD-superfamily hydrolase, subfamily II 94.71
TIGR01457249 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydr 94.7
PRK10187266 trehalose-6-phosphate phosphatase; Provisional 94.61
KOG3120256 consensus Predicted haloacid dehalogenase-like hyd 94.36
PF06941191 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosol 94.31
TIGR01482225 SPP-subfamily Sucrose-phosphate phosphatase subfam 94.29
COG2503274 Predicted secreted acid phosphatase [General funct 94.11
PTZ00174247 phosphomannomutase; Provisional 94.03
PRK14502694 bifunctional mannosyl-3-phosphoglycerate synthase/ 93.67
TIGR01675229 plant-AP plant acid phosphatase. This model explic 93.63
TIGR01485249 SPP_plant-cyano sucrose-6F-phosphate phosphohydrol 93.62
PLN02887580 hydrolase family protein 93.6
PF12754309 Blt1: Cell-cycle control medial ring component; In 93.18
cd0177279 SAKS1_UBX SAKS1-like UBX domain. SAKS1 (SAPK-subst 93.1
PF13019162 Telomere_Sde2: Telomere stability and silencing 93.1
COG0647269 NagD Predicted sugar phosphatases of the HAD super 93.04
COG4502180 5'(3')-deoxyribonucleotidase [Nucleotide transport 92.88
smart0066681 PB1 PB1 domain. Phox and Bem1p domain, present in 92.57
PLN02423245 phosphomannomutase 92.24
cd0176777 UBX UBX (ubiquitin regulatory X) domain. The UBX ( 92.22
TIGR01460236 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class 92.1
COG1877266 OtsB Trehalose-6-phosphatase [Carbohydrate transpo 92.1
cd0640680 PB1_P67 A PB1 domain is present in p67 proteins wh 91.97
PF05822246 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); Inter 91.31
COG4359220 Uncharacterized conserved protein [Function unknow 90.93
cd0177485 Faf1_like2_UBX Faf1 ike-2 UBX domain. Faf1_like2 i 90.71
cd0177382 Faf1_like1_UBX Faf1 ike-1 UBX domain. Faf1_like1 i 90.59
COG3769274 Predicted hydrolase (HAD superfamily) [General fun 90.57
PF0056484 PB1: PB1 domain; InterPro: IPR000270 The Phox and 90.55
PLN02151354 trehalose-phosphatase 90.41
PF03767229 Acid_phosphat_B: HAD superfamily, subfamily IIIB ( 89.88
PRK0643767 hypothetical protein; Provisional 89.67
cd0177180 Faf1_UBX Faf1 UBX domain. Faf1 (fas-associated fac 89.67
TIGR00685244 T6PP trehalose-phosphatase. At least 18 distinct s 89.43
cd0177079 p47_UBX p47-like ubiquitin domain. p47_UBX p47 is 89.35
PRK0836470 sulfur carrier protein ThiS; Provisional 88.53
cd0640782 PB1_NLP A PB1 domain is present in NIN like protei 88.53
KOG4549144 consensus Magnesium-dependent phosphatase [General 88.41
PLN02580384 trehalose-phosphatase 88.28
PLN03017366 trehalose-phosphatase 88.18
PRK14501726 putative bifunctional trehalose-6-phosphate syntha 88.13
KOG0012380 consensus DNA damage inducible protein [Replicatio 88.04
KOG1615227 consensus Phosphoserine phosphatase [Amino acid tr 87.31
PF05116247 S6PP: Sucrose-6F-phosphate phosphohydrolase; Inter 86.87
cd0639681 PB1_NBR1 The PB1 domain is an essential part of NB 86.6
cd0599281 PB1 The PB1 domain is a modular domain mediating s 85.74
TIGR01511562 ATPase-IB1_Cu copper-(or silver)-translocating P-t 85.5
TIGR02471236 sucr_syn_bact_C sucrose phosphate synthase, sucros 85.4
KOG2982418 consensus Uncharacterized conserved protein [Funct 85.37
PF1483688 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A 84.58
PF1504476 CLU_N: Mitochondrial function, CLU-N-term 84.04
TIGR01680275 Veg_Stor_Prot vegetative storage protein. The prot 83.89
TIGR02958 452 sec_mycoba_snm4 secretion protein snm4. Members of 83.35
PF08235157 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 82.76
PRK0648865 sulfur carrier protein ThiS; Validated 82.62
KOG2134 422 consensus Polynucleotide kinase 3' phosphatase [Re 80.29
>TIGR02245 HAD_IIID1 HAD-superfamily subfamily IIID hydrolase, TIGR02245 Back     alignment and domain information 
Probab=100.00  E-value=3.1e-52  Score=368.29  Aligned_cols=195  Identities=76%  Similarity=1.219  Sum_probs=183.2

Q ss_pred             HHHhhhhhhcccccCCCcCCcceEEEecCCceEeccCCCCCCceecCCcHHHHHHHHHhCCcEEEEcCCcHHHHHHHHHH
Q 042485          127 KLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEE  206 (332)
Q Consensus       127 k~~~~v~~~~~~~l~~~~~~kk~LVLDLD~TLi~~~~~~~~~~~~~RP~l~eFL~~l~~~yeivI~Tas~~~ya~~~l~~  206 (332)
                      |++++++++.++.+++|++|||+|||||||||+|+.+..+++++++||||++||++|+++|||+||||+++.||+.+|++
T Consensus         1 ~~~~~~~~~~~~~~~~~~~~kklLVLDLDeTLvh~~~~~~~~~~~kRP~l~eFL~~~~~~feIvVwTAa~~~ya~~~l~~   80 (195)
T TIGR02245         1 KLLRRIEQYKIKLLNPPREGKKLLVLDIDYTLFDHRSPAETGEELMRPYLHEFLTSAYEDYDIVIWSATSMKWIEIKMTE   80 (195)
T ss_pred             ChhHHHHhcCccccCCCCCCCcEEEEeCCCceEcccccCCCceEEeCCCHHHHHHHHHhCCEEEEEecCCHHHHHHHHHH
Confidence            57889999999999999999999999999999999777778899999999999999999999999999999999999999


Q ss_pred             hCCCCCCCceEEEEecCCceEEEeeCCCCCccccccccccccCCCcCCCCcEEEEeCCccccccCCCCeeeeccccCCcC
Q 042485          207 LGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHA  286 (332)
Q Consensus       207 l~~~~~~~~~~~~~~d~~~~~~~~~~~~g~~~~KdL~~i~~~~~~~~~~~~~iivDD~~~~~~~~p~Ngi~I~~f~~~~~  286 (332)
                      +++..++.+++.+++|+.+|+++.+...|..++|||+.+|++++..|+++|||||||+|++|.+||+|||+|+||++++.
T Consensus        81 l~~~~~~~~~i~~~ld~~~~~~~~~~~~g~~~vKdL~~lw~~l~~~~~~~ntiiVDd~p~~~~~~P~N~i~I~~f~~~~~  160 (195)
T TIGR02245        81 LGVLTNPNYKITFLLDSTAMITVHTPRRGKFDVKPLGVIWALLPEFYSMKNTIMFDDLRRNFLMNPQNGLKIRPFKKAHA  160 (195)
T ss_pred             hcccCCccceEEEEeccccceeeEeeccCcEEEeecHHhhhhcccCCCcccEEEEeCCHHHHhcCCCCccccCCccccCC
Confidence            99998999999999998878888777888777999999999887546999999999999999999999999999998877


Q ss_pred             CCCCchHHHHHHHHHHhccCCCCchhHhHhhHHHh
Q 042485          287 NRDSDQELVKLTQYLLAIADLDDLSNLDHGRWEFY  321 (332)
Q Consensus       287 ~~~~D~~L~~L~~~L~~l~~~~Dvr~~~~~~w~~~  321 (332)
                      ++..|+||..|++||+.||.++|||+++|++|++|
T Consensus       161 ~~~~D~eL~~L~~yL~~la~~~Dvr~~~~~~w~~~  195 (195)
T TIGR02245       161 NRGTDQELLKLTQYLKTIAELEDFSSLDHKEWERY  195 (195)
T ss_pred             CCcccHHHHHHHHHHHHHhcCcccchhhhcccccC
Confidence            77899999999999999999999999999999987

