Citrus Sinensis ID: 042560

Local Sequence Feature Prediction

Prediction and Method	Result

Residue Number Marker

Protein Sequence

Secondary Structure (Consensus)

Disordered Region (Consensus)

Transmembrane Helix (Consensus)

Signal Peptide (Consensus)

Coiled Coil (COILS)

--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------200-------210-------220-------230-------240-------250-------260-------270-------280-------

MDLVNEFLNIVAPVLTIAILPSFLPLYLLFKFLHFVIRTINAEDVAGKVVLITGASSGIGKHLAYEYARRRARLVLVARRERQLREVADQAELMGSPFALAIPADVSKVEDCKHFVDVTMEHFGRLDHLVTNAGVVPMCLFEDYTDITKPAPAMDINFWGSAYGTYFAIPYLKQTKGKIIVVASAAGWLPPPRMSFYNASKAAKIALYETLRVEFGGDIGITIVTPGLIESEITGGKFLNKNGKLEVDQEIRDVQISLLPVQPTEECAKAIVNSACRGDRYLTQPSW

cHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHccccccccccEEEEEccccHHHHHHHHHHHHcccEEEEEcccHHHHHHHHHHHHHcccccEEEEEcccccHHHHHHHHHHHHHHcccccEEEEcccccccccccccccccccHHHHHHHHHHHHHHHHHHHHHHHHcccEEEEEccccccccccccHHHHHHHHHHHHHHHHHHHHHccccEEEEECcccEEccccccccccccccHHHHHHHHHHHHcccccccHHHHHHHHHHHHccccccCCcccc

*DLVNEFLNIVAPVLTIAILPSFLPLYLLFKFLHFVIRTINAEDVAGKVVLITGASSGIGKHLAYEYARRRARLVLVARRERQLREVADQAELMGSPFALAIPADVSKVEDCKHFVDVTMEHFGRLDHLVTNAGVVPMCLFEDYTDITKPAPAMDINFWGSAYGTYFAIPYLKQTKGKIIVVASAAGWLPPPRMSFYNASKAAKIALYETLRVEFGGDIGITIVTPGLIESEITGGKFLNKNGKLEVDQEIRDVQISLLPVQPTEECAKAIVNSACRGDRYLTQPSW

xxxxxxHHHHHHHHHHHHHHHHHHHHHHHHxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries

Annotation	Function Description	Confidence Level	Reference Protein
Corticosteroid 11-beta-dehydrogenase isozyme 1	Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone. Catalyzes reversibly the conversion of 7-ketocholesterol to 7-beta-hydroxycholesterol. In intact cells, the reaction runs only in one direction, from 7-ketocholesterol to 7-beta-hydroxycholesterol.	probable	Q6QLL4
Dehydrogenase/reductase SDR family protein 7-like	Putative oxidoreductase.	probable	Q8T197
Corticosteroid 11-beta-dehydrogenase isozyme 1	Catalyzes reversibly the conversion of cortisol to the inactive metabolite cortisone.	probable	P50172

Prediction of Enzyme Commission Number

No confident prediction of EC number!

Spatial Structural Prediction

Structural Models Based on Templates

Template: 3V2H, chain A
Confidence level:very confident
Coverage over the Query: 47-231,255-287
View the alignment between query and template
View the model in PyMOL