This family of sequences appears to belong to the Haloacid Dehalogenase (HAD) superfamily of enzymes by virtue of the presence of three catalytic domains, in this case: LLVLD(ILV)D(YH)T, I(VMG)IWS, and (DN)(VC)K(PA)Lx{15-17}T(IL)(MH)(FV)DD(IL)(GRS)(RK)N. Since this family has no large "cap" domain between motifs 1 and 2 or between 2 and 3, it is formally a "class III" HAD.
>KOG1605 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR02251 HIF-SF_euk Dullard-like phosphatase domain Back     alignment and domain information
>PF03031 NIF: NLI interacting factor-like phosphatase; InterPro: IPR004274 The function of this domain is unclear Back     alignment and domain information
>KOG2832 consensus TFIIF-interacting CTD phosphatase, including NLI-interacting factor (involved in RNA polymerase II regulation) [Transcription] Back     alignment and domain information
>TIGR02250 FCP1_euk FCP1-like phosphatase, phosphatase domain Back     alignment and domain information
>KOG1872 consensus Ubiquitin-specific protease [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01813 UBP_N UBP ubiquitin processing protease Back     alignment and domain information
>smart00577 CPDc catalytic domain of ctd-like phosphatases Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>cd01812 BAG1_N Ubiquitin-like domain of BAG1 Back     alignment and domain information
>cd01791 Ubl5 UBL5 ubiquitin-like modifier Back     alignment and domain information
>cd01807 GDX_N ubiquitin-like domain of GDX Back     alignment and domain information
>cd01804 midnolin_N Ubiquitin-like domain of midnolin Back     alignment and domain information
>cd01805 RAD23_N Ubiquitin-like domain of RAD23 Back     alignment and domain information
>cd01792 ISG15_repeat1 ISG15 ubiquitin-like protein, first repeat of 2 Back     alignment and domain information
>cd01797 NIRF_N amino-terminal ubiquitin-like domain of Np95 and NIRF Back     alignment and domain information
>cd01794 DC_UbP_C dendritic cell derived ubiquitin-like protein Back     alignment and domain information
>cd01793 Fubi Fubi ubiquitin-like protein Back     alignment and domain information
>cd01809 Scythe_N Ubiquitin-like domain of Scythe protein Back     alignment and domain information
>cd01798 parkin_N amino-terminal ubiquitin-like of parkin protein Back     alignment and domain information
>cd01810 ISG15_repeat2 ISG15 ubiquitin-like protein, second repeat of 2 Back     alignment and domain information
>cd01800 SF3a120_C Ubiquitin-like domain of Mammalian splicing factor SF3a_120 Back     alignment and domain information
>PF00240 ubiquitin: Ubiquitin family; InterPro: IPR000626 Ubiquitinylation is an ATP-dependent process that involves the action of at least three enzymes: a ubiquitin-activating enzyme (E1, IPR000011 from INTERPRO), a ubiquitin-conjugating enzyme (E2, IPR000608 from INTERPRO), and a ubiquitin ligase (E3, IPR000569 from INTERPRO, IPR003613 from INTERPRO), which work sequentially in a cascade Back     alignment and domain information
>cd01802 AN1_N ubiquitin-like domain of AN1 Back     alignment and domain information
>PTZ00044 ubiquitin; Provisional Back     alignment and domain information
>cd01796 DDI1_N DNA damage inducible protein 1 ubiquitin-like domain Back     alignment and domain information
>cd01806 Nedd8 Nebb8-like ubiquitin protein Back     alignment and domain information
>cd01803 Ubiquitin Ubiquitin Back     alignment and domain information
>cd01808 hPLIC_N Ubiquitin-like domain of hPLIC-1 and hPLIC2 Back     alignment and domain information
>cd01790 Herp_N Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain protein Back     alignment and domain information
>KOG0323 consensus TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>smart00213 UBQ Ubiquitin homologues Back     alignment and domain information
>TIGR00601 rad23 UV excision repair protein Rad23 Back     alignment and domain information
>cd01815 BMSC_UbP_N Ubiquitin-like domain of BMSC-UbP Back     alignment and domain information
>cd01769 UBL Ubiquitin-like domain of UBL Back     alignment and domain information
>KOG0005 consensus Ubiquitin-like protein [Cell cycle control, cell division, chromosome partitioning; Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>cd01799 Hoil1_N Ubiquitin-like domain of HOIL1 Back     alignment and domain information
>KOG0010 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>cd01763 Sumo Small ubiquitin-related modifier (SUMO) Back     alignment and domain information
>cd01795 USP48_C USP ubiquitin-specific protease Back     alignment and domain information
>KOG0011 consensus Nucleotide excision repair factor NEF2, RAD23 component [Replication, recombination and repair] Back     alignment and domain information
>TIGR01685 MDP-1 magnesium-dependent phosphatase-1 Back     alignment and domain information
>KOG0003 consensus Ubiquitin/60s ribosomal protein L40 fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>cd01789 Alp11_N Ubiquitin-like domain of Alp11 tubulin-folding cofactor B Back     alignment and domain information
>KOG0004 consensus Ubiquitin/40S ribosomal protein S27a fusion [Translation, ribosomal structure and biogenesis] Back     alignment and domain information
>PF14560 Ubiquitin_2: Ubiquitin-like domain; PDB: 1WJN_A 2KJ6_A 2KJR_A 1V6E_A 1T0Y_A Back     alignment and domain information
>cd01814 NTGP5 Ubiquitin-like NTGP5 and ATGP4 Back     alignment and domain information
>TIGR01681 HAD-SF-IIIC HAD-superfamily phosphatase, subfamily IIIC Back     alignment and domain information
>PLN03243 haloacid dehalogenase-like hydrolase; Provisional Back     alignment and domain information
>PRK14988 GMP/IMP nucleotidase; Provisional Back     alignment and domain information
>TIGR01662 HAD-SF-IIIA HAD-superfamily hydrolase, subfamily IIIA Back     alignment and domain information
>PF11976 Rad60-SLD: Ubiquitin-2 like Rad60 SUMO-like; InterPro: IPR022617 This entry includes small ubiquitin-related modifier (SUMO) proteins Back     alignment and domain information
>COG0637 Predicted phosphatase/phosphohexomutase [General function prediction only] Back     alignment and domain information
>TIGR01656 Histidinol-ppas histidinol-phosphate phosphatase family domain Back     alignment and domain information
>PRK13288 pyrophosphatase PpaX; Provisional Back     alignment and domain information
>PLN02575 haloacid dehalogenase-like hydrolase Back     alignment and domain information
>TIGR02253 CTE7 HAD superfamily (subfamily IA) hydrolase, TIGR02253 Back     alignment and domain information
>cd01788 ElonginB Ubiquitin-like domain of Elongin B Back     alignment and domain information
>PLN02770 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>PRK10725 fructose-1-P/6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PRK11587 putative phosphatase; Provisional Back     alignment and domain information
>TIGR01993 Pyr-5-nucltdase pyrimidine 5'-nucleotidase Back     alignment and domain information
>PLN02560 enoyl-CoA reductase Back     alignment and domain information
>TIGR01449 PGP_bact 2-phosphoglycolate phosphatase, prokaryotic Back     alignment and domain information
>PRK13226 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01454 AHBA_synth_RP 3-amino-5-hydroxybenoic acid synthesis related protein Back     alignment and domain information
>TIGR01428 HAD_type_II 2-haloalkanoic acid dehalogenase, type II Back     alignment and domain information
>TIGR00213 GmhB_yaeD D,D-heptose 1,7-bisphosphate phosphatase Back     alignment and domain information
>PRK09449 dUMP phosphatase; Provisional Back     alignment and domain information
>PF12689 Acid_PPase: Acid Phosphatase; InterPro: IPR010036 This entry represents two closely related clades of sequences from eukaryotes and archaea Back     alignment and domain information
>TIGR03351 PhnX-like phosphonatase-like hydrolase Back     alignment and domain information
>cd01801 Tsc13_N Ubiquitin-like domain of Tsc13 Back     alignment and domain information
>PRK08942 D,D-heptose 1,7-bisphosphate phosphatase; Validated Back     alignment and domain information
>TIGR02009 PGMB-YQAB-SF beta-phosphoglucomutase family hydrolase Back     alignment and domain information
>PRK13225 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>COG4996 Predicted phosphatase [General function prediction only] Back     alignment and domain information
>PRK10826 2-deoxyglucose-6-phosphatase; Provisional Back     alignment and domain information
>TIGR01509 HAD-SF-IA-v3 haloacid dehalogenase superfamily, subfamily IA, variant 3 with third motif having DD or ED Back     alignment and domain information
>PF13419 HAD_2: Haloacid dehalogenase-like hydrolase; PDB: 2FI1_A 2I6X_A 3SD7_A 4F71_A 4DFD_B 4F72_B 4DCC_A 3DDH_A 3KZX_A 2B0C_A Back     alignment and domain information
>TIGR02254 YjjG/YfnB HAD superfamily (subfamily IA) hydrolase, TIGR02254 Back     alignment and domain information
>TIGR01422 phosphonatase phosphonoacetaldehyde hydrolase Back     alignment and domain information
>PRK13223 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01684 viral_ppase viral phosphatase Back     alignment and domain information
>PRK10563 6-phosphogluconate phosphatase; Provisional Back     alignment and domain information
>PF11543 UN_NPL4: Nuclear pore localisation protein NPL4; InterPro: IPR024682 Npl4, along with Ufd1, forms the heterodimer adaptor complex UN, which is involved in the recruitment of p97, an AAA ATPase, for tasks involving the ubiquitin pathway Back     alignment and domain information
>PRK13222 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>TIGR01664 DNA-3'-Pase DNA 3'-phosphatase Back     alignment and domain information
>PLN02940 riboflavin kinase Back     alignment and domain information
>PRK06769 hypothetical protein; Validated Back     alignment and domain information
>TIGR01261 hisB_Nterm histidinol-phosphatase Back     alignment and domain information
>KOG0001 consensus Ubiquitin and ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones; General function prediction only] Back     alignment and domain information
>TIGR00338 serB phosphoserine phosphatase SerB Back     alignment and domain information
>cd01427 HAD_like Haloacid dehalogenase-like hydrolases Back     alignment and domain information
>PLN02954 phosphoserine phosphatase Back     alignment and domain information
>PHA03398 viral phosphatase superfamily protein; Provisional Back     alignment and domain information
>TIGR02247 HAD-1A3-hyp Epoxide hydrolase N-terminal domain-like phosphatase Back     alignment and domain information
>TIGR01990 bPGM beta-phosphoglucomutase Back     alignment and domain information
>PRK06698 bifunctional 5'-methylthioadenosine/S-adenosylhomocysteine nucleosidase/phosphatase; Validated Back     alignment and domain information
>PHA02597 30 Back     alignment and domain information
>PRK09456 ?-D-glucose-1-phosphatase; Provisional Back     alignment and domain information
>PRK13478 phosphonoacetaldehyde hydrolase; Provisional Back     alignment and domain information
>KOG4248 consensus Ubiquitin-like protein, regulator of apoptosis [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>KOG3109 consensus Haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>TIGR01491 HAD-SF-IB-PSPlk HAD-superfamily, subfamily-IB PSPase-like hydrolase, archaeal Back     alignment and domain information
>COG1011 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR02252 DREG-2 REG-2-like, HAD superfamily (subfamily IA) hydrolase Back     alignment and domain information
>TIGR01686 FkbH FkbH-like domain Back     alignment and domain information
>PLN02779 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>cd00196 UBQ Ubiquitin-like proteins Back     alignment and domain information
>PRK09552 mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; Reviewed Back     alignment and domain information
>TIGR01663 PNK-3'Pase polynucleotide 5'-kinase 3'-phosphatase Back     alignment and domain information
>PF13881 Rad60-SLD_2: Ubiquitin-2 like Rad60 SUMO-like; PDB: 1SE9_A 1WGH_A 2GOW_A Back     alignment and domain information
>PHA02530 pseT polynucleotide kinase; Provisional Back     alignment and domain information
>PLN02919 haloacid dehalogenase-like hydrolase family protein Back     alignment and domain information
>TIGR01548 HAD-SF-IA-hyp1 haloacid dehalogenase superfamily, subfamily IA hydrolase, TIGR01548 Back     alignment and domain information
>TIGR01549 HAD-SF-IA-v1 haloacid dehalogenase superfamily, subfamily IA, variant 1 with third motif having Dx(3-4)D or Dx(3-4)E Back     alignment and domain information
>TIGR01489 DKMTPPase-SF 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>TIGR01672 AphA HAD superfamily (subfamily IIIB) phosphatase, TIGR01672 Back     alignment and domain information
>PRK11133 serB phosphoserine phosphatase; Provisional Back     alignment and domain information
>PRK13582 thrH phosphoserine phosphatase; Provisional Back     alignment and domain information
>TIGR01668 YqeG_hyp_ppase HAD superfamily (subfamily IIIA) phosphatase, TIGR01668 Back     alignment and domain information
>PTZ00445 p36-lilke protein; Provisional Back     alignment and domain information
>TIGR01493 HAD-SF-IA-v2 Haloacid dehalogenase superfamily, subfamily IA, variant 2 with 3rd motif like haloacid dehalogenase Back     alignment and domain information
>COG0546 Gph Predicted phosphatases [General function prediction only] Back     alignment and domain information
>KOG3493 consensus Ubiquitin-like protein [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>PRK05446 imidazole glycerol-phosphate dehydratase/histidinol phosphatase; Provisional Back     alignment and domain information
>PRK10748 flavin mononucleotide phosphatase; Provisional Back     alignment and domain information
>PF05152 DUF705: Protein of unknown function (DUF705); InterPro: IPR007827 This family contains uncharacterised baculoviral proteins Back     alignment and domain information
>cd01811 OASL_repeat1 2'-5' oligoadenylate synthetase-like protein, repeat 1 of 2 Back     alignment and domain information
>TIGR01670 YrbI-phosphatas 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase, YrbI family Back     alignment and domain information
>PRK08238 hypothetical protein; Validated Back     alignment and domain information
>PF08817 YukD: WXG100 protein secretion system (Wss), protein YukD; InterPro: IPR014921 YukD is a bacterial protein that adopts a ubiquitin-like fold [] Back     alignment and domain information
>KOG4495 consensus RNA polymerase II transcription elongation factor Elongin/SIII, subunit elongin B [Transcription] Back     alignment and domain information
>PF08645 PNK3P: Polynucleotide kinase 3 phosphatase; InterPro: IPR013954 Polynucleotide kinase 3 phosphatases play a role in the repair of single breaks in DNA induced by DNA-damaging agents such as gamma radiation and camptothecin [] Back     alignment and domain information
>COG0560 SerB Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02137 HSK-PSP phosphoserine phosphatase/homoserine phosphotransferase bifunctional protein Back     alignment and domain information
>TIGR01488 HAD-SF-IB Haloacid Dehalogenase superfamily, subfamily IB, phosphoserine phosphatase-like Back     alignment and domain information
>KOG2914 consensus Predicted haloacid-halidohydrolase and related hydrolases [General function prediction only] Back     alignment and domain information
>COG2179 Predicted hydrolase of the HAD superfamily [General function prediction only] Back     alignment and domain information
>KOG0006 consensus E3 ubiquitin-protein ligase (Parkin protein) [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01490 HAD-SF-IB-hyp1 HAD-superfamily subfamily IB hydrolase, TIGR01490 Back     alignment and domain information
>PRK09484 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; Provisional Back     alignment and domain information
>PF11470 TUG-UBL1: GLUT4 regulating protein TUG; InterPro: IPR021569 TUG is a GLUT4 regulating protein and functions to retain membrane vesicles containing GLUT4 intracellularly Back     alignment and domain information
>PRK11590 hypothetical protein; Provisional Back     alignment and domain information
>PRK11009 aphA acid phosphatase/phosphotransferase; Provisional Back     alignment and domain information
>COG3882 FkbH Predicted enzyme involved in methoxymalonyl-ACP biosynthesis [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>TIGR01544 HAD-SF-IE haloacid dehalogenase superfamily, subfamily IE hydrolase, TIGR01544 Back     alignment and domain information
>PF13344 Hydrolase_6: Haloacid dehalogenase-like hydrolase; PDB: 2HO4_B 1YV9_A 1WVI_B 3EPR_A 2P27_A 2OYC_A 2CFT_A 2P69_A 2CFS_A 2CFR_A Back     alignment and domain information
>KOG3206 consensus Alpha-tubulin folding cofactor B [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>COG0561 Cof Predicted hydrolases of the HAD superfamily [General function prediction only] Back     alignment and domain information
>TIGR01533 lipo_e_P4 5'-nucleotidase, lipoprotein e(P4) family Back     alignment and domain information
>PF09419 PGP_phosphatase: Mitochondrial PGP phosphatase; InterPro: IPR010021 This group of hypothetical proteins is a part of the IIIA subfamily of the haloacid dehalogenase (HAD) superfamily of hydrolases Back     alignment and domain information
>TIGR01459 HAD-SF-IIA-hyp4 HAD-superfamily class IIA hydrolase, TIGR01459 Back     alignment and domain information
>COG5417 Uncharacterized small protein [Function unknown] Back     alignment and domain information
>PRK00192 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>TIGR03333 salvage_mtnX 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase Back     alignment and domain information
>TIGR01689 EcbF-BcbF capsule biosynthesis phosphatase Back     alignment and domain information
>TIGR01545 YfhB_g-proteo haloacid dehalogenase superfamily, subfamily IF hydrolase, YfhB Back     alignment and domain information
>PF06888 Put_Phosphatase: Putative Phosphatase; InterPro: IPR016965 This group represents phosphatases related to PHOSPHO1 and PHOSPHO2 [] Back     alignment and domain information
>TIGR02461 osmo_MPG_phos mannosyl-3-phosphoglycerate phosphatase Back     alignment and domain information
>TIGR02463 MPGP_rel mannosyl-3-phosphoglycerate phosphatase-related protein Back     alignment and domain information
>smart00775 LNS2 LNS2 domain Back     alignment and domain information
>TIGR01487 SPP-like sucrose-phosphate phosphatase-like hydrolase, Archaeal Back     alignment and domain information
>PRK10513 sugar phosphate phosphatase; Provisional Back     alignment and domain information
>PF00789 UBX: UBX domain; InterPro: IPR001012 The UBX domain is found in ubiquitin-regulatory proteins, which are members of the ubiquitination pathway, as well as a number of other proteins including FAF-1 (FAS-associated factor 1), the human Rep-8 reproduction protein and several hypothetical proteins from yeast Back     alignment and domain information
>TIGR02726 phenyl_P_delta phenylphosphate carboxylase, delta subunit Back     alignment and domain information
>PRK03669 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PF08282 Hydrolase_3: haloacid dehalogenase-like hydrolase; InterPro: IPR013200 The Haloacid Dehydrogenase (HAD) superfamily includes phosphatases, phosphonatases, P-type ATPases, beta-phosphoglucomutases, phosphomannomutases, and dehalogenases, which are involved in a variety of cellular processes ranging from amino acid biosynthesis to detoxification [] Back     alignment and domain information
>PF10302 DUF2407: DUF2407 ubiquitin-like domain; InterPro: IPR019413 This entry represents a family of proteins of unknown function found in fungi Back     alignment and domain information
>PRK10530 pyridoxal phosphate (PLP) phosphatase; Provisional Back     alignment and domain information
>PRK01158 phosphoglycolate phosphatase; Provisional Back     alignment and domain information
>PRK12702 mannosyl-3-phosphoglycerate phosphatase; Reviewed Back     alignment and domain information
>PRK10444 UMP phosphatase; Provisional Back     alignment and domain information
>TIGR00099 Cof-subfamily Cof subfamily of IIB subfamily of haloacid dehalogenase superfamily Back     alignment and domain information
>PLN02811 hydrolase Back     alignment and domain information
>PRK10976 putative hydrolase; Provisional Back     alignment and domain information
>KOG1769 consensus Ubiquitin-like proteins [Posttranslational modification, protein turnover, chaperones] Back     alignment and domain information
>TIGR01486 HAD-SF-IIB-MPGP mannosyl-3-phosphoglycerate phosphatase family Back     alignment and domain information
>TIGR01458 HAD-SF-IIA-hyp3 HAD-superfamily subfamily IIA hydrolase, TIGR01458 Back     alignment and domain information
>TIGR01456 CECR5 HAD-superfamily class IIA hydrolase, TIGR01456, CECR5 Back     alignment and domain information
>PLN02645 phosphoglycolate phosphatase Back     alignment and domain information
>PRK15126 thiamin pyrimidine pyrophosphate hydrolase; Provisional Back     alignment and domain information
>COG0241 HisB Histidinol phosphatase and related phosphatases [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR01691 enolase-ppase 2,3-diketo-5-methylthio-1-phosphopentane phosphatase Back     alignment and domain information
>KOG1639 consensus Steroid reductase required for elongation of the very long chain fatty acids [Lipid transport and metabolism] Back     alignment and domain information
>smart00166 UBX Domain present in ubiquitin-regulatory proteins Back     alignment and domain information
>TIGR01452 PGP_euk phosphoglycolate/pyridoxal phosphate phosphatase family Back     alignment and domain information
>PF11019 DUF2608: Protein of unknown function (DUF2608); InterPro: IPR022565 This family is conserved in Bacteria Back     alignment and domain information
>KOG0013 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>COG5190 FCP1 TFIIF-interacting CTD phosphatases, including NLI-interacting factor [Transcription] Back     alignment and domain information
>KOG3085 consensus Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>TIGR01484 HAD-SF-IIB HAD-superfamily hydrolase, subfamily IIB Back     alignment and domain information
>TIGR01457 HAD-SF-IIA-hyp2 HAD-superfamily subfamily IIA hydrolase, TIGR01457 Back     alignment and domain information
>PRK10187 trehalose-6-phosphate phosphatase; Provisional Back     alignment and domain information
>KOG3120 consensus Predicted haloacid dehalogenase-like hydrolase [General function prediction only] Back     alignment and domain information
>PF06941 NT5C: 5' nucleotidase, deoxy (Pyrimidine), cytosolic type C protein (NT5C); InterPro: IPR010708 This family consists of several 5' nucleotidase, deoxy (Pyrimidine), and cytosolic type C (NT5C) proteins Back     alignment and domain information
>TIGR01482 SPP-subfamily Sucrose-phosphate phosphatase subfamily Back     alignment and domain information
>COG2503 Predicted secreted acid phosphatase [General function prediction only] Back     alignment and domain information
>PTZ00174 phosphomannomutase; Provisional Back     alignment and domain information
>PRK14502 bifunctional mannosyl-3-phosphoglycerate synthase/mannosyl-3 phosphoglycerate phosphatase; Provisional Back     alignment and domain information
>TIGR01675 plant-AP plant acid phosphatase Back     alignment and domain information
>TIGR01485 SPP_plant-cyano sucrose-6F-phosphate phosphohydrolase Back     alignment and domain information
>PLN02887 hydrolase family protein Back     alignment and domain information
>PF12754 Blt1: Cell-cycle control medial ring component; InterPro: IPR024737 During size-dependent cell cycle transitions controlled by the ubiquitous cyclin-dependent kinase Cdk1, Blt1 has been shown to co-localise with Cdr2 in the medial interphase nodes, as well as with Mid1 which was previously shown to localise to similar interphase structures Back     alignment and domain information
>cd01772 SAKS1_UBX SAKS1-like UBX domain Back     alignment and domain information
>PF13019 Telomere_Sde2: Telomere stability and silencing Back     alignment and domain information
>COG0647 NagD Predicted sugar phosphatases of the HAD superfamily [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG4502 5'(3')-deoxyribonucleotidase [Nucleotide transport and metabolism] Back     alignment and domain information
>smart00666 PB1 PB1 domain Back     alignment and domain information
>PLN02423 phosphomannomutase Back     alignment and domain information
>cd01767 UBX UBX (ubiquitin regulatory X) domain Back     alignment and domain information
>TIGR01460 HAD-SF-IIA Haloacid Dehalogenase Superfamily Class (subfamily) IIA Back     alignment and domain information
>COG1877 OtsB Trehalose-6-phosphatase [Carbohydrate transport and metabolism] Back     alignment and domain information
>cd06406 PB1_P67 A PB1 domain is present in p67 proteins which forms a signaling complex with p40, a crucial step for activation of NADPH oxidase during phagocytosis Back     alignment and domain information
>PF05822 UMPH-1: Pyrimidine 5'-nucleotidase (UMPH-1); InterPro: IPR006434 This family is a small group of metazoan sequences with sequences from Arabidopsis thaliana (Mouse-ear cress) and rice Back     alignment and domain information
>COG4359 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>cd01774 Faf1_like2_UBX Faf1 ike-2 UBX domain Back     alignment and domain information
>cd01773 Faf1_like1_UBX Faf1 ike-1 UBX domain Back     alignment and domain information
>COG3769 Predicted hydrolase (HAD superfamily) [General function prediction only] Back     alignment and domain information
>PF00564 PB1: PB1 domain; InterPro: IPR000270 The Phox and Bem1p domain, is present in many eukaryotic cytoplasmic signalling proteins Back     alignment and domain information
>PLN02151 trehalose-phosphatase Back     alignment and domain information
>PF03767 Acid_phosphat_B: HAD superfamily, subfamily IIIB (Acid phosphatase); InterPro: IPR005519 This family of class B acid phosphatases also contains a number of vegetative storage proteins (VPS25) Back     alignment and domain information
>PRK06437 hypothetical protein; Provisional Back     alignment and domain information
>cd01771 Faf1_UBX Faf1 UBX domain Back     alignment and domain information
>TIGR00685 T6PP trehalose-phosphatase Back     alignment and domain information
>cd01770 p47_UBX p47-like ubiquitin domain Back     alignment and domain information
>PRK08364 sulfur carrier protein ThiS; Provisional Back     alignment and domain information
>cd06407 PB1_NLP A PB1 domain is present in NIN like proteins (NLP), a key enzyme in a process of establishment of symbiosis betweeen legumes and nitrogen fixing bacteria (Rhizobium) Back     alignment and domain information
>KOG4549 consensus Magnesium-dependent phosphatase [General function prediction only] Back     alignment and domain information
>PLN02580 trehalose-phosphatase Back     alignment and domain information
>PLN03017 trehalose-phosphatase Back     alignment and domain information
>PRK14501 putative bifunctional trehalose-6-phosphate synthase/HAD hydrolase subfamily IIB; Provisional Back     alignment and domain information
>KOG0012 consensus DNA damage inducible protein [Replication, recombination and repair] Back     alignment and domain information
>KOG1615 consensus Phosphoserine phosphatase [Amino acid transport and metabolism] Back     alignment and domain information
>PF05116 S6PP: Sucrose-6F-phosphate phosphohydrolase; InterPro: IPR006380 This family of sequences represent sucrose phosphate phosphohydrolase (SPP) from plants and cyanobacteria [] Back     alignment and domain information
>cd06396 PB1_NBR1 The PB1 domain is an essential part of NBR1 protein, next to BRCA1, a scaffold protein mediating specific protein-protein interaction with both titin protein kinase and with another scaffold protein p62 Back     alignment and domain information
>cd05992 PB1 The PB1 domain is a modular domain mediating specific protein-protein interactions which play a role in many critical cell processes, such as osteoclastogenesis, angiogenesis, early cardiovascular development, and cell polarity Back     alignment and domain information
>TIGR01511 ATPase-IB1_Cu copper-(or silver)-translocating P-type ATPase Back     alignment and domain information
>TIGR02471 sucr_syn_bact_C sucrose phosphate synthase, sucrose phosphatase-like domain, bacterial Back     alignment and domain information
>KOG2982 consensus Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PF14836 Ubiquitin_3: Ubiquitin-like domain; PDB: 3JYU_A 4A3O_B 3PPA_A 3T9L_A 4A3P_A 3PV1_A Back     alignment and domain information
>PF15044 CLU_N: Mitochondrial function, CLU-N-term Back     alignment and domain information
>TIGR01680 Veg_Stor_Prot vegetative storage protein Back     alignment and domain information
>TIGR02958 sec_mycoba_snm4 secretion protein snm4 Back     alignment and domain information
>PF08235 LNS2: LNS2 (Lipin/Ned1/Smp2); InterPro: IPR013209 This domain is found in Saccharomyces cerevisiae (Baker's yeast) protein SMP2, proteins with an N-terminal lipin domain (IPR007651 from INTERPRO) and phosphatidylinositol transfer proteins [] Back     alignment and domain information
>PRK06488 sulfur carrier protein ThiS; Validated Back     alignment and domain information
>KOG2134 consensus Polynucleotide kinase 3' phosphatase [Replication, recombination and repair] Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
3shq_A320 Crystal Structure Of Ublcp1 Length = 320 2e-80
1v5t_A90 Solution Structure Of The Ubiquitin-Like Domain Fro 4e-07
2kx3_A81 The Solution Structure Of The Mutant Of Ubl Domain 7e-07
2lgd_A83 The High Resolution Structure Of Ubiquitin Like Dom 8e-07
>pdb|3SHQ|A Chain A, Crystal Structure Of Ublcp1 Length = 320 Back     alignment and structure 
Iteration: 1

 Score =  295 bits (755), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 155/304 (50%), Positives = 198/304 (65%), Gaps = 5/304 (1%)
Query: 22  WSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVXXXXXXXXXX 81
           WSGKEY V +   D+V  L+  I   T V P+RQKLL  K   K A D V          
Sbjct: 12  WSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVKISALELKPN 71
Query: 82  XXMTMIGTVEDEI---IVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIK 138
             + M+G+ E +I      P +  E++DDF+   E    +    V   K++RR+  YKIK
Sbjct: 72  FKLMMVGSTEADIEDACSLPDNIGEVVDDFDDADEREESVAHSAVYLAKVQRRVRDYKIK 131
Query: 139 LRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYDIMIWSATSMK 198
              P REGKKLLVLDIDYTLFDHRS AE   +LMRPYLHEFLT+AY +YDI+IWSATSM+
Sbjct: 132 ELAPPREGKKLLVLDIDYTLFDHRSPAETGTELMRPYLHEFLTSAYEDYDIVIWSATSMR 191
Query: 199 WVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNT 258
           W+E KM  LGV +N NYK+   LD  AMI+V    RG+ D KPLG+IW  + + Y+S NT
Sbjct: 192 WIEEKMRLLGVASNDNYKVMFYLDSTAMISVHVPERGVVDVKPLGVIWALYKQ-YNSSNT 250
Query: 259 IMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIA-DLDDLSNLDHGR 317
           IMFDD+RRNF+MNP++GL I+PFR+AH NR +D EL+KL+ YL  IA    D ++L+H +
Sbjct: 251 IMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLKLSDYLRKIAHHCPDFNSLNHRK 310
Query: 318 WEFY 321
           WE Y
Sbjct: 311 WEHY 314
>pdb|1V5T|A Chain A, Solution Structure Of The Ubiquitin-Like Domain From Mouse Hypothetical 8430435i17rik Protein Length = 90 Back     alignment and structure
>pdb|2KX3|A Chain A, The Solution Structure Of The Mutant Of Ubl Domain Of Ublcp1, I5m Length = 81 Back     alignment and structure
>pdb|2LGD|A Chain A, The High Resolution Structure Of Ubiquitin Like Domain Of Ublcp1 Length = 83 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query332
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 2e-94
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 5e-26
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 9e-23
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 7e-22
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 7e-22
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 3e-12
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 6e-12
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 6e-12
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 6e-12
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 4e-11
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 8e-07
1vt4_I 1221 APAF-1 related killer DARK; drosophila apoptosome, 6e-05
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 6e-09
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 4e-08
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 4e-08
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 9e-08
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 1e-07
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 2e-07
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 5e-07
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 5e-07
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 7e-07
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 2e-06
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 2e-06
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 2e-06
3u5c_F225 RP14, S2, YS8, 40S ribosomal protein S5; translati 8e-06
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 8e-06
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 2e-05
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 2e-05
3m62_B106 UV excision repair protein RAD23; armadillo-like r 3e-05
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 3e-05
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 5e-05
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 5e-05
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 1e-04
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 1e-04
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 1e-04
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 1e-04
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 1e-04
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 1e-04
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 2e-04
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 2e-04
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 2e-04
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 2e-04
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 2e-04
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 3e-04
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 4e-04
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 4e-04
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 5e-04
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 5e-04
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 6e-04
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 6e-04
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 7e-04
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Length = 320 Back     alignment and structure
 Score =  282 bits (722), Expect = 2e-94
 Identities = 163/318 (51%), Positives = 211/318 (66%), Gaps = 5/318 (1%)

Query: 12  SSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTV 71
             +E+ + VKWSGKEY V +   D+V  L+  I   T V P+RQKLL  K   K A D V
Sbjct: 2   EVKEVVVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNV 61

Query: 72  LLSQLPLKSSLKMTMIGTVEDEI---IVDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKL 128
            +S L LK + K+ M+G+ E +I      P +  E++DDF+   E    +    V   K+
Sbjct: 62  KISALELKPNFKLMMVGSTEADIEDACSLPDNIGEVVDDFDDADEREESVAHSAVYLAKV 121

Query: 129 RRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENPLQLMRPYLHEFLTAAYAEYD 188
           +RR+  YKIK   P REGKKLLVLDIDYTLFDHRS AE   +LMRPYLHEFLT+AY +YD
Sbjct: 122 QRRVRDYKIKELAPPREGKKLLVLDIDYTLFDHRSPAETGTELMRPYLHEFLTSAYEDYD 181

Query: 189 IMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQ 248
           I+IWSATSM+W+E KM  LGV +N NYK+   LD  AMI+V    RG+ D KPLG+IW  
Sbjct: 182 IVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAMISVHVPERGVVDVKPLGVIWAL 241

Query: 249 FPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIAD-L 307
           + + Y+S NTIMFDD+RRNF+MNP++GL I+PFR+AH NR +D EL+KL+ YL  IA   
Sbjct: 242 YKQ-YNSSNTIMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLKLSDYLRKIAHHC 300

Query: 308 DDLSNLDHGRWEFYIEDN 325
            D ++L+H +WE Y    
Sbjct: 301 PDFNSLNHRKWEHYHPKK 318
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Length = 90 Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Length = 95 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Length = 85 Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Length = 181 Back     alignment and structure
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Length = 204 Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Length = 195 Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 92 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1vt4_I APAF-1 related killer DARK; drosophila apoptosome, apoptosis, programmed cell death; HET: DTP; 6.90A {Drosophila melanogaster} PDB: 3iz8_A* Length = 1221 Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Length = 96 Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Length = 88 Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Length = 100 Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Length = 94 Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 100 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 125 Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Length = 81 Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: k.45.1.1 PDB: 3dbr_I 3dbl_I Length = 88 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Length = 90 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 106 Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 101 Back     alignment and structure
>3u5c_F RP14, S2, YS8, 40S ribosomal protein S5; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3izb_F 3o30_D 3o2z_D 3u5g_F 3jyv_G* 2noq_F 1s1h_G 3iz6_F Length = 225 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Length = 159 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 87 Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Length = 86 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 106 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Length = 76 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} Length = 85 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} Length = 85 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Length = 189 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Length = 88 Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Length = 88 Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Length = 368 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Length = 114 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Length = 128 Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Length = 101 Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Length = 88 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Length = 79 Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Length = 111 Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Length = 93 Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Length = 96 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Length = 76 Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Length = 93 Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Length = 98 Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Length = 77 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Length = 76 Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Length = 84 Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Length = 289 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
3shq_A320 UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila 100.0
3qle_A204 TIM50P; chaperone, mitochondrion, preprotein trans 100.0
2ght_A181 Carboxy-terminal domain RNA polymerase II polypept 100.0
2hhl_A195 CTD small phosphatase-like protein; CTD phosphatas 99.96
3ef0_A 372 RNA polymerase II subunit A C-terminal domain phos 99.91
3ef1_A 442 RNA polymerase II subunit A C-terminal domain phos 99.9
1wgg_A96 Ubiquitin carboxyl-terminal hydrolase 14; ubiquiti 99.81
1v5t_A90 8430435I17RIK protein; hypothetical protein, ubiqu 99.79
1v86_A95 DNA segment, CHR 7, wayne state university 128, ex 99.78
2dzm_A100 FAS-associated factor 1; ubiquitin-like domain, HF 99.73
2bwf_A77 Ubiquitin-like protein DSK2; signaling protein, UB 99.69
1wxv_A92 BAG-family molecular chaperone regulator-1; struct 99.68
2kd0_A85 LRR repeats and ubiquitin-like domain-containing p 99.68
3v6c_B91 Ubiquitin; structural genomics, structural genomic 99.67
2lxa_A87 Ubiquitin-like protein MDY2; ubiquitin-like domain 99.66
3plu_A93 Ubiquitin-like modifier HUB1; ubiquitin-like, HUB- 99.65
2kk8_A84 Uncharacterized protein AT4G05270; solution arabid 99.65
1uh6_A100 Ubiquitin-like 5; beta-grAsp fold, structural geno 99.65
3m62_B106 UV excision repair protein RAD23; armadillo-like r 99.64
3dbh_I88 NEDD8; cell cycle, activating enzyme, apoptosis, m 99.64
2dzi_A81 Ubiquitin-like protein 4A; GDX, structural genomic 99.63
3m63_B101 Ubiquitin domain-containing protein DSK2; armadill 99.63
4a20_A98 Ubiquitin-like protein MDY2; protein binding, GET- 99.63
4hcn_B98 Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidas 99.62
1wx7_A106 Ubiquilin 3; ubiquitin-like domain, structural gen 99.62
2wyq_A85 HHR23A, UV excision repair protein RAD23 homolog A 99.62
1wx8_A96 Riken cDNA 4931431F19; ubiquitin-like domain, ubiq 99.61
1j8c_A125 Ubiquitin-like protein hplic-2; ubiquitin-like dom 99.61
3phx_B79 Ubiquitin-like protein ISG15; OTU domain, DE-ubiqu 99.61
1uel_A95 HHR23B, UV excision repair protein RAD23 homolog B 99.6
1ttn_A106 DC-UBP, dendritic cell-derived ubiquitin-like prot 99.6
4fbj_B88 NEDD8; effector-HOST target complex, glutamine dea 99.6
4eew_A88 Large proline-rich protein BAG6; ubiquitin-like fo 99.6
2kan_A94 Uncharacterized protein AR3433A; ubiquitin fold, a 99.59
2hj8_A88 Interferon-induced 17 kDa protein; HR2873B, human 99.59
2l7r_A93 Ubiquitin-like protein FUBI; structural genomics, 99.58
2klc_A101 Ubiquilin-1; ubiquitin-like, structural genomics, 99.58
1v5o_A102 1700011N24RIK protein; hypothetical protein, ubiqu 99.58
1wh3_A87 59 kDa 2'-5'-oligoadenylate synthetase like protei 99.58
4dwf_A90 HLA-B-associated transcript 3; ubiquitin-like doma 99.57
2fnj_B118 Transcription elongation factor B polypeptide 2; b 99.57
1yqb_A100 Ubiquilin 3; structural genomics consortium, ubiqu 99.57
1wju_A100 NEDD8 ultimate buster-1; ubiquitin-like domain, st 99.57
3vdz_A111 Ubiquitin-40S ribosomal protein S27A; gadolinium, 99.56
1sif_A88 Ubiquitin; hydrophobic mutants, folding, stability 99.55
3mtn_B85 UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquit 99.55
1x1m_A107 Ubiquitin-like protein SB132; structural genomics, 99.55
3n3k_B85 Ubiquitin; hydrolase, protease, thiol protease, DU 99.55
1ndd_A76 NEDD8, protein (ubiquitin-like protein NEDD8); pro 99.55
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.55
1wgd_A93 Homocysteine-responsive endoplasmic reticulum- res 99.55
2faz_A78 Ubiquitin-like containing PHD and ring finger DOM 99.55
1wy8_A89 NP95-like ring finger protein, isoform A; ubiquiti 99.54
3a9j_A76 Ubiquitin; protein complex, cytoplasm, isopeptide 99.54
4ajy_B118 Transcription elongation factor B polypeptide 2; E 99.54
2daf_A118 FLJ35834 protein; hypothetical protein FLJ35834, u 99.52
3k9o_B96 Ubiquitin, UBB+1; E2-25K, complex structure, ATP-b 99.52
1yx5_B98 Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo s 99.51
2ojr_A111 Ubiquitin; lanthide-binding TAG, terbium, TB, SAD 99.5
1v6e_A95 Cytoskeleton-associated protein 1; tubulin-specifi 99.49
2kdi_A114 Ubiquitin, vacuolar protein sorting-associated pro 99.48
2gow_A125 HCG-1 protein, ubiquitin-like protein 3; BC059385, 99.47
1wgh_A116 Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fo 99.47
2uyz_B79 Small ubiquitin-related modifier 1; sumoylation, c 99.46
2kdb_A99 Homocysteine-responsive endoplasmic reticulum- res 99.46
1we6_A111 Splicing factor, putative; structural genomics, ub 99.46
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.46
2kjr_A95 CG11242; UBL, ubiquitin, ubiquitin-like, structura 99.45
1wia_A95 Hypothetical ubiquitin-like protein (riken cDNA 20 99.45
3b1l_X76 E3 ubiquitin-protein ligase parkin; proteasome, AL 99.17
1v2y_A105 3300001G02RIK protein; hypothetical protein, ubiqu 99.44
1wyw_B97 Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Ho 99.44
2dzj_A88 Synaptic glycoprotein SC2; ubiquitin-like fold, st 99.43
3l0w_B169 Monoubiquitinated proliferating cell nuclear antig 99.41
3q3f_A189 Ribonuclease/ubiquitin chimeric protein; domain SW 99.4
2kj6_A97 Tubulin folding cofactor B; methods development, N 99.4
1we7_A115 SF3A1 protein; structural genomics, ubiquitin-like 99.4
4b6w_A86 Tubulin-specific chaperone; CAP-Gly, ubiquitin-lik 99.4
4dbg_A105 Ranbp-type and C3HC4-type zinc finger-containing; 99.4
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.39
3rt3_B159 Ubiquitin-like protein ISG15; ubiquitin-like domai 99.39
1t0y_A122 Tubulin folding cofactor B; ubiquitin-like, cytosk 99.37
3u5e_m128 60S ribosomal protein L40; translation, ribosome, 99.37
2kzr_A86 Ubiquitin thioesterase OTU1; structural genomics, 99.34
3b08_A152 Polyubiquitin-C, ubiquitin; protein complex, signa 99.31
3u5c_f152 40S ribosomal protein S31; translation, ribosome, 99.31
3u30_A172 Ubiquitin, linear DI-ubiquitin; immune system; 2.4 99.3
1se9_A126 Ubiquitin family; ubiquitin-like, cell-free, wheat 99.29
1wf9_A107 NPL4 family protein; beta-grAsp fold like domain, 99.28
3ai5_A307 Yeast enhanced green fluorescent protein, ubiquit; 99.27
1oqy_A368 HHR23A, UV excision repair protein RAD23 homolog A 99.26
1wjn_A97 Tubulin-folding protein TBCE; ubiquitin-like domai 99.06
2xzm_9189 RPS31E; ribosome, translation; 3.93A {Tetrahymena 98.99
2io1_B94 Small ubiquitin-related modifier 3 precursor; SUMO 98.88
3a4r_A79 Nfatc2-interacting protein; ubiquitin fold, coiled 98.88
2io0_B91 Small ubiquitin-related modifier 2 precursor; SUMO 98.8
1wm3_A72 Ubiquitin-like protein SMT3B; ubiquitin fold, half 98.8
2d07_B93 Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Ho 98.73
1wz0_A104 Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-li 98.69
3kbb_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.65
2eke_C106 Ubiquitin-like protein SMT3; UBC9, SUMO binding mo 98.65
2k8h_A110 Small ubiquitin protein; SUMO, post-translational 98.64
2wm8_A187 MDP-1, magnesium-dependent phosphatase 1; haloacid 98.63
2fpr_A176 Histidine biosynthesis bifunctional protein HISB; 98.61
2pjh_A80 Protein NPL4, nuclear protein localization protein 98.58
2pr7_A137 Haloacid dehalogenase/epoxide hydrolase family; NP 98.55
3l8h_A179 Putative haloacid dehalogenase-like hydrolase; HAD 98.53
3ib6_A189 Uncharacterized protein; structural genomics, unkn 98.51
4g9b_A243 Beta-PGM, beta-phosphoglucomutase; HAD, putative p 98.44
3kzx_A231 HAD-superfamily hydrolase, subfamily IA, variant; 98.44
1nnl_A225 L-3-phosphoserine phosphatase; PSP, HPSP, phospho- 98.37
2ah5_A210 COG0546: predicted phosphatases; MCSG, structural 98.36
4gib_A250 Beta-phosphoglucomutase; rossmann fold, HAD-like, 98.35
2oda_A196 Hypothetical protein pspto_2114; haloacid dehaloge 98.35
3m9l_A205 Hydrolase, haloacid dehalogenase-like family; HAD 98.33
2gmw_A211 D,D-heptose 1,7-bisphosphate phosphatase; Zn-bindi 98.32
3e58_A214 Putative beta-phosphoglucomutase; structu genomics 98.3
2p9j_A162 Hypothetical protein AQ2171; secsg, riken, PSI, st 98.29
4efo_A94 Serine/threonine-protein kinase TBK1; ubiquitin li 98.26
3m1y_A217 Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, 98.25
2pib_A216 Phosphorylated carbohydrates phosphatase TM_1254; 98.23
3umb_A233 Dehalogenase-like hydrolase; 2.20A {Ralstonia sola 98.23
2no4_A240 (S)-2-haloacid dehalogenase IVA; HAD superfamily, 98.21
4ex6_A237 ALNB; modified rossman fold, phosphatase, magnesiu 98.2
2i6x_A211 Hydrolase, haloacid dehalogenase-like family; HAD 98.2
3um9_A230 Haloacid dehalogenase, type II; haloacid dehalogen 98.19
3mc1_A226 Predicted phosphatase, HAD family; PSI2, NYSGXRC, 98.19
3kd3_A219 Phosphoserine phosphohydrolase-like protein; csgid 98.18
3nuq_A282 Protein SSM1, putative nucleotide phosphatase; sup 98.17
1zrn_A232 L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseud 98.17
4eze_A317 Haloacid dehalogenase-like hydrolase; magnesium bi 98.15
3qxg_A243 Inorganic pyrophosphatase; hydrolase, magnesium bi 98.14
3s6j_A233 Hydrolase, haloacid dehalogenase-like family; stru 98.13
3ed5_A238 YFNB; APC60080, bacillus subtilis subsp. subtilis 98.13
3sd7_A240 Putative phosphatase; structural genomics, haloaci 98.11
2hdo_A209 Phosphoglycolate phosphatase; NP_784602.1, structu 98.1
4dcc_A229 Putative haloacid dehalogenase-like hydrolase; mag 98.1
3fvv_A232 Uncharacterized protein; unknown function, structu 98.1
3zvl_A 416 Bifunctional polynucleotide phosphatase/kinase; hy 98.09
3cnh_A200 Hydrolase family protein; NP_295428.1, predicted h 98.09
3kyd_D115 Small ubiquitin-related modifier 1; SUMO, thioeste 98.09
2nyv_A222 Pgpase, PGP, phosphoglycolate phosphatase; structu 98.09
2w43_A201 Hypothetical 2-haloalkanoic acid dehalogenase; hyd 98.08
3n1u_A191 Hydrolase, HAD superfamily, subfamily III A; struc 98.06
2hsz_A243 Novel predicted phosphatase; structural genomics, 98.05
1qq5_A253 Protein (L-2-haloacid dehalogenase); hydrolase; 1. 98.03
3pge_A200 SUMO-modified proliferating cell nuclear antigen; 98.02
2zg6_A220 Putative uncharacterized protein ST2620, probable 98.02
3qnm_A240 Haloacid dehalogenase-like hydrolase; structural g 98.01
3e8m_A164 Acylneuraminate cytidylyltransferase; 2-keto-3-deo 98.0
3n07_A195 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 97.97
3dv9_A247 Beta-phosphoglucomutase; structural genomics, APC6 97.97
4eek_A259 Beta-phosphoglucomutase-related protein; hydrolase 97.96
2o2x_A218 Hypothetical protein; structural genomics, joint c 97.96
3p96_A415 Phosphoserine phosphatase SERB; ssgcid, structural 97.95
2hoq_A241 Putative HAD-hydrolase PH1655; haloacid dehalogena 97.95
3tix_A207 Ubiquitin-like protein SMT3, RNA-induced transcri 97.94
2p11_A231 Hypothetical protein; putative haloacid dehalogena 97.92
1k1e_A180 Deoxy-D-mannose-octulosonate 8-phosphate phosphat; 97.92
3u26_A234 PF00702 domain protein; structural genomics, PSI-b 97.91
3l5k_A250 Protein GS1, haloacid dehalogenase-like hydrolase 97.91
3d6j_A225 Putative haloacid dehalogenase-like hydrolase; str 97.9
2fi1_A190 Hydrolase, haloacid dehalogenase-like family; stru 97.88
1rku_A206 Homoserine kinase; phosphoserine phosphatase, phos 97.88
3k1z_A263 Haloacid dehalogenase-like hydrolase domain-conta 97.87
3ij5_A211 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; 97.86
3umc_A254 Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeru 97.85
3iru_A277 Phoshonoacetaldehyde hydrolase like protein; phosp 97.85
3nas_A233 Beta-PGM, beta-phosphoglucomutase; PSI, structural 97.85
2hcf_A234 Hydrolase, haloacid dehalogenase-like family; NP_6 97.84
3mn1_A189 Probable YRBI family phosphatase; structural genom 97.84
3ddh_A234 Putative haloacid dehalogenase-like family hydrol; 97.83
3smv_A240 S-(-)-azetidine-2-carboxylate hydrolase; haloacid 97.8
2b0c_A206 Putative phosphatase; alpha-D-glucose-1-phosphate, 97.8
3umg_A254 Haloacid dehalogenase; defluorinase, hydrolase; 2. 97.79
3nvb_A387 Uncharacterized protein; protein FKBH, protein fkb 97.77
1te2_A226 Putative phosphatase; structural genomics, phospha 97.76
2fea_A236 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 97.75
1q92_A197 5(3)-deoxyribonucleotidase; alpha-beta rossman fol 97.74
2r8e_A188 3-deoxy-D-manno-octulosonate 8-phosphate phosphata 97.72
2g80_A253 Protein UTR4; YEL038W, UTR4 protein (unknown trans 97.71
2qlt_A275 (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, sac 97.71
3bwv_A180 Putative 5'(3')-deoxyribonucleotidase; NP_764060.1 97.67
4ap9_A201 Phosphoserine phosphatase; hydrolase, haloacid deh 97.67
3mmz_A176 Putative HAD family hydrolase; structural genomics 97.65
2go7_A207 Hydrolase, haloacid dehalogenase-like family; stru 97.61
2jxx_A97 Nfatc2-interacting protein; nuclear factor of acti 97.59
2wf7_A221 Beta-PGM, beta-phosphoglucomutase; transition stat 97.57
2i7d_A193 5'(3')-deoxyribonucleotidase, cytosolic type; hydr 97.53
3skx_A280 Copper-exporting P-type ATPase B; P1B-ATPase, ATP 97.53
2pke_A251 Haloacid delahogenase-like family hydrolase; NP_63 97.52
3vay_A230 HAD-superfamily hydrolase; rossmann fold, haloacid 97.5
2b82_A211 APHA, class B acid phosphatase; DDDD acid phosphat 97.49
2i33_A258 Acid phosphatase; HAD superfamily, hydrolase; 1.57 97.49
1l7m_A211 Phosphoserine phosphatase; rossmann fold, four-hel 97.48
2fdr_A229 Conserved hypothetical protein; SAD, structural ge 97.44
2bps_A81 YUKD protein; ubiquitin-like protein, ubiquitin; 2 97.36
1swv_A267 Phosphonoacetaldehyde hydrolase; HAD enzyme superf 97.33
3n28_A335 Phosphoserine phosphatase; HAD family hydrolase, s 97.28
2l76_A95 Nfatc2-interacting protein; ubiquitin-like domain, 97.27
3v7o_A227 Minor nucleoprotein VP30; ssgcid, seattle structur 97.26
3i28_A 555 Epoxide hydrolase 2; aromatic hydrocarbons catabol 97.21
3goe_A82 DNA repair protein RAD60; SUMO-like domain, sumoyl 97.16
2kc2_A128 Talin-1, F1; FERM, adhesion, cell membrane, cell p 97.07
2obb_A142 Hypothetical protein; structural genomics, PSI-2, 96.99
3ocu_A262 Lipoprotein E; hydrolase, outer membrane; HET: NMN 96.9
3uf8_A209 Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- 96.89
3pct_A260 Class C acid phosphatase; hydrolase, outer membran 96.81
2al3_A90 TUG long isoform; TUG UBL1 insulin, endocytosis/ex 96.8
3ix6_A360 TS, tsase, thymidylate synthase; niaid, ssgcid, se 96.66
3qx1_A84 FAS-associated factor 1; UBX, protein binding, P97 96.65
3epr_A264 Hydrolase, haloacid dehalogenase-like family; stru 96.62
3qgm_A268 P-nitrophenyl phosphatase (PHO2); structural genom 96.56
3ewi_A168 N-acylneuraminate cytidylyltransferase; beta barre 96.55
1wr8_A231 Phosphoglycolate phosphatase; alpha / beta core do 96.54
3mpo_A279 Predicted hydrolase of the HAD superfamily; SGX, P 96.47
4dw8_A279 Haloacid dehalogenase-like hydrolase; HAD, putativ 96.42
1xpj_A126 Hypothetical protein; structural genomics, MCSG, p 96.41
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 96.36
3pgv_A285 Haloacid dehalogenase-like hydrolase; structural g 96.34
2dzk_A109 UBX domain-containing protein 2; ubiquitin-like fo 96.33
4da1_A389 Protein phosphatase 1K, mitochondrial; metal-ION-a 96.27
3gyg_A289 NTD biosynthesis operon putative hydrolase NTDB; P 96.27
1l6r_A227 Hypothetical protein TA0175; structural genomics, 96.26
3dnp_A 290 Stress response protein YHAX; structural PSI-2, pr 96.19
1xvi_A275 MPGP, YEDP, putative mannosyl-3-phosphoglycerate p 96.19
1nrw_A 288 Hypothetical protein, haloacid dehalogenase-like h 96.18
2pq0_A258 Hypothetical conserved protein GK1056; hyopthetica 96.17
3a1c_A287 Probable copper-exporting P-type ATPase A; ATP-bin 96.15
3dao_A283 Putative phosphatse; structural genomics, joint ce 96.08
1vjr_A271 4-nitrophenylphosphatase; TM1742, structural genom 96.07
3pdw_A266 Uncharacterized hydrolase YUTF; structural genomic 96.07
1rkq_A282 Hypothetical protein YIDA; two domain structure wi 96.03
2daj_A91 KIAA0977 protein, COBL-like 1; ubiquitin-like doma 95.97
3kc2_A 352 Uncharacterized protein YKR070W; HAD-like, mitocho 95.92
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 95.91
3fzq_A274 Putative hydrolase; YP_001086940.1, putative haloa 95.88
2hx1_A284 Predicted sugar phosphatases of the HAD superfamil 95.83
1zjj_A263 Hypothetical protein PH1952; alpha/beta hydrolase 95.7
2zos_A249 MPGP, mannosyl-3-phosphoglycerate phosphatase; hal 95.67
1nf2_A268 Phosphatase; structural proteomics, HAD NEW fold, 95.66
2x4d_A271 HLHPP, phospholysine phosphohistidine inorganic py 95.65
2ho4_A259 Haloacid dehalogenase-like hydrolase domain contai 95.62
2oyc_A 306 PLP phosphatase, pyridoxal phosphate phosphatase; 95.61
1qyi_A384 ZR25, hypothetical protein; structural genomics, P 95.56
1ltq_A301 Polynucleotide kinase; phosphatase, alpha/beta, P- 95.54
2b30_A301 Pvivax hypothetical protein; SGPP, structural geno 95.53
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 95.48
2c4n_A250 Protein NAGD; nucleotide phosphatase, HAD superfam 95.34
2rbk_A261 Putative uncharacterized protein; HAD-like phospha 95.17
3f9r_A246 Phosphomannomutase; trypanosome glycobiology struc 95.16
1yv9_A264 Hydrolase, haloacid dehalogenase family; hypotheti 94.92
3l7y_A304 Putative uncharacterized protein SMU.1108C; hydrol 94.92
1s2o_A244 SPP, sucrose-phosphatase; phosphohydrolase, HAD su 94.92
2amy_A246 PMM 2, phosphomannomutase 2; HS.459855, HS.313504, 94.75
2fue_A262 PMM 1, PMMH-22, phosphomannomutase 1; enzyme-produ 94.68
1rlm_A271 Phosphatase; HAD family, rossman fold, hydrolase; 94.67
3r4c_A268 Hydrolase, haloacid dehalogenase-like hydrolase; h 94.64
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 94.58
1wj4_A124 KIAA0794 protein; UBX domain, beta-grAsp fold, str 94.47
1u02_A239 Trehalose-6-phosphate phosphatase related protein; 94.42
4fe3_A297 Cytosolic 5'-nucleotidase 3; substrate complex, HA 94.26
1ip9_A85 BEM1 protein; ubiquitin alpha/beta roll, signaling 93.9
1oey_A83 P67-PHOX, neutrophil cytosol factor 2; immune syst 93.51
3zx4_A259 MPGP, mannosyl-3-phosphoglycerate phosphatase; hyd 93.33
1ryj_A70 Unknown; beta/alpha protein, structural genomics, 92.0
1vd2_A89 Protein kinase C, IOTA type; PB1 domain, OPCA moti 91.65
2l32_A74 Small archaeal modifier protein 2; protein BIN; NM 91.23
2cr5_A109 Reproduction 8; UBX domain, D0H8S2298E protein, st 90.7
4a3p_A217 Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {H 90.57
3jyu_A231 Ubiquitin carboxyl-terminal hydrolase; domain in u 90.44
2hi0_A240 Putative phosphoglycolate phosphatase; YP_619066.1 89.1
4eut_A396 Serine/threonine-protein kinase TBK1; ATP binding, 87.52
2om6_A235 Probable phosphoserine phosphatase; rossmann fold, 87.33
4as2_A327 Phosphorylcholine phosphatase; hydrolase, HAD supe 87.09
1s3s_G127 P47 protein; AAA ATPase, protein-protein complex, 86.18
2gfh_A260 Haloacid dehalogenase-like hydrolase domain conta; 86.15
2kvr_A130 Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubi 85.59
1tyg_B87 YJBS; alpha beta barrel, protein-protein complex, 84.41
3ivf_A371 Talin-1; FERM domain, cell membrane, cell projecti 83.0
2yj3_A263 Copper-transporting ATPase; hydrolase, P-type ATPa 83.52
1y8a_A332 Hypothetical protein AF1437; structural genomics, 82.86
1yns_A261 E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo 81.75
>3shq_A UBLCP1; phosphatase, hydrolase; 1.96A {Drosophila melanogaster} Back     alignment and structure
Probab=100.00  E-value=4.8e-78  Score=571.66  Aligned_cols=314  Identities=52%  Similarity=0.864  Sum_probs=278.6

Q ss_pred             CCceEEEEEEeCCeEEEEEecCCCCHHHHHHHHHHHhCCCCCCceEeeccCCCcccCcccccccCCCCCCceEEEEecCC
Q 042485           12 SSEELTLTVKWSGKEYTVRVCGDDSVAELKRRICELTNVLPKRQKLLYPKIGNKLADDTVLLSQLPLKSSLKMTMIGTVE   91 (332)
Q Consensus        12 ~~~~i~i~vk~~g~~~~i~v~~~~tV~~LK~~I~~~tgvp~~~QkLl~~k~~gk~l~d~~~L~~~~i~~g~~l~l~gs~~   91 (332)
                      ..++|+|+|||+|++|+|++++++||++||++|+++|||||++|||+++|++|++++|+.+|+++||++|++||||||++
T Consensus         2 ~~~~i~i~Vk~~g~~~~v~v~~~~Tv~~lK~~I~~~tgVpp~~QkLi~~k~~Gk~l~D~~~L~~~~ik~g~~l~L~gs~~   81 (320)
T 3shq_A            2 EVKEVVVIVKWSGKEYPVDLTDQDTVEVLRHEIFRKTQVRPERQKLLNLKYKGKTAADNVKISALELKPNFKLMMVGSTE   81 (320)
T ss_dssp             --CEEEEEEEETTEEEEEEEETTSBHHHHHHHHHHHHCCCGGGCEETTCBSSSSBCCTTSBTTSSCCC--CEEEEECCCC
T ss_pred             CCceEEEEEEECCEEEEEEECCCCcHHHHHHHHHHHHCcCHHHeEEeecccCCcccCccccHHHcCCCCCCEEEEEccch
Confidence            45689999999999999999999999999999999999999999999544479999999999999999999999999999


Q ss_pred             Cccc---cCCCCCCccccccccchhhhhhhhhhhhhHHHHHhhhhhhcccccCCCcCCcceEEEecCCceEeccCCCCCC
Q 042485           92 DEII---VDPVDSPEIIDDFELGQEEAVDIKDKEVNKQKLRRRLSQYKIKLRNPSREGKKLLVLDIDYTLFDHRSTAENP  168 (332)
Q Consensus        92 ~~~~---~~~~~~~~~~~d~~~~~~~~~~i~~~~~n~~k~~~~v~~~~~~~l~~~~~~kk~LVLDLD~TLi~~~~~~~~~  168 (332)
                      +++.   .+|++.++|+|||+.+.++..++++.+.|++++++|++.+.++.++||+++|++|||||||||||+.....++
T Consensus        82 ~~i~~~~~~p~~~~~~~eD~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~~p~~~~k~tLVLDLDeTLvh~~~~~~~~  161 (320)
T 3shq_A           82 ADIEDACSLPDNIGEVVDDFDDADEREESVAHSAVYLAKVQRRVRDYKIKELAPPREGKKLLVLDIDYTLFDHRSPAETG  161 (320)
T ss_dssp             ----------CCCSCCCCTTCCCCC--CCSTTSHHHHHHHHHHHHHCCCCCSSCCCTTCEEEEECCBTTTBCSSSCCSSH
T ss_pred             hhhcccccCCCcCCcccccCCCcccchhhhhhhhhhHHHHHHHHHhcCCCcCCCCcCCCcEEEEeccccEEcccccCCCc
Confidence            9887   6788899999999987777899999999999999999999999999999999999999999999998877778


Q ss_pred             ceecCCcHHHHHHHHHhCCcEEEEcCCcHHHHHHHHHHhCCCCCCCceEEEEecCCceEEEeeCCCCCcccccccccccc
Q 042485          169 LQLMRPYLHEFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIFDCKPLGLIWDQ  248 (332)
Q Consensus       169 ~~~~RP~l~eFL~~l~~~yeivI~Tas~~~ya~~~l~~l~~~~~~~~~~~~~~d~~~~~~~~~~~~g~~~~KdL~~i~~~  248 (332)
                      ++++|||+++||++|+++|+|+||||+.+.||+++++.|+....+.+++.+++++.+++++....+|..++|||+.+|++
T Consensus       162 ~~~~RP~l~eFL~~l~~~yeivIfTas~~~ya~~vld~Ld~~~~~~~~~~~~r~~~~~~~~~~~~~g~~~vKdLs~Lw~~  241 (320)
T 3shq_A          162 TELMRPYLHEFLTSAYEDYDIVIWSATSMRWIEEKMRLLGVASNDNYKVMFYLDSTAMISVHVPERGVVDVKPLGVIWAL  241 (320)
T ss_dssp             HHHBCTTHHHHHHHHHHHEEEEEECSSCHHHHHHHHHHTTCTTCSSCCCCEEECGGGCEEEEETTTEEEEECCHHHHHHH
T ss_pred             ceEeCCCHHHHHHHHHhCCEEEEEcCCcHHHHHHHHHHhCCCCCcceeEEEEEcCCccccccccCCCCEEEEEhHHhhcc
Confidence            89999999999999999999999999999999999999988766667777777776667776777787799999999999


Q ss_pred             CCCcCCCCcEEEEeCCccccccCCCCeeeeccccCCcCCCCCchHHHHHHHHHHhcc-CCCCchhHhHhhHHHhhhhhh
Q 042485          249 FPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKLTQYLLAIA-DLDDLSNLDHGRWEFYIEDNT  326 (332)
Q Consensus       249 ~~~~~~~~~~iivDD~~~~~~~~p~Ngi~I~~f~~~~~~~~~D~~L~~L~~~L~~l~-~~~Dvr~~~~~~w~~~~~~~~  326 (332)
                      ||+ |++++||+|||+|.+|.+||+|||+|.+|++++.++.+|++|..|++||+.|+ .++|||+++|++|++|++++.
T Consensus       242 ~p~-rdl~~tIiIDdsp~~~~~~p~NgI~I~~~~~~~~~~~~D~eL~~L~~~L~~L~~~~~DVr~~~~~~w~~~~~~~~  319 (320)
T 3shq_A          242 YKQ-YNSSNTIMFDDIRRNFLMNPKSGLKIRPFRQAHLNRGTDTELLKLSDYLRKIAHHCPDFNSLNHRKWEHYHPKKN  319 (320)
T ss_dssp             CTT-CCGGGEEEEESCGGGGTTSGGGEEECCCCCCHHHHTTTCCHHHHHHHHHHHHHHHCSCGGGCCGGGGGGCCC---
T ss_pred             cCC-CChhHEEEEeCChHHhccCcCceEEeCeEcCCCCCCCccHHHHHHHHHHHHHhccCcchhHHHHHHHHHhhhhhc
Confidence            999 59999999999999999999999999999986545578999999999999999 999999999999999998864
>3qle_A TIM50P; chaperone, mitochondrion, preprotein translocation; HET: 1PE; 1.83A {Saccharomyces cerevisiae EC1118} Back     alignment and structure
>2ght_A Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1; protein-peptide complex, HAD superfamily, hydrolase; HET: SEP; 1.80A {Homo sapiens} PDB: 2ghq_A* 3pgl_A* 1t9z_A* 1ta0_A* 3l0c_A 3l0y_A 3l0b_A* 2q5e_A Back     alignment and structure
>2hhl_A CTD small phosphatase-like protein; CTD phosphatase, keggins anion, structural genomics, PSI, protein structure initiative; HET: KEG; 2.10A {Homo sapiens} Back     alignment and structure
>3ef0_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, ALF4, transition state analog, cobalt, magnesium; 2.10A {Schizosaccharomyces pombe} Back     alignment and structure
>3ef1_A RNA polymerase II subunit A C-terminal domain phosphatase; CTD, FCPH, BRCT, hydrolase, BEF3, acylphosphate analog, cobalt, magnesium; HET: BFD; 2.15A {Schizosaccharomyces pombe} Back     alignment and structure
>1wgg_A Ubiquitin carboxyl-terminal hydrolase 14; ubiquitin specific protease 14, USP14, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1v5t_A 8430435I17RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 2kx3_A Back     alignment and structure
>1v86_A DNA segment, CHR 7, wayne state university 128, expressed; ubiquitin fold, structural genomics, D7WSU128E protein; HET: DNA; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2dzm_A FAS-associated factor 1; ubiquitin-like domain, HFAF1, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>2bwf_A Ubiquitin-like protein DSK2; signaling protein, UBA, signaling proteins; 1.15A {Saccharomyces cerevisiae} SCOP: d.15.1.1 PDB: 2bwe_S Back     alignment and structure
>1wxv_A BAG-family molecular chaperone regulator-1; structural genomics, apoptosis, riken structural genomics/proteomics initiative, RSGI, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2kd0_A LRR repeats and ubiquitin-like domain-containing protein AT2G30105; ubiquitin-like protein, NESG, leucine-rich repeat, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>3v6c_B Ubiquitin; structural genomics, structural genomics consortium, SGC, UB protease, hydrolase-signaling protein complex; 1.70A {Homo sapiens} PDB: 3v6e_B Back     alignment and structure
>2lxa_A Ubiquitin-like protein MDY2; ubiquitin-like domain, protein-protein interaction, SGT2 BIN domain, GET pathway, protein binding; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>3plu_A Ubiquitin-like modifier HUB1; ubiquitin-like, HUB-1, SNU66, peptide binding protein; 1.40A {Saccharomyces cerevisiae} PDB: 3plv_A 1m94_A 1p0r_A Back     alignment and structure
>2kk8_A Uncharacterized protein AT4G05270; solution arabidopsis thaliana, uncharacterized putative protein, NESG, structural genomics; NMR {Arabidopsis thaliana} Back     alignment and structure
>1uh6_A Ubiquitin-like 5; beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3m62_B UV excision repair protein RAD23; armadillo-like repeats, UBL conjugation pathway, DNA damage, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>3dbh_I NEDD8; cell cycle, activating enzyme, apoptosis, membrane, UBL conjugation pathway, ATP-binding, ligase, nucleotide- binding, polymorphism; 2.85A {Homo sapiens} SCOP: d.15.1.1 PDB: 3dbr_I 3dbl_I Back     alignment and structure
>2dzi_A Ubiquitin-like protein 4A; GDX, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3m63_B Ubiquitin domain-containing protein DSK2; armadillo-like repeats, UBL conjugation pathway, nucleus, phosphoprotein; HET: 1PE; 2.40A {Saccharomyces cerevisiae} Back     alignment and structure
>4a20_A Ubiquitin-like protein MDY2; protein binding, GET-pathway, tail-anchored proteins; 1.78A {Saccharomyces cerevisiae} PDB: 2lxc_A 4goc_A Back     alignment and structure
>4hcn_B Polyubiquitin, ubiquitin; ubiquitin/NEDD8 deamidase, NEDD8, protein binding; 2.60A {Saccharomyces cerevisiae} Back     alignment and structure
>1wx7_A Ubiquilin 3; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2wyq_A HHR23A, UV excision repair protein RAD23 homolog A; DNA binding protein, DNA excision repair, proteasomal degrad polyubiquitin; 1.65A {Homo sapiens} PDB: 1p98_A 1p9d_U 1p1a_A Back     alignment and structure
>1wx8_A Riken cDNA 4931431F19; ubiquitin-like domain, ubiquilin 1-like, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1j8c_A Ubiquitin-like protein hplic-2; ubiquitin-like domain, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3phx_B Ubiquitin-like protein ISG15; OTU domain, DE-ubiquitinase, DE-isgylase, hydrolase-protein complex; 1.60A {Homo sapiens} Back     alignment and structure
>1uel_A HHR23B, UV excision repair protein RAD23 homolog B; UBL, UIM, riken structural genomics/proteomics initiative, RSGI, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ttn_A DC-UBP, dendritic cell-derived ubiquitin-like protein; ubiquitin-like domain, solution structure, signaling protein; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4fbj_B NEDD8; effector-HOST target complex, glutamine deamidase, deamidati bacterial effector, cell cycle-protein binding complex; 1.60A {Homo sapiens} PDB: 4f8c_B Back     alignment and structure
>4eew_A Large proline-rich protein BAG6; ubiquitin-like fold, GP78-binding, chaperone; 1.30A {Homo sapiens} Back     alignment and structure
>2kan_A Uncharacterized protein AR3433A; ubiquitin fold, alpha+beta, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>2hj8_A Interferon-induced 17 kDa protein; HR2873B, human ISG15, structure, northeast structural genomics consortium, protein structure initiative, NESG; NMR {Homo sapiens} Back     alignment and structure
>2l7r_A Ubiquitin-like protein FUBI; structural genomics, PSI-biology, protein structure initiati northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>2klc_A Ubiquilin-1; ubiquitin-like, structural genomics, PSI-2, protein structur initiative, northeast structural genomics consortium, NESG; NMR {Homo sapiens} Back     alignment and structure
>1v5o_A 1700011N24RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wh3_A 59 kDa 2'-5'-oligoadenylate synthetase like protein; P59 OASL, ubiquitin family, structural genomics; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>4dwf_A HLA-B-associated transcript 3; ubiquitin-like domain, BAT3 protein, PF00240, structural GEN joint center for structural genomics, JCSG; 1.80A {Homo sapiens} PDB: 1wx9_A Back     alignment and structure
>2fnj_B Transcription elongation factor B polypeptide 2; beta-sandwich, lectin-like, SPRY, protein transport/signaling protein complex; 1.80A {Mus musculus} SCOP: d.15.1.1 PDB: 1lm8_B 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A Back     alignment and structure
>1yqb_A Ubiquilin 3; structural genomics consortium, ubiquitin, ubiquitin-like domain, structural genomics, signaling protein SGC; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wju_A NEDD8 ultimate buster-1; ubiquitin-like domain, structural genomics, riken structural genomics/proteomics initiative, RSGI, protein binding; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3vdz_A Ubiquitin-40S ribosomal protein S27A; gadolinium, MRI contrast agent, peptide-based contrast agent lanthanide binding TAG; 2.40A {Synthetic construct} PDB: 2ojr_A Back     alignment and structure
>1sif_A Ubiquitin; hydrophobic mutants, folding, stability, structural protein; 2.18A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3mtn_B UBA80, ubcep1, ubiquitin variant UBV.21.4; ubiquitin-specific protease activity, hydrolase, ubiquitin B structural genomics consortium, SGC; 2.70A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1x1m_A Ubiquitin-like protein SB132; structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3n3k_B Ubiquitin; hydrolase, protease, thiol protease, DUB, zinc ribbon, inhibitor, ubiqu acetylation, cytoplasm, isopeptide bond, nucleus; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1ndd_A NEDD8, protein (ubiquitin-like protein NEDD8); proteolysis, signaling protei; 1.60A {Homo sapiens} SCOP: d.15.1.1 PDB: 1r4m_I 1r4n_I* 1xt9_B 2ko3_A 3gzn_I* 2bkr_B 2nvu_I* 3dqv_A 1bt0_A Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1wgd_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; ENDPLASMIC reticulum stress, UBL domain; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2faz_A Ubiquitin-like containing PHD and ring finger DOM protein 1; cell cycle, DNA damage, DNA repair, DNA-binding, ligase, Met binding, nuclear protein; 2.00A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wy8_A NP95-like ring finger protein, isoform A; ubiquitin-like domain, NP95/ICBP90-like ring finger (NIRF), ubiquitin ligase, structural genomics, NPPSFA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a9j_A Ubiquitin; protein complex, cytoplasm, isopeptide bond, metal-binding, zinc; 1.18A {Mus musculus} PDB: 3a1q_B 2znv_B 3a9k_A 3h7p_A 3jsv_A 3dvg_Y 3dvn_Y 3nob_A 2o6v_D* 3jw0_X 3jvz_X 3nhe_B* 1aar_A 1d3z_A 1f9j_A 1fxt_B 1g6j_A 1nbf_C 1cmx_B 1q5w_B ... Back     alignment and structure
>4ajy_B Transcription elongation factor B polypeptide 2; E3 ubiquitin ligase, transcription factor, hypoxic signaling transcription; 1.73A {Homo sapiens} PDB: 1lqb_A 1vcb_A 2c9w_B 2izv_B 2jz3_B 2xai_C 3dcg_A 3zrc_A* 3zrf_A 3ztc_A* 3ztd_A* 3zun_A* 1lm8_B 4b95_A* 2fnj_B 4b9k_A* 4awj_A* Back     alignment and structure
>2daf_A FLJ35834 protein; hypothetical protein FLJ35834, ubiquitin-like domain, structural genomics, NPPSFA; NMR {Homo sapiens} Back     alignment and structure
>3k9o_B Ubiquitin, UBB+1; E2-25K, complex structure, ATP-binding, isopeptide BO ligase, nucleotide-binding, UBL conjugation pathway; 1.80A {Homo sapiens} PDB: 2k25_A 2kx0_A Back     alignment and structure
>1yx5_B Ubiquitin; proteasome, UIM, hydrolase; NMR {Homo sapiens} SCOP: d.15.1.1 PDB: 1yx6_B Back     alignment and structure
>2ojr_A Ubiquitin; lanthide-binding TAG, terbium, TB, SAD phasing, protein binding; 2.60A {Homo sapiens} Back     alignment and structure
>1v6e_A Cytoskeleton-associated protein 1; tubulin-specific chaperone B, tubulin folding cofactor B, microtubule, ubiquitin-like fold, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2kdi_A Ubiquitin, vacuolar protein sorting-associated protein 27 fusion protein; ubiquitin interacting motif, UIM, protein domain interface; NMR {Saccharomyces cerevisiae} Back     alignment and structure
>2gow_A HCG-1 protein, ubiquitin-like protein 3; BC059385, structural genomics, protein structure initiative, PSI; NMR {Homo sapiens} Back     alignment and structure
>1wgh_A Ubiquitin-like 3, HCG-1 protein; ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2uyz_B Small ubiquitin-related modifier 1; sumoylation, cell division, nuclear protein, ubiquitin-like modifier, UBL conjugation pathway; 1.4A {Homo sapiens} SCOP: d.15.1.1 PDB: 2vrr_B 2iy0_B 2iy1_B 2g4d_B 2las_A 2io2_B 1z5s_B 3uip_B* 1tgz_B* 2bf8_B Back     alignment and structure
>2kdb_A Homocysteine-responsive endoplasmic reticulum- resident ubiquitin-like domain member...; UBL domain, membrane, polymorphism, transmembrane; NMR {Homo sapiens} Back     alignment and structure
>1we6_A Splicing factor, putative; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>2kjr_A CG11242; UBL, ubiquitin, ubiquitin-like, structural genomics, PSI-2, protein structure initiative; NMR {Drosophila melanogaster} Back     alignment and structure
>1wia_A Hypothetical ubiquitin-like protein (riken cDNA 2010008E23); 'structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>3b1l_X E3 ubiquitin-protein ligase parkin; proteasome, ALFA-beta-protein; 1.85A {Mus musculus} PDB: 1mg8_A 2zeq_A 2knb_A 1iyf_A Back     alignment and structure
>1v2y_A 3300001G02RIK protein; hypothetical protein, ubiquitin-like fold, structural genomics, riken structural genomics/proteomics initiative, RSGI; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>1wyw_B Ubiquitin-like protein SMT3C; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 1y8r_C* 2asq_A 2pe6_B 1a5r_A 2kqs_A 3kyc_D* 3rzw_C Back     alignment and structure
>2dzj_A Synaptic glycoprotein SC2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3l0w_B Monoubiquitinated proliferating cell nuclear antigen, proliferating cell nuclear antigen; replication, DNA damage, DNA repair; 2.80A {Saccharomyces cerevisiae} PDB: 3l10_B Back     alignment and structure
>3q3f_A Ribonuclease/ubiquitin chimeric protein; domain SWAP, oligomerization, ubiquitin insertion, hydrolase binding; 2.17A {Bacillus amyloliquefaciens} Back     alignment and structure
>2kj6_A Tubulin folding cofactor B; methods development, NESG, solution PSI-2, structural genomics, protein structure initiative; NMR {Arabidopsis thaliana} Back     alignment and structure
>1we7_A SF3A1 protein; structural genomics, ubiquitin-like domain, riken structural genomics/proteomics initiative, RSGI, gene regulation; NMR {Mus musculus} SCOP: d.15.1.1 PDB: 1zkh_A Back     alignment and structure
>4b6w_A Tubulin-specific chaperone; CAP-Gly, ubiquitin-like; HET: MSE; 2.35A {Trypanosoma brucei brucei strain 927} Back     alignment and structure
>4dbg_A Ranbp-type and C3HC4-type zinc finger-containing; ubiquitin fold, ubiquitination, ligase; 2.71A {Homo sapiens} PDB: 2lgy_A Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3rt3_B Ubiquitin-like protein ISG15; ubiquitin-like domain, isgylation, antiviral protein-viral P complex; 2.01A {Homo sapiens} PDB: 3sdl_C 3r66_C 3pse_B 1z2m_A Back     alignment and structure
>1t0y_A Tubulin folding cofactor B; ubiquitin-like, cytoskeleton, microtubule, CESG, structural genomics, protein structure initiative, PSI; NMR {Caenorhabditis elegans} SCOP: d.15.1.1 Back     alignment and structure
>3u5e_m 60S ribosomal protein L40; translation, ribosome, ribosomal R ribosomal protein, STM1, eukaryotic ribosome; 3.00A {Saccharomyces cerevisiae} PDB: 3u5i_m 4b6a_m 4a18_K 4a19_K 4a1b_K 4a1d_K 4adx_5 3izc_p 3izs_p 3iz5_p 3izr_p Back     alignment and structure
>2kzr_A Ubiquitin thioesterase OTU1; structural genomics, northeast structural genomics consortiu PSI-2, protein structure initiative, hydrolase; NMR {Mus musculus} Back     alignment and structure
>3b08_A Polyubiquitin-C, ubiquitin; protein complex, signaling protein-metal binding protein COM; HET: TRE; 1.70A {Homo sapiens} PDB: 2w9n_A* 3b0a_A* 3axc_A 2zvn_A 2zvo_A 2y5b_B Back     alignment and structure
>3u5c_f 40S ribosomal protein S31; translation, ribosome, ribosomal, ribosomal R ribosomal protein, eukaryotic ribosome, RNA-protein C; 3.00A {Saccharomyces cerevisiae} PDB: 3u5g_f Back     alignment and structure
>3u30_A Ubiquitin, linear DI-ubiquitin; immune system; 2.43A {Homo sapiens} Back     alignment and structure
>1se9_A Ubiquitin family; ubiquitin-like, cell-free, wheat GERM, structural genomics, protein structure initiative, CESG; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>1wf9_A NPL4 family protein; beta-grAsp fold like domain, hypothetical protein, structural genomics, NPPSFA; NMR {Arabidopsis thaliana} SCOP: d.15.1.1 Back     alignment and structure
>3ai5_A Yeast enhanced green fluorescent protein, ubiquit; ubiquitin, fusion protein, fluore protein, transcription; HET: CR2; 1.40A {Aequorea victoria} PDB: 3ako_B* Back     alignment and structure
>1oqy_A HHR23A, UV excision repair protein RAD23 homolog A; DNA repair, proteasome-mediated degradation, protein- protein interaction, replication; NMR {Homo sapiens} SCOP: a.5.2.1 a.5.2.1 a.189.1.1 d.15.1.1 PDB: 1qze_A 1tp4_A Back     alignment and structure
>1wjn_A Tubulin-folding protein TBCE; ubiquitin-like domain, progressive motor neuropathy, structural genomics; NMR {Mus musculus} SCOP: d.15.1.1 Back     alignment and structure
>2xzm_9 RPS31E; ribosome, translation; 3.93A {Tetrahymena thermophila} PDB: 2xzn_9 Back     alignment and structure
>2io1_B Small ubiquitin-related modifier 3 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.60A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3a4r_A Nfatc2-interacting protein; ubiquitin fold, coiled coil, cytoplasm, methylation, nucleus, transcription; 1.00A {Mus musculus} PDB: 3a4s_C 3rd2_A Back     alignment and structure
>2io0_B Small ubiquitin-related modifier 2 precursor; SUMO, SENP, ULP, complex, protein binding, hydrolase; 2.30A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>1wm3_A Ubiquitin-like protein SMT3B; ubiquitin fold, half-open barrel, two helices, protein transport; 1.20A {Homo sapiens} SCOP: d.15.1.1 PDB: 1wm2_A 3uin_B 3uio_B 2ckh_B Back     alignment and structure
>2d07_B Ubiquitin-like protein SMT3B; hydrolase; 2.10A {Homo sapiens} SCOP: d.15.1.1 PDB: 2rpq_A 2awt_A 2io3_B 2iyd_B 1u4a_A 2k1f_A Back     alignment and structure
>1wz0_A Ubiquitin-like protein SMT3B; SUMO-2, ubiquitin-like molecule, structural genomics, sentrin2, NPPFSA; NMR {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>3kbb_A Phosphorylated carbohydrates phosphatase TM_1254; hydrolase, arbohydrate metabolism, COBA magnesium, manganese, metal-binding, nickel; HET: MSE GOL; 1.74A {Thermotoga maritima MSB8} Back     alignment and structure
>2eke_C Ubiquitin-like protein SMT3; UBC9, SUMO binding motif, SBM, ligase/protein binding complex; 1.90A {Saccharomyces cerevisiae} SCOP: d.15.1.1 Back     alignment and structure
>2k8h_A Small ubiquitin protein; SUMO, post-translational modifier, signaling protein; NMR {Trypanosoma brucei} Back     alignment and structure
>2wm8_A MDP-1, magnesium-dependent phosphatase 1; haloacid dehalogenase, protein phosphatase, hydrolase, magne metal-binding; 1.75A {Homo sapiens} PDB: 1u7o_A 1u7p_A Back     alignment and structure
>2fpr_A Histidine biosynthesis bifunctional protein HISB; histidinola phosphate phosphatase, bifunctional enzyme structural genomics; 1.70A {Escherichia coli} SCOP: c.108.1.19 PDB: 2fps_A 2fpu_A* 2fpx_A 2fpw_A* Back     alignment and structure
>2pjh_A Protein NPL4, nuclear protein localization protein 4 homolog; UFD1, NPL4, AAA, protein binding, transport protein; NMR {Mus musculus} Back     alignment and structure
>2pr7_A Haloacid dehalogenase/epoxide hydrolase family; NP_599989.1, uncharacterized protein, structural genomics; 1.44A {Corynebacterium glutamicum atcc 13032} Back     alignment and structure
>3l8h_A Putative haloacid dehalogenase-like hydrolase; HAD superfamily, GMHB, D-glycero-D-manno-heptose-1, 7-bispho phosphatase; HET: FX1; 1.68A {Bordetella bronchiseptica} Back     alignment and structure
>3ib6_A Uncharacterized protein; structural genomics, unknown function, PSI-2, protein struct initiative; 2.20A {Listeria monocytogenes} Back     alignment and structure
>4g9b_A Beta-PGM, beta-phosphoglucomutase; HAD, putative phosphoglucomutase, enzyme function initiative structural genomics, isomerase; 1.70A {Escherichia coli} Back     alignment and structure
>3kzx_A HAD-superfamily hydrolase, subfamily IA, variant; ssgcid, NIH, niaid, SBRI, UW, emerald biostructures, ehrlich chaffeensis; 1.90A {Ehrlichia chaffeensis} Back     alignment and structure
>1nnl_A L-3-phosphoserine phosphatase; PSP, HPSP, phospho-aspartyl, hydrolase; 1.53A {Homo sapiens} SCOP: c.108.1.4 PDB: 1l8l_A* 1l8o_A Back     alignment and structure
>2ah5_A COG0546: predicted phosphatases; MCSG, structural genomics, hydrola haloacid dehalogenase-like, PSI; 1.74A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>4gib_A Beta-phosphoglucomutase; rossmann fold, HAD-like, structural genomics, center for structural genomics of infectious DISE csgid, isomerase; 2.27A {Clostridium difficile} Back     alignment and structure
>2oda_A Hypothetical protein pspto_2114; haloacid dehalogenase, phosphonoacetaldehyde hydrolase, protein binding; HET: EPE; 1.90A {Pseudomonas syringae PV} Back     alignment and structure
>3m9l_A Hydrolase, haloacid dehalogenase-like family; HAD family hydrolase, structural genomics, PSI, protein structure initiative; HET: MSE; 1.60A {Pseudomonas fluorescens} PDB: 2ybd_A* 3r09_A* Back     alignment and structure
>2gmw_A D,D-heptose 1,7-bisphosphate phosphatase; Zn-binding protein, hydrolase; 1.50A {Escherichia coli} SCOP: c.108.1.19 PDB: 3esq_A 3esr_A 3l1u_A 3l1v_A 3l8e_A 3l8f_A 3l8g_A* Back     alignment and structure
>3e58_A Putative beta-phosphoglucomutase; structu genomics, PSI-2, protein structure initiative, midwest CENT structural genomics; 1.86A {Streptococcus thermophilus lmg 18311} Back     alignment and structure
>2p9j_A Hypothetical protein AQ2171; secsg, riken, PSI, structural GENO protein structure initiative, southeast collaboratory for S genomics; 2.40A {Aquifex aeolicus} Back     alignment and structure
>4efo_A Serine/threonine-protein kinase TBK1; ubiquitin like domain, transferase; 1.77A {Homo sapiens} Back     alignment and structure
>3m1y_A Phosphoserine phosphatase (SERB); NYSGXRC, PSI II, phophoserine phosphatase, protein structure initiative, structural genomics; 2.40A {Helicobacter pylori} SCOP: c.108.1.0 Back     alignment and structure
>3umb_A Dehalogenase-like hydrolase; 2.20A {Ralstonia solanacearum} Back     alignment and structure
>2no4_A (S)-2-haloacid dehalogenase IVA; HAD superfamily, rossman fold, hydrol; 1.93A {Burkholderia cepacia} PDB: 2no5_A* Back     alignment and structure
>4ex6_A ALNB; modified rossman fold, phosphatase, magnesium binding, hydro; 1.25A {Streptomyces SP} PDB: 4ex7_A Back     alignment and structure
>2i6x_A Hydrolase, haloacid dehalogenase-like family; HAD superfamily, struct genomics, PSI-2, protein structure initiative; HET: MSE; 2.40A {Porphyromonas gingivalis} Back     alignment and structure
>3um9_A Haloacid dehalogenase, type II; haloacid dehalogenase-like hydrolase protein superfamily, defluorinase, hydrolase; 2.19A {Polaromonas SP} Back     alignment and structure
>3mc1_A Predicted phosphatase, HAD family; PSI2, NYSGXRC, structural genomics, protein structure initiative; 1.93A {Clostridium acetobutylicum} SCOP: c.108.1.0 Back     alignment and structure
>3kd3_A Phosphoserine phosphohydrolase-like protein; csgid, niaid, S genomics, national institute of allergy and infectious DISE (niaid); 1.70A {Francisella tularensis subsp} Back     alignment and structure
>3nuq_A Protein SSM1, putative nucleotide phosphatase; suppresses the 6-AU sensitivity of transcription elongation II; 1.70A {Saccharomyces cerevisiae} PDB: 3onn_A 3opx_A* Back     alignment and structure
>1zrn_A L-2-haloacid dehalogenase; hydrolase; 1.83A {Pseudomonas SP} SCOP: c.108.1.1 PDB: 1zrm_A 1jud_A 1qh9_A Back     alignment and structure
>4eze_A Haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 2.27A {Salmonella enterica subsp} Back     alignment and structure
>3qxg_A Inorganic pyrophosphatase; hydrolase, magnesium binding site, NEW YORK research center for structural genomics; HET: TLA; 1.24A {Bacteroides thetaiotaomicron} PDB: 3qu2_A* 3qx7_A 3quq_A* 3r9k_A 3qut_A 3qu9_A* 3qu7_A 3qu5_A 3qyp_A 3quc_A 3qub_A 3qu4_A Back     alignment and structure
>3s6j_A Hydrolase, haloacid dehalogenase-like family; structural genomics, PSI-2; 2.20A {Pseudomonas syringae PV} Back     alignment and structure
>3ed5_A YFNB; APC60080, bacillus subtilis subsp. subtilis STR. 168, structural genomics, PSI-2, protein structure initiative; HET: MSE; 1.72A {Bacillus subtilis} PDB: 3i76_A Back     alignment and structure
>3sd7_A Putative phosphatase; structural genomics, haloacid dehalogenase-like hydrolase, H center for structural genomics of infectious diseases; HET: PGE; 1.70A {Clostridium difficile} Back     alignment and structure
>2hdo_A Phosphoglycolate phosphatase; NP_784602.1, structur genomics, PSI-2, protein structure initiative, joint center structural genomics; HET: MSE; 1.50A {Lactobacillus plantarum} SCOP: c.108.1.6 Back     alignment and structure
>4dcc_A Putative haloacid dehalogenase-like hydrolase; magnesium binding site, enzyme function initiativ; 1.65A {Bacteroides thetaiotaomicron} PDB: 4dfd_A 4f71_A 4f72_A Back     alignment and structure
>3fvv_A Uncharacterized protein; unknown function, structural genomics, PSI,MCSG, protein STR initiative, midwest center for structural genomics; 2.10A {Bordetella pertussis} Back     alignment and structure
>3zvl_A Bifunctional polynucleotide phosphatase/kinase; hydrolase-transferase complex, base excision repair, BER, non-homologous END-joining, NHEJ; 1.65A {Mus musculus} PDB: 3zvm_A* 3zvn_A* 1yj5_A 3u7e_B* 3u7f_B* 3u7h_B* 3u7g_A* Back     alignment and structure
>3cnh_A Hydrolase family protein; NP_295428.1, predicted hydrolase of haloacid dehalogenase-LI superfamily; HET: MSE PG4; 1.66A {Deinococcus radiodurans R1} Back     alignment and structure
>3kyd_D Small ubiquitin-related modifier 1; SUMO, thioester, adenylation, inhibitor, TETR intermediate, ligase, nucleus, phosphoprotein; HET: VMX; 2.61A {Homo sapiens} SCOP: d.15.1.1 Back     alignment and structure
>2nyv_A Pgpase, PGP, phosphoglycolate phosphatase; structural genomics, PSI-2, protein structure initiative; 2.10A {Aquifex aeolicus} PDB: 2yy6_A Back     alignment and structure
>2w43_A Hypothetical 2-haloalkanoic acid dehalogenase; hydrolase, metabolic process; HET: MES; 1.66A {Sulfolobus tokodaii} PDB: 2w11_A Back     alignment and structure
>3n1u_A Hydrolase, HAD superfamily, subfamily III A; structural genomics, PSI-2; 1.80A {Legionella pneumophila} SCOP: c.108.1.0 Back     alignment and structure
>2hsz_A Novel predicted phosphatase; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; HET: UNL; 1.90A {Haemophilus somnus 129PT} SCOP: c.108.1.6 Back     alignment and structure
>1qq5_A Protein (L-2-haloacid dehalogenase); hydrolase; 1.52A {Xanthobacter autotrophicus} SCOP: c.108.1.1 PDB: 1qq6_A* 1qq7_A* 1aq6_A Back     alignment and structure
>3pge_A SUMO-modified proliferating cell nuclear antigen; DNA replication, DNA binding protein; 2.80A {Saccharomyces cerevisiae} Back     alignment and structure
>2zg6_A Putative uncharacterized protein ST2620, probable 2-haloalkanoic; probable 2-haloalkanoic acid dehalogenase, hydrolase, structural genomics; 2.40A {Sulfolobus tokodaii} Back     alignment and structure
>3qnm_A Haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 1.70A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>3e8m_A Acylneuraminate cytidylyltransferase; 2-keto-3-deoxynononic acid 9-phosphate phosphohydrolase, nucleotidyltransferase; HET: PEG PG4 EDO PGE; 1.10A {Bacteroides thetaiotaomicron} PDB: 3e84_A 3e81_A* Back     alignment and structure
>3n07_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; structural genomics, phosphatase, PSI-2, protein structure initiative; HET: MSE; 1.76A {Vibrio cholerae} Back     alignment and structure
>3dv9_A Beta-phosphoglucomutase; structural genomics, APC60149, PSI- protein structure initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.72A {Bacteroides vulgatus} Back     alignment and structure
>4eek_A Beta-phosphoglucomutase-related protein; hydrolase, magnesium binding site, enzyme function initiativ; 1.60A {Deinococcus radiodurans} PDB: 4eel_A* 4een_A Back     alignment and structure
>2o2x_A Hypothetical protein; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2, hydrolase; 1.50A {Mesorhizobium loti} SCOP: c.108.1.19 Back     alignment and structure
>3p96_A Phosphoserine phosphatase SERB; ssgcid, structural genomics, structural genomics center for infectious disease, hydrolas; 2.05A {Mycobacterium avium} Back     alignment and structure
>2hoq_A Putative HAD-hydrolase PH1655; haloacid dehalogenase, structural genomics, NPPSFA, national on protein structural and functional analyses; 1.70A {Pyrococcus horikoshii} Back     alignment and structure
>3tix_A Ubiquitin-like protein SMT3, RNA-induced transcri silencing complex protein TAS3; PIN, rossmann fold, SPOC, alpha-helical hairpin, heterochrom silencing, RITS, RNAI, argonaute; 2.90A {Saccharomyces cerevisiae} Back     alignment and structure
>2p11_A Hypothetical protein; putative haloacid dehalogenase-like hydrolase, structural GE joint center for structural genomics, JCSG; 2.20A {Burkholderia xenovorans} Back     alignment and structure
>1k1e_A Deoxy-D-mannose-octulosonate 8-phosphate phosphat; structural genomics, KDO 8-P phosphatase, structure function project, S2F; HET: MES; 1.67A {Haemophilus influenzae RD} SCOP: c.108.1.5 PDB: 1j8d_A* Back     alignment and structure
>3u26_A PF00702 domain protein; structural genomics, PSI-biology, northeast structural genom consortium, NESG, unknown function; 1.59A {Pyrococcus horikoshii} SCOP: c.108.1.1 PDB: 1x42_A Back     alignment and structure
>3l5k_A Protein GS1, haloacid dehalogenase-like hydrolase domain- containing protein 1A; HDHD1A, haloacid dehalogenase-like hydrolase domain containing 1A; 2.00A {Homo sapiens} Back     alignment and structure
>3d6j_A Putative haloacid dehalogenase-like hydrolase; structural genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides fragilis nctc 9343} Back     alignment and structure
>2fi1_A Hydrolase, haloacid dehalogenase-like family; structural genomics, haloacid dehalogenase-like F PSI, protein structure initiative; 1.40A {Streptococcus pneumoniae} SCOP: c.108.1.3 Back     alignment and structure
>1rku_A Homoserine kinase; phosphoserine phosphatase, phosphoserine:homoserine phosphotransferase, THRH, phosphoserine phosphoryl donor; 1.47A {Pseudomonas aeruginosa} SCOP: c.108.1.11 PDB: 1rkv_A Back     alignment and structure
>3k1z_A Haloacid dehalogenase-like hydrolase domain-conta protein 3; HDHD3, haloacid dehalogenase-like hydrolase domain containin structural genomics; 1.55A {Homo sapiens} Back     alignment and structure
>3ij5_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphat; IDP022 hydrolase, lipopolysaccharide biosynthesis, magnesium, STRU genomics; 1.95A {Yersinia pestis} Back     alignment and structure
>3umc_A Haloacid dehalogenase; HY; 2.15A {Pseudomonas aeruginosa} Back     alignment and structure
>3iru_A Phoshonoacetaldehyde hydrolase like protein; phosphonoacetaldehyde hydrolase like P structural genomics, PSI-2, protein structure initiative; 2.30A {Oleispira antarctica} SCOP: c.108.1.0 Back     alignment and structure
>3nas_A Beta-PGM, beta-phosphoglucomutase; PSI, structural genomics, protein structure initiative, NEW research center for structural genomics; 3.00A {Bacillus subtilis} Back     alignment and structure
>2hcf_A Hydrolase, haloacid dehalogenase-like family; NP_662590.1, ST genomics, PSI-2, protein structure initiative; 1.80A {Chlorobaculum tepidum} SCOP: c.108.1.6 Back     alignment and structure
>3mn1_A Probable YRBI family phosphatase; structural genomics, PSI, protein structure initiative, NYSG phosphatase; 1.80A {Pseudomonas syringae PV} PDB: 3nrj_A Back     alignment and structure
>3ddh_A Putative haloacid dehalogenase-like family hydrol; hydrolase, HAD superfamily, ST genomics, PSI-2, protein structure initiative; 2.00A {Bacteroides thetaiotaomicron} Back     alignment and structure
>3smv_A S-(-)-azetidine-2-carboxylate hydrolase; haloacid dehalogenase superfamily, L-azetidine-2- carboxylate; HET: GOL; 1.38A {Pseudomonas} Back     alignment and structure
>2b0c_A Putative phosphatase; alpha-D-glucose-1-phosphate, structural genomic protein structure initiative, midwest center for structural genomics, MCSG; HET: G1P; 2.00A {Escherichia coli} SCOP: c.108.1.2 Back     alignment and structure
>3umg_A Haloacid dehalogenase; defluorinase, hydrolase; 2.25A {Rhodococcus jostii} Back     alignment and structure
>1te2_A Putative phosphatase; structural genomics, phosphates, PSI, protein S initiative, midwest center for structural genomics, MCSG; HET: MSE; 1.76A {Escherichia coli} SCOP: c.108.1.6 Back     alignment and structure
>2fea_A 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase; 2633731, structural genomics, joint center for structural GE JCSG; HET: MSE; 2.00A {Bacillus subtilis} SCOP: c.108.1.20 Back     alignment and structure
>1q92_A 5(3)-deoxyribonucleotidase; alpha-beta rossman fold, hydrolase; HET: DRM; 1.40A {Homo sapiens} SCOP: c.108.1.8 PDB: 1mh9_A* 1q91_A* 1z4m_A* 1z4i_A* 1z4j_A* 1z4l_A* 1z4k_A* 1z4p_X* 1z4q_A* 2jau_A* 2jaw_A* 3u19_A* 3u13_A 4e88_A Back     alignment and structure
>2r8e_A 3-deoxy-D-manno-octulosonate 8-phosphate phosphatase; YRBI, divalent metal, HAD superfamily, KDO 8-P, hydrolase; 1.40A {Escherichia coli O6} PDB: 2r8x_A 2r8y_A 2r8z_A 3hyc_A 3i6b_A* Back     alignment and structure
>2g80_A Protein UTR4; YEL038W, UTR4 protein (unknown transcript 4 protein), struct genomics, PSI, protein structure initiative; 2.28A {Saccharomyces cerevisiae} SCOP: c.108.1.22 Back     alignment and structure
>2qlt_A (DL)-glycerol-3-phosphatase 1; APC7326, RHR2P, saccharom cerevisiae, structural genomics, PSI-2, protein structure initiative; 1.60A {Saccharomyces cerevisiae} Back     alignment and structure
>3bwv_A Putative 5'(3')-deoxyribonucleotidase; NP_764060.1, deoxyribonucleotidase-like protein; HET: MSE; 1.55A {Staphylococcus epidermidis} Back     alignment and structure
>4ap9_A Phosphoserine phosphatase; hydrolase, haloacid dehalogenase superfamily, NDSB; HET: 1PS; 1.78A {Thermococcus onnurineus} PDB: 4b6j_A Back     alignment and structure
>3mmz_A Putative HAD family hydrolase; structural genomics, protein structure initiative, NEW YORK structural genomix research consortium; 1.84A {Streptomyces avermitilis} Back     alignment and structure
>2go7_A Hydrolase, haloacid dehalogenase-like family; structural genomics, joint center for structural genomics, J protein structure initiative; 2.10A {Streptococcus pneumoniae} SCOP: c.108.1.6 Back     alignment and structure
>2jxx_A Nfatc2-interacting protein; nuclear factor of activated T-cells, cytoplasmic 2- interacting protein, ubiquitin like homologue; NMR {Homo sapiens} Back     alignment and structure
>2wf7_A Beta-PGM, beta-phosphoglucomutase; transition state analogue, haloacid dehalogenase superfamily, isomerase, phosphotransferase; HET: G7P; 1.05A {Lactococcus lactis} PDB: 1o03_A* 1z4n_A* 1z4o_A* 1zol_A 2wf5_A* 2wf6_A* 1o08_A* 2wf8_A* 2wf9_A* 2wfa_A 2whe_A 1lvh_A* 3fm9_A Back     alignment and structure
>2i7d_A 5'(3')-deoxyribonucleotidase, cytosolic type; hydrolase; HET: DUR; 1.20A {Homo sapiens} PDB: 2jar_A* 2jao_A* Back     alignment and structure
>3skx_A Copper-exporting P-type ATPase B; P1B-ATPase, ATP binding domain, copper(II) transporter, MEMB protein, hydrolase; 1.59A {Archaeoglobus fulgidus} PDB: 3sky_A* Back     alignment and structure
>2pke_A Haloacid delahogenase-like family hydrolase; NP_639141.1, ST genomics, joint center for structural genomics, JCSG; 1.81A {Xanthomonas campestris PV} Back     alignment and structure
>3vay_A HAD-superfamily hydrolase; rossmann fold, haloacid dehalogenase; 1.98A {Pseudomonas syringae PV} Back     alignment and structure
>2b82_A APHA, class B acid phosphatase; DDDD acid phosphatase, metallo-ENZ hydrolase; HET: ADN; 1.25A {Escherichia coli} SCOP: c.108.1.12 PDB: 2b8j_A* 2hf7_A 1rmt_A* 1n9k_A 1rmq_A 1n8n_A* 1rmy_A* 2g1a_A* 3cz4_A 2heg_A* 1z5g_A 1z5u_A* 1z88_A 2aut_A Back     alignment and structure
>2i33_A Acid phosphatase; HAD superfamily, hydrolase; 1.57A {Bacillus anthracis} PDB: 2i34_A Back     alignment and structure
>1l7m_A Phosphoserine phosphatase; rossmann fold, four-helix bundle, B-hairpin, structural genomics, BSGC structure funded by NIH; 1.48A {Methanocaldococcus jannaschii} SCOP: c.108.1.4 PDB: 1f5s_A 1l7n_A 1l7p_A* 1l7o_A* 1j97_A* Back     alignment and structure
>2fdr_A Conserved hypothetical protein; SAD, structural genomics, agrobacter tumefaciens, HAD-superfamily hydrolase; 2.00A {Agrobacterium tumefaciens str} SCOP: c.108.1.6 Back     alignment and structure
>2bps_A YUKD protein; ubiquitin-like protein, ubiquitin; 2.7A {Bacillus subtilis} Back     alignment and structure
>1swv_A Phosphonoacetaldehyde hydrolase; HAD enzyme superfamily, phosphonotase, metal binding; 2.30A {Bacillus cereus} SCOP: c.108.1.3 PDB: 1sww_A 2iof_A* 2ioh_A 1rql_A 1rqn_A 2iof_K* 1rdf_A 1fez_A Back     alignment and structure
>3n28_A Phosphoserine phosphatase; HAD family hydrolase, structural genomics, PSI, protein STRU initiative, nysgrc; 2.30A {Vibrio cholerae} Back     alignment and structure
>2l76_A Nfatc2-interacting protein; ubiquitin-like domain, structural genomics, PSI-biology, Pro structure initiative; NMR {Homo sapiens} Back     alignment and structure
>3v7o_A Minor nucleoprotein VP30; ssgcid, seattle structural genomics center for infectious disease, SMT, transcription; 2.25A {Reston ebolavirus} Back     alignment and structure
>3i28_A Epoxide hydrolase 2; aromatic hydrocarbons catabolism, detoxification, magnesium, metal-binding, peroxisome; HET: 34N; 1.95A {Homo sapiens} PDB: 1s8o_A* 1zd2_P* 1vj5_A* 1zd4_A* 1zd5_A* 3i1y_A* 1zd3_A* 3koo_A* 3otq_A* 4hai_A* 1cqz_A 1cr6_A* 1ek1_A* 1ek2_A* 3ans_A* 3ant_A* 3pdc_A* Back     alignment and structure
>3goe_A DNA repair protein RAD60; SUMO-like domain, sumoylation, SUMO, genome stability, DNA damage, DNA recombination, nucleus; HET: DNA; 0.97A {Schizosaccharomyces pombe} PDB: 3rcz_A* Back     alignment and structure
>2kc2_A Talin-1, F1; FERM, adhesion, cell membrane, cell projection, cytoplasm, cytoskeleton, membrane, phosphoprotein, structural protein; NMR {Mus musculus} Back     alignment and structure
>2obb_A Hypothetical protein; structural genomics, PSI-2, PR structure initiative, midwest center for structural genomic unknown function; 2.20A {Bacteroides thetaiotaomicron} SCOP: c.108.1.25 Back     alignment and structure
>3ocu_A Lipoprotein E; hydrolase, outer membrane; HET: NMN; 1.35A {Haemophilus influenzae} PDB: 3ocv_A* 3ocw_A* 3ocx_A* 3ocz_A* 3ocy_A* 3sf0_A* 2hlk_A 2hll_A 3et4_A 3et5_A Back     alignment and structure
>3uf8_A Ubiquitin-like protein SMT3, peptidyl-prolyl CIS- isomerase; ssgcid, seattle structural genomics center for in disease; HET: FK5; 1.50A {Burkholderia pseudomallei} PDB: 4ggq_C* 3vaw_A* 3uqa_A* 4g50_A* 4fn2_A* 3uqb_A* 4giv_A* 1euv_B 3v60_A 3v61_A 3v62_A* Back     alignment and structure
>3pct_A Class C acid phosphatase; hydrolase, outer membrane; 1.85A {Pasteurella multocida} Back     alignment and structure
>2al3_A TUG long isoform; TUG UBL1 insulin, endocytosis/exocytosis complex; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>3ix6_A TS, tsase, thymidylate synthase; niaid, ssgcid, seattle structural center for infectious DISE brucellosis, orchitis, epididymitis, mastitis; 2.20A {Brucella melitensis} Back     alignment and structure
>3qx1_A FAS-associated factor 1; UBX, protein binding, P97 binding; 1.60A {Homo sapiens} PDB: 3qwz_B* 3qc8_B 3qca_A 3qq8_B 3r3m_B 1h8c_A Back     alignment and structure
>3epr_A Hydrolase, haloacid dehalogenase-like family; structural genomics, unknown function, HAD superfamily hydro PSI-2; 1.55A {Streptococcus agalactiae serogroup V} SCOP: c.108.1.14 PDB: 1ys9_A 1wvi_A 1ydf_A Back     alignment and structure
>3qgm_A P-nitrophenyl phosphatase (PHO2); structural genomics, PSI-2, protein structure initiative, MI center for structural genomics, MCSG; HET: MSE; 2.00A {Archaeoglobus fulgidus} SCOP: c.108.1.0 Back     alignment and structure
>3ewi_A N-acylneuraminate cytidylyltransferase; beta barrel, HAD-like, rossmannoid fold, nucleotidyltransferase, nucleus; 1.90A {Mus musculus} Back     alignment and structure
>1wr8_A Phosphoglycolate phosphatase; alpha / beta core domain, HAD superfamily, structural genomi structural genomics/proteomics initiative, RSGI; 1.60A {Pyrococcus horikoshii} SCOP: c.108.1.10 Back     alignment and structure
>3mpo_A Predicted hydrolase of the HAD superfamily; SGX, PSI, structural genomics, protein structure initiative; 2.90A {Lactobacillus brevis} SCOP: c.108.1.0 Back     alignment and structure
>4dw8_A Haloacid dehalogenase-like hydrolase; HAD, putative phosphatase, enzyme function initiative, EFI, structural genomics; 1.50A {Bacteroides thetaiotaomicron} PDB: 3niw_A 4dwo_A Back     alignment and structure
>1xpj_A Hypothetical protein; structural genomics, MCSG, protein STR initiative, PSI, midwest center for structural genomics, UN function; HET: TLA; 2.30A {Vibrio cholerae} SCOP: c.108.1.18 Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>3pgv_A Haloacid dehalogenase-like hydrolase; structural genomics, joint center for structural genomics, J protein structure initiative; HET: EPE; 2.39A {Klebsiella pneumoniae subsp} Back     alignment and structure
>2dzk_A UBX domain-containing protein 2; ubiquitin-like fold, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} PDB: 2kxj_A Back     alignment and structure
>4da1_A Protein phosphatase 1K, mitochondrial; metal-ION-assisted catalysis, dehydrogenase phosphatase, hydrolase; 2.38A {Homo sapiens} PDB: 3qht_A 1l2n_A Back     alignment and structure
>3gyg_A NTD biosynthesis operon putative hydrolase NTDB; PF05116, PF08282, MCSG, PSI-2, haloacid dehalogenase-like HY structural genomics; 2.45A {Bacillus subtilis subsp} Back     alignment and structure
>1l6r_A Hypothetical protein TA0175; structural genomics, putative hydrolas midwest center for structural genomics, MCSG, PSI; 1.40A {Thermoplasma acidophilum} SCOP: c.108.1.10 PDB: 1kyt_A Back     alignment and structure
>3dnp_A Stress response protein YHAX; structural PSI-2, protein structure initiative, midwest center for STR genomics, MCSG, unknown function; HET: MSE; 1.85A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1xvi_A MPGP, YEDP, putative mannosyl-3-phosphoglycerate phosphatase; hypothetical protein, conserved protein, phophatase-like domain; HET: 1PE PG4 PGE; 2.26A {Escherichia coli K12} SCOP: c.108.1.10 Back     alignment and structure
>1nrw_A Hypothetical protein, haloacid dehalogenase-like hydrolase; structural genomics, PSI, protein structure initiative; 1.70A {Bacillus subtilis} SCOP: c.108.1.10 Back     alignment and structure
>2pq0_A Hypothetical conserved protein GK1056; hyopthetical protein, structural genomics, unknown function; 2.60A {Geobacillus kaustophilus} PDB: 2qyh_A Back     alignment and structure
>3a1c_A Probable copper-exporting P-type ATPase A; ATP-binding, cell membrane, copper transport, hydrolase, ION transport, magnesium, membrane; HET: ACP; 1.85A {Archaeoglobus fulgidus} PDB: 3a1d_A* 3a1e_A* 2b8e_A 2voy_J 2voy_I Back     alignment and structure
>3dao_A Putative phosphatse; structural genomics, joint center for S genomics, JCSG, protein structure initiative, PSI-2, hydrol; HET: MSE 1PE CIT; 1.80A {Eubacterium rectale} Back     alignment and structure
>1vjr_A 4-nitrophenylphosphatase; TM1742, structural genomics, JCSG, protein structure initiative, joint center for structural G hydrolase; 2.40A {Thermotoga maritima} SCOP: c.108.1.14 PDB: 1pw5_A* Back     alignment and structure
>3pdw_A Uncharacterized hydrolase YUTF; structural genomics, PSI2, NYSGXRC, protein structure initia YORK SGX research center for structural genomics; 1.60A {Bacillus subtilis} SCOP: c.108.1.0 Back     alignment and structure
>1rkq_A Hypothetical protein YIDA; two domain structure with beta-alpha sandwich. stucture contains A magnesium ION., PSI, protein structure initiative; 1.40A {Escherichia coli} SCOP: c.108.1.10 Back     alignment and structure
>2daj_A KIAA0977 protein, COBL-like 1; ubiquitin-like domain, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Homo sapiens} Back     alignment and structure
>3kc2_A Uncharacterized protein YKR070W; HAD-like, mitochondral protein, PSI, MCSG, structural genomi protein structure initiative; HET: MSE; 1.55A {Saccharomyces cerevisiae} PDB: 3rf6_A* Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure
>3fzq_A Putative hydrolase; YP_001086940.1, putative haloacid dehalogenase-like hydrolas structural genomics, joint center for structural genomics; HET: MSE; 2.10A {Clostridium difficile} SCOP: c.108.1.0 Back     alignment and structure
>2hx1_A Predicted sugar phosphatases of the HAD superfamily; ZP_00311070.1, possible sugar phosphatase, structural genomics; HET: MSE EPE; 2.10A {Cytophaga hutchinsonii} Back     alignment and structure
>1zjj_A Hypothetical protein PH1952; alpha/beta hydrolase fold, HAD superfamily, structural genom riken structural genomics/proteomics initiative; 1.85A {Pyrococcus horikoshii} Back     alignment and structure
>2zos_A MPGP, mannosyl-3-phosphoglycerate phosphatase; haloacid dehalogenase like hydrolase, mannosylglycerate, cytoplasm, hydrolase, magnesium; 1.70A {Pyrococcus horikoshii} PDB: 1wzc_A Back     alignment and structure
>1nf2_A Phosphatase; structural proteomics, HAD NEW fold, structural genomics, BSGC structure funded by NIH structure initiative, PSI; 2.20A {Thermotoga maritima} SCOP: c.108.1.10 Back     alignment and structure
>2x4d_A HLHPP, phospholysine phosphohistidine inorganic pyrophos phosphatase; hydrolase; 1.92A {Homo sapiens} Back     alignment and structure
>2ho4_A Haloacid dehalogenase-like hydrolase domain containing 2; HDHD2, protein structure initiative, PSI, center for eukaryotic structural genomics, CESG; 2.20A {Mus musculus} PDB: 3hlt_A Back     alignment and structure
>2oyc_A PLP phosphatase, pyridoxal phosphate phosphatase; structural genomics, NYSGXRC, NEW YORK SGX research center for structural genomics, PSI-2; 1.72A {Homo sapiens} PDB: 2p27_A 2p69_A* 2cft_A* 2cfs_A 2cfr_A* Back     alignment and structure
>1qyi_A ZR25, hypothetical protein; structural genomics, PSI, protein structure initiative, NORT structural genomics consortium, NESG; 2.50A {Staphylococcus aureus subsp} SCOP: c.108.1.13 Back     alignment and structure
>1ltq_A Polynucleotide kinase; phosphatase, alpha/beta, P-loop, transferase; HET: ADP; 2.33A {Enterobacteria phage T4} SCOP: c.108.1.9 c.37.1.1 PDB: 1rc8_A* 1rpz_A* 1rrc_A* 2ia5_A Back     alignment and structure
>2b30_A Pvivax hypothetical protein; SGPP, structural genomics, PSI, protein structure initiative; 2.70A {Plasmodium vivax} SCOP: c.108.1.10 Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>2c4n_A Protein NAGD; nucleotide phosphatase, HAD superfamily, UMP phosphatase, carbohydrate metabolism, hydrolase; 1.8A {Escherichia coli} SCOP: c.108.1.14 Back     alignment and structure
>2rbk_A Putative uncharacterized protein; HAD-like phosphatase, unknown function; 1.00A {Bacteroides thetaiotaomicron} SCOP: c.108.1.10 PDB: 1ymq_A 2rb5_A 2rav_A 2rar_A Back     alignment and structure
>3f9r_A Phosphomannomutase; trypanosome glycobiology structural genomics, isomerase, structural genomics consortium, SGC; 1.85A {Trypanosoma brucei} SCOP: c.108.1.0 PDB: 2i54_A* 2i55_A* Back     alignment and structure
>1yv9_A Hydrolase, haloacid dehalogenase family; hypothetical protein, struc genomics, PSI, protein structure initiative; 2.80A {Enterococcus faecalis} SCOP: c.108.1.14 Back     alignment and structure
>3l7y_A Putative uncharacterized protein SMU.1108C; hydrolase; 2.00A {Streptococcus mutans} Back     alignment and structure
>1s2o_A SPP, sucrose-phosphatase; phosphohydrolase, HAD superfamily, cyanobacteria; 1.40A {Synechocystis SP} SCOP: c.108.1.10 PDB: 1tj3_A 1tj4_A* 1tj5_A* 1u2s_A* 1u2t_A* 2b1q_A* 2b1r_A* 2d2v_A* Back     alignment and structure
>2amy_A PMM 2, phosphomannomutase 2; HS.459855, HS.313504, BC008310, phosphatase, PFAM PF03332, H superfamily, jaecken disease; 2.09A {Homo sapiens} SCOP: c.108.1.10 PDB: 2q4r_A Back     alignment and structure
>2fue_A PMM 1, PMMH-22, phosphomannomutase 1; enzyme-product complex, protein glycosyl carbohydrate-deficient glycoprotein syndrome; HET: MSE M1P; 1.75A {Homo sapiens} SCOP: c.108.1.10 PDB: 2fuc_A* Back     alignment and structure
>1rlm_A Phosphatase; HAD family, rossman fold, hydrolase; 1.90A {Escherichia coli} SCOP: c.108.1.10 PDB: 1rlt_A 1rlo_A* 2hf2_A Back     alignment and structure
>3r4c_A Hydrolase, haloacid dehalogenase-like hydrolase; haloalkanoate dehalogenase enzyme superfamily, phosphohydrol hydrolase; 1.82A {Bacteroides thetaiotaomicron} SCOP: c.108.1.0 Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>1wj4_A KIAA0794 protein; UBX domain, beta-grAsp fold, structural genomics, riken structural genomics/proteomics initiative, RSGI, unknown function; NMR {Homo sapiens} SCOP: d.15.1.2 Back     alignment and structure
>1u02_A Trehalose-6-phosphate phosphatase related protein; structural genomics, PSI; 1.92A {Thermoplasma acidophilum} SCOP: c.108.1.15 Back     alignment and structure
>4fe3_A Cytosolic 5'-nucleotidase 3; substrate complex, HAD-like, protein binding; HET: U5P; 1.74A {Mus musculus} PDB: 2g09_A* 2bdu_A* 2g08_A 2g06_A* 2g0a_A* 2q4t_A* 2g07_A* 2jga_A 2vkq_A 2cn1_A Back     alignment and structure
>1ip9_A BEM1 protein; ubiquitin alpha/beta roll, signaling protein; NMR {Saccharomyces cerevisiae} SCOP: d.15.2.2 PDB: 1ipg_A 2kfk_A Back     alignment and structure
>1oey_A P67-PHOX, neutrophil cytosol factor 2; immune system, PB1 heterodimer/complex, NADPH oxidase, PB1 D heterodimerization; 2.0A {Homo sapiens} SCOP: d.15.2.2 Back     alignment and structure
>3zx4_A MPGP, mannosyl-3-phosphoglycerate phosphatase; hydrolase, haloalkanoid acid dehalogenase-like phosphatase, crystallographic snapshot; HET: 2M8; 1.74A {Thermus thermophilus} PDB: 3zty_A 3zu6_A* 3ztw_A* 3zw7_A* 3zwd_A* 3zwk_A 3zup_A* 3zx5_A* Back     alignment and structure
>1ryj_A Unknown; beta/alpha protein, structural genomics, protein structure initiative, OCSP, NESG, PSI; NMR {Methanothermococcusthermolithotrophicus} SCOP: d.15.3.2 Back     alignment and structure
>1vd2_A Protein kinase C, IOTA type; PB1 domain, OPCA motif, APKC, ZIP/P62, MEK5, molecular recognition, transferase; NMR {Homo sapiens} SCOP: d.15.2.2 PDB: 1wmh_A Back     alignment and structure
>2l32_A Small archaeal modifier protein 2; protein BIN; NMR {Haloferax volcanii} Back     alignment and structure
>2cr5_A Reproduction 8; UBX domain, D0H8S2298E protein, structural genomics, NPPSFA, national project on protein structural and functional analyses; NMR {Mus musculus} SCOP: d.15.1.2 Back     alignment and structure
>4a3p_A Ubiquitin carboxyl-terminal hydrolase 15; 1.40A {Homo sapiens} PDB: 4a3o_A 3pv1_A 3ppa_A* 3t9l_A 3lmn_A Back     alignment and structure
>3jyu_A Ubiquitin carboxyl-terminal hydrolase; domain in ubiquitin-specific peptidases (DUSP), proto- oncogene, ubiquitin-fold, UBL, protease, thioesterase; HET: 1PS; 2.37A {Mus musculus} Back     alignment and structure
>2hi0_A Putative phosphoglycolate phosphatase; YP_619066.1, structural genomics, joint center for structural genomics, JCSG; HET: MSE; 1.51A {Lactobacillus delbrueckii} Back     alignment and structure
>4eut_A Serine/threonine-protein kinase TBK1; ATP binding, phosphorylation, transferase-transferas inhibitor complex; HET: BX7; 2.60A {Homo sapiens} Back     alignment and structure
>2om6_A Probable phosphoserine phosphatase; rossmann fold, B-hairpin, four-helix bundle, structural GENO NPPSFA; 2.20A {Pyrococcus horikoshii} Back     alignment and structure
>4as2_A Phosphorylcholine phosphatase; hydrolase, HAD superfamily, alkylammonium compounds; HET: BTB; 2.12A {Pseudomonas aeruginosa} PDB: 4as3_A* Back     alignment and structure
>1s3s_G P47 protein; AAA ATPase, protein-protein complex, UBX domain, protein binding; HET: ADP; 2.90A {Rattus norvegicus} SCOP: d.15.1.2 PDB: 1i42_A 1jru_A Back     alignment and structure
>2gfh_A Haloacid dehalogenase-like hydrolase domain conta; structural genomics, joint center for structural genomics, J protein structure initiative, PSI-2; 1.90A {Mus musculus} SCOP: c.108.1.6 PDB: 2w4m_A Back     alignment and structure
>2kvr_A Ubiquitin carboxyl-terminal hydrolase 7; USP7, ubiquitin-like domain, UBL, ubiquitin specific protease, HOST-virus interaction, nucleus, protease; NMR {Homo sapiens} Back     alignment and structure
>1tyg_B YJBS; alpha beta barrel, protein-protein complex, THis, BIOS protein; 3.15A {Bacillus subtilis} SCOP: d.15.3.2 Back     alignment and structure
>3ivf_A Talin-1; FERM domain, cell membrane, cell projection, cytoskeleton, M phosphoprotein, cell adhesion, structural protein; 1.94A {Mus musculus} PDB: 2kma_A 2kc1_A Back     alignment and structure
>2yj3_A Copper-transporting ATPase; hydrolase, P-type ATPase, COPB, heavy metal translocation; 2.20A {Sulfolobus solfataricus} PDB: 2iye_A 2yj6_A* 2yj5_A* 2yj4_A* Back     alignment and structure
>1y8a_A Hypothetical protein AF1437; structural genomics, protein structu initiative, PSI, midwest center for structural genomics; 1.40A {Archaeoglobus fulgidus} SCOP: c.108.1.24 Back     alignment and structure
>1yns_A E-1 enzyme; hydrolase fold; HET: HPO; 1.70A {Homo sapiens} SCOP: c.108.1.22 PDB: 1zs9_A Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 332
d1ta0a_181 c.108.1.16 (A:) Carboxy-terminal domain RNA polyme 8e-26
d1v5ta_90 d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus mu 2e-15
d1v86a_95 d.15.1.1 (A:) hypothetical D7wsu128e protein {Mous 4e-15
d1wxva181 d.15.1.1 (A:7-87) Bag-family molecular chaperone r 1e-11
d1wgga_96 d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolas 6e-10
d1wx8a183 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus muscul 6e-08
d1j8ca_103 d.15.1.1 (A:) Ubiquitin-like N-terminal domain of 1e-07
d2bwfa173 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyc 2e-07
d1v2ya_105 d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik 2e-06
d1z2ma176 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protei 3e-06
d1yqba184 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapien 5e-06
d1wjna_97 d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse 6e-06
d1wiaa_95 d.15.1.1 (A:) Ubiquitin-like protein bab25500 (201 7e-06
d1uh6a_100 d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mous 1e-05
d1wgha_116 d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mous 2e-05
d1zkha186 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-t 8e-05
d1wgda_93 d.15.1.1 (A:) Homocysteine-responsive endoplasmic 1e-04
d1wx9a173 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 2e-04
d1z2ma276 d.15.1.1 (A:79-154) Interferon-induced 15 kDa prot 2e-04
d1v5oa_102 d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus mu 2e-04
d1ogwa_76 d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [Tax 3e-04
d1v6ea_95 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 4e-04
d1t0ya_90 d.15.1.1 (A:) Ubiquitin-like domain of tubulin fol 4e-04
d1wh3a_87 d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like 4e-04
d1oqya477 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 h 7e-04
d1bt0a_73 d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis t 8e-04
d1ttna180 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquit 0.001
d1wjua_100 d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human 0.002
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Length = 181 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

 Score = 99.3 bits (247), Expect = 8e-26
 Identities = 33/192 (17%), Positives = 70/192 (36%), Gaps = 35/192 (18%)

Query: 134 QYKIKLRNPSREGKKLLVLDIDYTL----FDHRSTAENPLQLM------------RPYLH 177
           QY +         K  +V+D+D TL    F   + A+  + +             RP++ 
Sbjct: 2   QYLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVD 61

Query: 178 EFLTAAYAEYDIMIWSATSMKWVELKMEELGVLTNPNYKITALLDHLAMITVQSDSRGIF 237
           EFL      ++ ++++A+  K+ +   + L    +      A L            R   
Sbjct: 62  EFLQRMGELFECVLFTASLAKYADPVADLL----DKWGAFRARL-----------FRESC 106

Query: 238 DCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLAIKPFRKAHANRDSDQELVKL 297
                  + D        +  ++ D+   ++V +P N + +  +     +  SD EL  L
Sbjct: 107 VFHRGNYVKDLSRLGRDLRRVLILDNSPASYVFHPDNAVPVASWF----DNMSDTELHDL 162

Query: 298 TQYLLAIADLDD 309
             +   ++ +DD
Sbjct: 163 LPFFEQLSRVDD 174
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 90 Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Length = 81 Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Length = 96 Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 83 Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Length = 103 Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Length = 73 Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Length = 105 Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Length = 84 Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Length = 97 Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Length = 100 Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Length = 116 Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Length = 86 Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Length = 93 Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Length = 73 Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Length = 102 Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Length = 76 Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Length = 95 Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Length = 90 Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Length = 87 Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Length = 77 Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Length = 73 Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Length = 80 Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Length = 100 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query332
d1ta0a_181 Carboxy-terminal domain RNA polymerase II polypept 100.0
d1v5ta_90 8430435i17rik protein {Mouse (Mus musculus) [TaxId 99.8
d1v86a_95 hypothetical D7wsu128e protein {Mouse (Mus musculu 99.79
d1wgga_96 Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (M 99.78
d2bwfa173 DSK2 {Baker's yeast (Saccharomyces cerevisiae) [Ta 99.74
d1wxva181 Bag-family molecular chaperone regulator-1 {Human 99.73
d1j8ca_103 Ubiquitin-like N-terminal domain of PLIC-2 {Human 99.7
d1yqba184 Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} 99.68
d1z2ma176 Interferon-induced 15 kDa protein {Human (Homo sap 99.68
d1wx8a183 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090] 99.67
d2zeqa178 Ubiquitin-like domain of parkin {Mouse (Mus muscul 99.67
d1z2ma276 Interferon-induced 15 kDa protein {Human (Homo sap 99.66
d1m94a_73 Ubiquitin-like modifier protein hub1 {Baker's yeas 99.65
d1bt0a_73 Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxI 99.65
d1wh3a_87 2'-5'-oligoadenylate synthetase-like protein, OASL 99.65
d1uh6a_100 Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculu 99.64
d1oqya477 Ubiquitin-like domain of Rad23 homolog A (Hhr23a) 99.64
d1ogwa_76 Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} 99.63
d1ttna180 Dendritic cell-derived ubiquitin-like protein {Hum 99.62
d1uela_95 Ubiquitin-like domain of Rad23 homolog B (Hhr23B) 99.59
d1wx9a173 Large proline-rich protein BAT3 {Human (Homo sapie 99.58
d2faza176 Ubiquitin-like PHD and RING finger domain-containi 99.58
d1wy8a176 Ubiquitin-like PHD and RING finger domain-containi 99.58
d1v5oa_102 1700011n24rik protein {Mouse (Mus musculus) [TaxId 99.58
d1wgha_116 Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculu 99.54
d1zkha186 Splicing factor 3 subunit 1, C-terminal domain {Hu 99.52
d1wiaa_95 Ubiquitin-like protein bab25500 (2010008E23Rik) {M 99.5
d1we6a_111 Splicing factor 3 subunit 1, C-terminal domain {Th 99.47
d1v2ya_105 Ubiquitin-like protein 3300001g02rik {Mouse (Mus m 99.47
d1wjua_100 NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens 99.47
d1se9a_101 Hypothetical protein At3g01050 {Thale cress (Arabi 99.4
d2c9wb1103 Elongin B {Human (Homo sapiens) [TaxId: 9606]} 99.35
d1v6ea_95 Ubiquitin-like domain of tubulin folding cofactor 99.32
d1wjna_97 Tubulin-folding protein TbcE {Mouse (Mus musculus) 99.32
d1wgda_93 Homocysteine-responsive endoplasmic reticulum-resi 99.31
d1t0ya_90 Ubiquitin-like domain of tubulin folding cofactor 99.26
d1euvb_79 SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomy 99.17
d1x1ma194 Ubiquitin-like protein 7 {Mouse (Mus musculus) [Ta 98.92
d1u7pa_164 Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mu 98.91
d2uyzb177 SUMO-1 (smt3 homologue) {Human (Homo sapiens) [Tax 98.71
d1te2a_218 Phosphatase YniC {Escherichia coli [TaxId: 562]} 98.7
d2go7a1204 Hypothetical protein SP2064 {Streptococcus pneumon 98.64
d2hdoa1207 Phosphoglycolate phosphatase {Lactobacillus planta 98.63
d2hsza1224 Phosphoglycolate phosphatase Gph {Haemophilus somn 98.59
d1x42a1230 Hypothetical protein PH0459 {Archaeon Pyrococcus h 98.57
d2hcfa1228 Hypothetical protein CT1708 {Chlorobium tepidum [T 98.53
d2fi1a1187 Putative hydrolase SP0805 {Streptococcus pneumonia 98.52
d2fdra1222 Hypothetical protein Atu0790 {Agrobacterium tumefa 98.5
d2ah5a1210 predicted phosphatase SP0104 {Streptococcus pneumo 98.48
d2gfha1247 N-acylneuraminate-9-phosphatase NANP {Mouse (Mus m 98.45
d1wf9a194 NPL4-like protein 1 {Thale cress (Arabidopsis thal 98.4
d1ltqa1149 Polynucleotide kinase, phosphatase domain {Bacteri 98.4
d1swva_257 Phosphonoacetaldehyde hydrolase {Bacillus cereus [ 98.36
d1nnla_217 Phosphoserine phosphatase {Human (Homo sapiens) [T 98.29
d1zrna_220 L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., s 98.28
d1o08a_221 beta-Phosphoglucomutase {Lactococcus lactis [TaxId 98.26
d1zs9a1253 E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} 98.22
d1cr6a1222 Epoxide hydrolase, N-terminal domain {Mouse (Mus m 98.18
d2feaa1226 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate 98.16
d2fpwa1161 Histidine biosynthesis bifunctional protein HisB, 98.09
d1qq5a_245 L-2-Haloacid dehalogenase, HAD {Xanthobacter autot 98.0
d2b0ca1197 Putative phosphatase YihX {Escherichia coli [TaxId 97.87
d1wm3a_72 SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} 97.76
d1zd3a1225 Epoxide hydrolase, N-terminal domain {Human (Homo 97.72
d2obba1122 Hypothetical protein BT0820 {Bacteroides thetaiota 97.56
d2o2xa1209 Hypothetical protein Mll2559 {Mesorhizobium loti [ 97.56
d1j97a_210 Phosphoserine phosphatase {Archaeon Methanococcus 97.38
d1xpja_124 Hypothetical protein VC0232 {Vibrio cholerae [TaxI 97.28
d2amya1243 Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 97.17
d2bdua1291 Cytosolic 5'-nucleotidase III {Mouse (Mus musculus 96.99
d1yj5a1195 5' polynucleotide kinase-3' phosphatase, middle do 96.91
d1rkqa_271 Hypothetical protein YidA {Escherichia coli [TaxId 96.9
d2gmwa1182 D,D-heptose 1,7-bisphosphate phosphatase GmhB {Esc 96.88
d1xvia_232 Putative mannosyl-3-phosphoglycerate phosphatase M 96.65
d1wr8a_230 Phosphoglycolate phosphatase, PGPase {Pyrococcus h 96.34
d1nrwa_ 285 Hypothetical protein YwpJ {Bacillus subtilis [TaxI 96.27
d2c4na1250 NagD {Escherichia coli [TaxId: 562]} 96.25
d1vjra_261 Hypothetical protein TM1742 {Thermotoga maritima [ 96.08
d2b30a1283 PFL1270w orthologue {Plasmodium vivax [TaxId: 5855 96.07
d1nf2a_267 Hypothetical protein TM0651 {Thermotoga maritima [ 96.03
d1rkua_206 Homoserine kinase ThrH {Pseudomonas aeruginosa [Ta 95.98
d1l6ra_225 Phosphoglycolate phosphatase, PGPase {Archaeon The 95.97
d2al3a176 Tether containing UBX domain for GLUT4 (Tug) {Mous 95.9
d1wzca1243 Putative mannosyl-3-phosphoglycerate phosphatase M 95.88
d1yv9a1253 Putative hydrolase EF1188 {Enterococcus faecalis [ 95.86
d1rlma_269 Sugar phosphatase SupH (YbiV) {Escherichia coli [T 95.83
d1u02a_229 Trehalose-6-phosphate phosphatase related protein 95.69
d1s2oa1244 Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 95.68
d1wvia_253 Putative phosphatase SMU.1415c {Streptococcus muta 95.55
d1h8ca_82 Fas-associated factor 1, Faf1 {Human (Homo sapiens 95.51
d2g80a1225 Protein UTR4 {Baker's yeast (Saccharomyces cerevis 95.4
d2fuea1244 Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 95.09
d1q92a_195 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo 94.19
d1ip9a_85 Bud emergence mediator Bemp1 {Baker's yeast (Sacch 93.75
d2rbka1260 Sugar-phosphate phosphatase BT4131 {Bacteroides th 93.65
d2cr5a196 UBX domain-containing protein 6 (Reproduction 8) { 93.07
d1i42a_89 p47 {Rat (Rattus norvegicus) [TaxId: 10116]} 92.07
d1wj4a_124 Hypothetical protein KIAA0794 {Human (Homo sapiens 91.23
d2b82a1209 Class B acid phosphatase, AphA {Escherichia coli [ 89.22
d1vjka_88 Molybdopterin synthase subunit MoaD {Pyrococcus fu 89.01
d2b8ea1135 Cation-transporting ATPase {Archaeon Archaeoglobus 85.78
d1oeya_82 Neutrophil cytosol factor 2 (p67phox component of 82.97
>d1ta0a_ c.108.1.16 (A:) Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: HAD-like
superfamily: HAD-like
family: NLI interacting factor-like phosphatase
domain: Carboxy-terminal domain RNA polymerase II polypeptide A small phosphatase 1, NRAMP1
species: Human (Homo sapiens) [TaxId: 9606]

Probab=100.00  E-value=4.8e-38  Score=273.34  Aligned_cols=162  Identities=19%  Similarity=0.274  Sum_probs=137.8

Q ss_pred             hcccccCCCcCCcceEEEecCCceEeccCCCC----------------CCceecCCcHHHHHHHHHhCCcEEEEcCCcHH
Q 042485          135 YKIKLRNPSREGKKLLVLDIDYTLFDHRSTAE----------------NPLQLMRPYLHEFLTAAYAEYDIMIWSATSMK  198 (332)
Q Consensus       135 ~~~~~l~~~~~~kk~LVLDLD~TLi~~~~~~~----------------~~~~~~RP~l~eFL~~l~~~yeivI~Tas~~~  198 (332)
                      +-+|...+...+|++||||||||||||.....                .++++.|||+++||++|+++|+|+||||+++.
T Consensus         3 ~llp~~~~~~~~k~~LVLDLDeTLihs~~~~~~~~~~~~~~~~~~~~~~~~v~~RP~l~eFL~~l~~~yei~I~Ta~~~~   82 (181)
T d1ta0a_           3 YLLPEAKAQDSDKICVVIDLDETLVHSSFKPVNNADFIIPVEIDGVVHQVYVLKRPHVDEFLQRMGELFECVLFTASLAK   82 (181)
T ss_dssp             CSSCCCCGGGTTSCEEEECCBTTTEEEESSCCTTCSEEEEEEETTEEEEEEEEECTTHHHHHHHHHHHSEEEEECSSCHH
T ss_pred             ccCCCCCcccCCCeEEEEeCCCCEEccccCCCCCccceeeecccceeeeeEEecCCCHHHHHHHHHhceEEEEEcCCcHH
Confidence            34566666667999999999999999875321                24678999999999999999999999999999


Q ss_pred             HHHHHHHHhCCCCCCCceEEEEec-CCceEEEeeCCCCCccccccccccccCCCcCCCCcEEEEeCCccccccCCCCeee
Q 042485          199 WVELKMEELGVLTNPNYKITALLD-HLAMITVQSDSRGIFDCKPLGLIWDQFPEFYSSKNTIMFDDLRRNFVMNPQNGLA  277 (332)
Q Consensus       199 ya~~~l~~l~~~~~~~~~~~~~~d-~~~~~~~~~~~~g~~~~KdL~~i~~~~~~~~~~~~~iivDD~~~~~~~~p~Ngi~  277 (332)
                      ||+.+++.+    +|...+.+.+. .+|.++      +..++|||+.+     + +++++||||||++.+|..||+|||+
T Consensus        83 YA~~il~~l----dp~~~~~~~~~r~~c~~~------~~~~~KdL~~l-----~-~~l~~vvivDd~~~~~~~~~~N~I~  146 (181)
T d1ta0a_          83 YADPVADLL----DKWGAFRARLFRESCVFH------RGNYVKDLSRL-----G-RDLRRVLILDNSPASYVFHPDNAVP  146 (181)
T ss_dssp             HHHHHHHHH----CSSCCEEEEECGGGSEEE------TTEEECCGGGS-----C-SCGGGEEEECSCGGGGTTCGGGBCC
T ss_pred             HHHHHHHHh----ccCCceeEEEEeeeeeec------CCcccccHhhc-----C-CCHHHeEEEcCChhhhhcCccCeeE
Confidence            999999987    56666666664 344431      33578999999     5 4999999999999999999999999


Q ss_pred             eccccCCcCCCCCchHHHHHHHHHHhccCCCCchhHhHh
Q 042485          278 IKPFRKAHANRDSDQELVKLTQYLLAIADLDDLSNLDHG  316 (332)
Q Consensus       278 I~~f~~~~~~~~~D~~L~~L~~~L~~l~~~~Dvr~~~~~  316 (332)
                      |++|.+    +.+|++|..|++||+.|++++|||++++|
T Consensus       147 I~~f~~----~~~D~eL~~l~~~L~~l~~~~DVR~~l~~  181 (181)
T d1ta0a_         147 VASWFD----NMSDTELHDLLPFFEQLSRVDDVYSVLRQ  181 (181)
T ss_dssp             CCCCSS----CTTCCHHHHHHHHHHHHTTCSCHHHHHCC
T ss_pred             ecCcCC----CCCcHHHHHHHHHHHHHccCCcHHHHhcC
Confidence            999998    56899999999999999999999999874
>d1v5ta_ d.15.1.1 (A:) 8430435i17rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1v86a_ d.15.1.1 (A:) hypothetical D7wsu128e protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgga_ d.15.1.1 (A:) Ubiquitin carboxyl-terminal hydrolase 14 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2bwfa1 d.15.1.1 (A:2-74) DSK2 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1wxva1 d.15.1.1 (A:7-87) Bag-family molecular chaperone regulator-1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1j8ca_ d.15.1.1 (A:) Ubiquitin-like N-terminal domain of PLIC-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1yqba1 d.15.1.1 (A:15-98) Ubiquilin-3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1z2ma1 d.15.1.1 (A:3-78) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx8a1 d.15.1.1 (A:8-90) 4931431F19Rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2zeqa1 d.15.1.1 (A:1-78) Ubiquitin-like domain of parkin {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1z2ma2 d.15.1.1 (A:79-154) Interferon-induced 15 kDa protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1m94a_ d.15.1.1 (A:) Ubiquitin-like modifier protein hub1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d1bt0a_ d.15.1.1 (A:) Rub1 {Mouse-ear cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1wh3a_ d.15.1.1 (A:) 2'-5'-oligoadenylate synthetase-like protein, OASL {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uh6a_ d.15.1.1 (A:) Ubiquitin-like protein 5, ubl5 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1oqya4 d.15.1.1 (A:1-77) Ubiquitin-like domain of Rad23 homolog A (Hhr23a) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ogwa_ d.15.1.1 (A:) Ubiquitin {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ttna1 d.15.1.1 (A:21-100) Dendritic cell-derived ubiquitin-like protein {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1uela_ d.15.1.1 (A:) Ubiquitin-like domain of Rad23 homolog B (Hhr23B) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wx9a1 d.15.1.1 (A:8-80) Large proline-rich protein BAT3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2faza1 d.15.1.1 (A:1-76) Ubiquitin-like PHD and RING finger domain-containing protein 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wy8a1 d.15.1.1 (A:8-83) Ubiquitin-like PHD and RING finger domain-containing protein 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v5oa_ d.15.1.1 (A:) 1700011n24rik protein {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgha_ d.15.1.1 (A:) Ubiquitin-like protein 3, Ubl3 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1zkha1 d.15.1.1 (A:1-86) Splicing factor 3 subunit 1, C-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1wiaa_ d.15.1.1 (A:) Ubiquitin-like protein bab25500 (2010008E23Rik) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1we6a_ d.15.1.1 (A:) Splicing factor 3 subunit 1, C-terminal domain {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1v2ya_ d.15.1.1 (A:) Ubiquitin-like protein 3300001g02rik {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjua_ d.15.1.1 (A:) NEDD8 ultimate buster-1, NUB1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1se9a_ d.15.1.1 (A:) Hypothetical protein At3g01050 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d2c9wb1 d.15.1.1 (B:2-104) Elongin B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1v6ea_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wjna_ d.15.1.1 (A:) Tubulin-folding protein TbcE {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wgda_ d.15.1.1 (A:) Homocysteine-responsive endoplasmic reticulum-resident ubiquitin-like domain member 1 protein, HERPUD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1t0ya_ d.15.1.1 (A:) Ubiquitin-like domain of tubulin folding cofactor B {Nematode (Caenorhabditis elegans) [TaxId: 6239]} Back     information, alignment and structure
>d1euvb_ d.15.1.1 (B:) SUMO-1 (smt3 homologue) {Baker's yeast (Saccharomyces cerevisiae), smt3 [TaxId: 4932]} Back     information, alignment and structure
>d1x1ma1 d.15.1.1 (A:8-101) Ubiquitin-like protein 7 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1u7pa_ c.108.1.17 (A:) Magnesium-dependent phosphatase-1, Mdp1 {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2uyzb1 d.15.1.1 (B:20-96) SUMO-1 (smt3 homologue) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1te2a_ c.108.1.6 (A:) Phosphatase YniC {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2go7a1 c.108.1.6 (A:3-206) Hypothetical protein SP2064 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2hdoa1 c.108.1.6 (A:1-207) Phosphoglycolate phosphatase {Lactobacillus plantarum [TaxId: 1590]} Back     information, alignment and structure
>d2hsza1 c.108.1.6 (A:1-224) Phosphoglycolate phosphatase Gph {Haemophilus somnus [TaxId: 731]} Back     information, alignment and structure
>d1x42a1 c.108.1.1 (A:1-230) Hypothetical protein PH0459 {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d2hcfa1 c.108.1.6 (A:2-229) Hypothetical protein CT1708 {Chlorobium tepidum [TaxId: 1097]} Back     information, alignment and structure
>d2fi1a1 c.108.1.3 (A:4-190) Putative hydrolase SP0805 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2fdra1 c.108.1.6 (A:3-224) Hypothetical protein Atu0790 {Agrobacterium tumefaciens [TaxId: 358]} Back     information, alignment and structure
>d2ah5a1 c.108.1.6 (A:1-210) predicted phosphatase SP0104 {Streptococcus pneumoniae [TaxId: 1313]} Back     information, alignment and structure
>d2gfha1 c.108.1.6 (A:1-247) N-acylneuraminate-9-phosphatase NANP {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wf9a1 d.15.1.1 (A:8-101) NPL4-like protein 1 {Thale cress (Arabidopsis thaliana) [TaxId: 3702]} Back     information, alignment and structure
>d1ltqa1 c.108.1.9 (A:153-301) Polynucleotide kinase, phosphatase domain {Bacteriophage T4 [TaxId: 10665]} Back     information, alignment and structure
>d1swva_ c.108.1.3 (A:) Phosphonoacetaldehyde hydrolase {Bacillus cereus [TaxId: 1396]} Back     information, alignment and structure
>d1nnla_ c.108.1.4 (A:) Phosphoserine phosphatase {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zrna_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Pseudomonas sp., strain YL [TaxId: 306]} Back     information, alignment and structure
>d1o08a_ c.108.1.6 (A:) beta-Phosphoglucomutase {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1zs9a1 c.108.1.22 (A:4-256) E-1 enzyme {Human(Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1cr6a1 c.108.1.2 (A:4-225) Epoxide hydrolase, N-terminal domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d2feaa1 c.108.1.20 (A:2-227) 2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase MtnX {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2fpwa1 c.108.1.19 (A:3-163) Histidine biosynthesis bifunctional protein HisB, phosphatase domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1qq5a_ c.108.1.1 (A:) L-2-Haloacid dehalogenase, HAD {Xanthobacter autotrophicus [TaxId: 280]} Back     information, alignment and structure
>d2b0ca1 c.108.1.2 (A:8-204) Putative phosphatase YihX {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wm3a_ d.15.1.1 (A:) SUMO-2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1zd3a1 c.108.1.2 (A:2-224) Epoxide hydrolase, N-terminal domain {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2obba1 c.108.1.25 (A:1-122) Hypothetical protein BT0820 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2o2xa1 c.108.1.19 (A:8-216) Hypothetical protein Mll2559 {Mesorhizobium loti [TaxId: 381]} Back     information, alignment and structure
>d1j97a_ c.108.1.4 (A:) Phosphoserine phosphatase {Archaeon Methanococcus jannaschii [TaxId: 2190]} Back     information, alignment and structure
>d1xpja_ c.108.1.18 (A:) Hypothetical protein VC0232 {Vibrio cholerae [TaxId: 666]} Back     information, alignment and structure
>d2amya1 c.108.1.10 (A:4-246) Phosphomannomutase 2 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2bdua1 c.108.1.21 (A:7-297) Cytosolic 5'-nucleotidase III {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1yj5a1 c.108.1.9 (A:144-338) 5' polynucleotide kinase-3' phosphatase, middle domain {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1rkqa_ c.108.1.10 (A:) Hypothetical protein YidA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2gmwa1 c.108.1.19 (A:24-205) D,D-heptose 1,7-bisphosphate phosphatase GmhB {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1xvia_ c.108.1.10 (A:) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1wr8a_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1nrwa_ c.108.1.10 (A:) Hypothetical protein YwpJ {Bacillus subtilis [TaxId: 1423]} Back     information, alignment and structure
>d2c4na1 c.108.1.14 (A:1-250) NagD {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjra_ c.108.1.14 (A:) Hypothetical protein TM1742 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d2b30a1 c.108.1.10 (A:18-300) PFL1270w orthologue {Plasmodium vivax [TaxId: 5855]} Back     information, alignment and structure
>d1nf2a_ c.108.1.10 (A:) Hypothetical protein TM0651 {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1rkua_ c.108.1.11 (A:) Homoserine kinase ThrH {Pseudomonas aeruginosa [TaxId: 287]} Back     information, alignment and structure
>d1l6ra_ c.108.1.10 (A:) Phosphoglycolate phosphatase, PGPase {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d2al3a1 d.15.1.2 (A:10-85) Tether containing UBX domain for GLUT4 (Tug) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1wzca1 c.108.1.10 (A:1-243) Putative mannosyl-3-phosphoglycerate phosphatase MPGP (YedP) {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1yv9a1 c.108.1.14 (A:4-256) Putative hydrolase EF1188 {Enterococcus faecalis [TaxId: 1351]} Back     information, alignment and structure
>d1rlma_ c.108.1.10 (A:) Sugar phosphatase SupH (YbiV) {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1u02a_ c.108.1.15 (A:) Trehalose-6-phosphate phosphatase related protein {Archaeon Thermoplasma acidophilum [TaxId: 2303]} Back     information, alignment and structure
>d1s2oa1 c.108.1.10 (A:1-244) Sucrose-phosphatase Slr0953 {Synechocystis sp. pcc 6803 [TaxId: 1148]} Back     information, alignment and structure
>d1wvia_ c.108.1.14 (A:) Putative phosphatase SMU.1415c {Streptococcus mutans [TaxId: 1309]} Back     information, alignment and structure
>d1h8ca_ d.15.1.2 (A:) Fas-associated factor 1, Faf1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2g80a1 c.108.1.22 (A:17-241) Protein UTR4 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2fuea1 c.108.1.10 (A:13-256) Phosphomannomutase 1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1q92a_ c.108.1.8 (A:) 5'(3')-deoxyribonucleotidase (dNT-2) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1ip9a_ d.15.2.2 (A:) Bud emergence mediator Bemp1 {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2rbka1 c.108.1.10 (A:2-261) Sugar-phosphate phosphatase BT4131 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d2cr5a1 d.15.1.2 (A:8-103) UBX domain-containing protein 6 (Reproduction 8) {Mouse (Mus musculus) [TaxId: 10090]} Back     information, alignment and structure
>d1i42a_ d.15.1.2 (A:) p47 {Rat (Rattus norvegicus) [TaxId: 10116]} Back     information, alignment and structure
>d1wj4a_ d.15.1.2 (A:) Hypothetical protein KIAA0794 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2b82a1 c.108.1.12 (A:4-212) Class B acid phosphatase, AphA {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1vjka_ d.15.3.1 (A:) Molybdopterin synthase subunit MoaD {Pyrococcus furiosus [TaxId: 2261]} Back     information, alignment and structure
>d2b8ea1 c.108.1.7 (A:416-434,A:548-663) Cation-transporting ATPase {Archaeon Archaeoglobus fulgidus [TaxId: 2234]} Back     information, alignment and structure
>d1oeya_ d.15.2.2 (A:) Neutrophil cytosol factor 2 (p67phox component of NADPH oxidase) {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure