Citrus Sinensis ID: 042631

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60------
IADYLRSRGVRFEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVRP
cHHHHHHcccEEEEEEcccccccccEEEEEcccccEEcccccEEEEEcHHHHHHHHHHHHcccccc
cHHHHHHcccEEEEEccccccccccccEcccccccEEccHHEEEEcccHHHHHHHHHHHHcccccc
iadylrsrgvrfediwgnhglggrmrsrmirpqpqifghaAQFITVNNSRFCLLINGwlerglvrp
iadylrsrgvrfediwgnhglggrMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINgwlerglvrp
IADYLRSRGVRFEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVRP
*******RGVRFEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGL***
*ADY***RGVRFEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVR*
IADYLRSRGVRFEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVRP
IADYLRSRGVRFEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVR*
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiiiiiiiiiiiiiiiiiiiiihhhhhhhhhhhhhhhhhhhhoooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooohhhhhhhhhhhhhhhhiiii
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
IADYLRSRGVRFEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVRP
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

No hits with e-value below 0.001 by BLAST

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
296087896 518 unnamed protein product [Vitis vinifera] 0.939 0.119 0.597 1e-12
225463946 467 PREDICTED: uncharacterized protein LOC10 0.939 0.132 0.597 1e-12
255580905 467 conserved hypothetical protein [Ricinus 0.893 0.126 0.562 1e-12
224130614 496 predicted protein [Populus trichocarpa] 0.893 0.118 0.578 9e-12
18396966 486 FAD/NAD(P)-binding oxidoreductase domain 0.893 0.121 0.562 5e-11
297828968 485 oxidoreductase [Arabidopsis lyrata subsp 0.893 0.121 0.562 5e-11
449483109 536 PREDICTED: uncharacterized protein LOC10 0.893 0.110 0.5 1e-08
449443231 545 PREDICTED: uncharacterized protein LOC10 0.893 0.108 0.5 1e-08
414868816 384 TPA: hypothetical protein ZEAMMB73_11144 0.939 0.161 0.514 1e-07
357116570 477 PREDICTED: uncharacterized protein LOC10 0.939 0.129 0.5 3e-07
>gi|296087896|emb|CBI35179.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
 Score = 77.0 bits (188), Expect = 1e-12,   Method: Composition-based stats.
 Identities = 40/67 (59%), Positives = 47/67 (70%), Gaps = 5/67 (7%)

Query: 2   ADYLRSRGVR---FEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGW 58
           A YL  RGVR   F+   G HGLGGRM +RMI PQ  IF HAAQF TV + RF  L++GW
Sbjct: 89  ALYLEKRGVRSTVFDT--GVHGLGGRMGTRMIDPQSLIFDHAAQFFTVGDPRFAQLVDGW 146

Query: 59  LERGLVR 65
           LE+GLV+
Sbjct: 147 LEKGLVQ 153

Source: Vitis vinifera

Species: Vitis vinifera

Genus: Vitis

Family: Vitaceae

Order: Vitales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|225463946|ref|XP_002268010.1| PREDICTED: uncharacterized protein LOC100241002 [Vitis vinifera] Back     alignment and taxonomy information
>gi|255580905|ref|XP_002531271.1| conserved hypothetical protein [Ricinus communis] gi|223529104|gb|EEF31084.1| conserved hypothetical protein [Ricinus communis] Back     alignment and taxonomy information
>gi|224130614|ref|XP_002328333.1| predicted protein [Populus trichocarpa] gi|222838048|gb|EEE76413.1| predicted protein [Populus trichocarpa] Back     alignment and taxonomy information
>gi|18396966|ref|NP_566235.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] gi|6175169|gb|AAF04895.1|AC011437_10 unknown protein [Arabidopsis thaliana] gi|15215628|gb|AAK91359.1| AT3g04650/F7O18_13 [Arabidopsis thaliana] gi|28416461|gb|AAO42761.1| At3g04650/F7O18_13 [Arabidopsis thaliana] gi|332640593|gb|AEE74114.1| FAD/NAD(P)-binding oxidoreductase domain-containing protein [Arabidopsis thaliana] Back     alignment and taxonomy information
>gi|297828968|ref|XP_002882366.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] gi|297328206|gb|EFH58625.1| oxidoreductase [Arabidopsis lyrata subsp. lyrata] Back     alignment and taxonomy information
>gi|449483109|ref|XP_004156495.1| PREDICTED: uncharacterized protein LOC101226129 [Cucumis sativus] Back     alignment and taxonomy information
>gi|449443231|ref|XP_004139383.1| PREDICTED: uncharacterized protein LOC101219713 [Cucumis sativus] Back     alignment and taxonomy information
>gi|414868816|tpg|DAA47373.1| TPA: hypothetical protein ZEAMMB73_111446, partial [Zea mays] Back     alignment and taxonomy information
>gi|357116570|ref|XP_003560053.1| PREDICTED: uncharacterized protein LOC100824134 [Brachypodium distachyon] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query66
TAIR|locus:2084903 486 AT3G04650 [Arabidopsis thalian 0.924 0.125 0.564 4.3e-12
TAIR|locus:2084903 AT3G04650 [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 171 (65.3 bits), Expect = 4.3e-12, P = 4.3e-12
 Identities = 35/62 (56%), Positives = 45/62 (72%)

Query:     5 LRSRGVRFEDI-WGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGL 63
             L +RGV+      G HGLGGR+ +R+I PQ  IF HAAQF T ++SRF  L++GWLE+GL
Sbjct:   111 LEARGVQSTVFDTGIHGLGGRLGTRIIEPQGLIFDHAAQFFTADDSRFIKLVDGWLEKGL 170

Query:    64 VR 65
             VR
Sbjct:   171 VR 172


Parameters:
  V=100
  filter=SEG
  E=0.001

  ctxfactor=1.00

  Query                        -----  As Used  -----    -----  Computed  ----
  Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H
   +0      0   BLOSUM62        0.330   0.146   0.487    same    same    same
               Q=9,R=2         0.244   0.0300  0.180     n/a     n/a     n/a

  Query
  Frame  MatID  Length  Eff.Length     E     S W   T  X   E2     S2
   +0      0       66        66   0.00091  102 3  11 22  0.38    28
                                                     29  0.48    28


Statistics:

  Database:  /share/blast/go-seqdb.fasta
   Title:  go_20130330-seqdb.fasta
   Posted:  5:47:42 AM PDT Apr 1, 2013
   Created:  5:47:42 AM PDT Apr 1, 2013
   Format:  XDF-1
   # of letters in database:  169,044,731
   # of sequences in database:  368,745
   # of database sequences satisfying E:  1
  No. of states in DFA:  539 (57 KB)
  Total size of DFA:  100 KB (2070 KB)
  Time to generate neighborhood:  0.00u 0.00s 0.00t   Elapsed:  00:00:00
  No. of threads or processors used:  24
  Search cpu time:  6.44u 0.19s 6.63t   Elapsed:  00:00:01
  Total cpu time:  6.44u 0.19s 6.63t   Elapsed:  00:00:01
  Start:  Fri May 10 17:31:53 2013   End:  Fri May 10 17:31:54 2013
GO:0005739 "mitochondrion" evidence=ISM
GO:0009507 "chloroplast" evidence=IDA

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Fail to connect to STRING server

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
COG3380 331 COG3380, COG3380, Predicted NAD/FAD-dependent oxid 4e-04
>gnl|CDD|225915 COG3380, COG3380, Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
 Score = 35.9 bits (83), Expect = 4e-04
 Identities = 14/48 (29%), Positives = 21/48 (43%), Gaps = 2/48 (4%)

Query: 19 HGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVRP 66
           G+GGR+ +R  R     F H AQ+    +  F   +    + GLV  
Sbjct: 34 RGVGGRLATR--RLDGGRFDHGAQYFKPRDELFLRAVEALRDDGLVDV 79

Length = 331

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 66
COG3380 331 Predicted NAD/FAD-dependent oxidoreductase [Genera 99.8
PF1345068 NAD_binding_8: NAD(P)-binding Rossmann-like domain 98.72
PF01593 450 Amino_oxidase: Flavin containing amine oxidoreduct 98.29
TIGR03467 419 HpnE squalene-associated FAD-dependent desaturase. 98.13
PLN02576 496 protoporphyrinogen oxidase 97.97
TIGR00562 462 proto_IX_ox protoporphyrinogen oxidase. This prote 97.86
PRK11883 451 protoporphyrinogen oxidase; Reviewed 97.86
PRK07208 479 hypothetical protein; Provisional 97.75
PLN02268 435 probable polyamine oxidase 97.74
PRK12416 463 protoporphyrinogen oxidase; Provisional 97.52
TIGR02731 453 phytoene_desat phytoene desaturase. Plants and cya 97.35
TIGR02734 502 crtI_fam phytoene desaturase. Phytoene is converte 97.27
PRK07233 434 hypothetical protein; Provisional 97.22
COG1233 487 Phytoene dehydrogenase and related proteins [Secon 97.12
PLN02568 539 polyamine oxidase 97.11
TIGR02733 492 desat_CrtD C-3',4' desaturase CrtD. Members of thi 97.08
KOG0029 501 consensus Amine oxidase [Secondary metabolites bio 97.08
TIGR02732 474 zeta_caro_desat carotene 7,8-desaturase. Carotene 96.9
PLN02676 487 polyamine oxidase 96.66
PLN02612 567 phytoene desaturase 96.64
PLN02529 738 lysine-specific histone demethylase 1 96.15
PLN02328 808 lysine-specific histone demethylase 1 homolog 95.96
PLN03000 881 amine oxidase 95.75
COG1231 450 Monoamine oxidase [Amino acid transport and metabo 95.39
TIGR02730 493 carot_isom carotene isomerase. Members of this fam 95.14
KOG0685 498 consensus Flavin-containing amine oxidase [Coenzym 94.82
COG1232 444 HemY Protoporphyrinogen oxidase [Coenzyme metaboli 94.58
PLN02487 569 zeta-carotene desaturase 94.57
TIGR00031 377 UDP-GALP_mutase UDP-galactopyranose mutase. The ge 94.16
COG3349 485 Uncharacterized conserved protein [Function unknow 90.66
PLN02976 1713 amine oxidase 90.53
PTZ00363 443 rab-GDP dissociation inhibitor; Provisional 81.98
>COG3380 Predicted NAD/FAD-dependent oxidoreductase [General function prediction only] Back     alignment and domain information 
Probab=99.80  E-value=5.3e-20  Score=134.34  Aligned_cols=60  Identities=32%  Similarity=0.528  Sum_probs=56.9

Q ss_pred             hhHHHHCCCc---cccccCCCCcccccceeecCCCCeeecccCceeeeCCHHHHHHHHHHHhCCcccC
Q 042631            2 ADYLRSRGVR---FEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGLVRP   66 (66)
Q Consensus         2 A~~L~~~G~~---fEk~~g~rg~GGRmaTRr~~~~~~~~DhGAqyft~~~~~f~~~v~~~~~~g~v~~   66 (66)
                      |..|+++|++   |||   +||+||||+|||.++.  .||||||||+++++.|.++|+.|.++|+|++
T Consensus        17 A~~L~~aG~~vtV~eK---g~GvGGRlAtRRl~~g--~~DhGAqYfk~~~~~F~~~Ve~~~~~glV~~   79 (331)
T COG3380          17 AYALREAGREVTVFEK---GRGVGGRLATRRLDGG--RFDHGAQYFKPRDELFLRAVEALRDDGLVDV   79 (331)
T ss_pred             HHHHHhcCcEEEEEEc---CCCcccchheeccCCc--cccccceeecCCchHHHHHHHHHHhCCceee
Confidence            6789999988   999   9999999999999987  5999999999999999999999999999864

>PF13450 NAD_binding_8: NAD(P)-binding Rossmann-like domain; PDB: 3KA7_A 1V0J_D 3INR_B 3KYB_B 3GF4_A 2BI8_A 3INT_B 1WAM_A 2BI7_A 3MJ4_G Back     alignment and domain information
>PF01593 Amino_oxidase: Flavin containing amine oxidoreductase This is a subset of the Pfam family; InterPro: IPR002937 This entry consists of various amine oxidases, including maize polyamine oxidase (PAO) [], L-amino acid oxidases (LAO) and various flavin containing monoamine oxidases (MAO) Back     alignment and domain information
>TIGR03467 HpnE squalene-associated FAD-dependent desaturase Back     alignment and domain information
>PLN02576 protoporphyrinogen oxidase Back     alignment and domain information
>TIGR00562 proto_IX_ox protoporphyrinogen oxidase Back     alignment and domain information
>PRK11883 protoporphyrinogen oxidase; Reviewed Back     alignment and domain information
>PRK07208 hypothetical protein; Provisional Back     alignment and domain information
>PLN02268 probable polyamine oxidase Back     alignment and domain information
>PRK12416 protoporphyrinogen oxidase; Provisional Back     alignment and domain information
>TIGR02731 phytoene_desat phytoene desaturase Back     alignment and domain information
>TIGR02734 crtI_fam phytoene desaturase Back     alignment and domain information
>PRK07233 hypothetical protein; Provisional Back     alignment and domain information
>COG1233 Phytoene dehydrogenase and related proteins [Secondary metabolites biosynthesis, transport, and catabolism] Back     alignment and domain information
>PLN02568 polyamine oxidase Back     alignment and domain information
>TIGR02733 desat_CrtD C-3',4' desaturase CrtD Back     alignment and domain information
>KOG0029 consensus Amine oxidase [Secondary metabolites biosynthesis, transport and catabolism] Back     alignment and domain information
>TIGR02732 zeta_caro_desat carotene 7,8-desaturase Back     alignment and domain information
>PLN02676 polyamine oxidase Back     alignment and domain information
>PLN02612 phytoene desaturase Back     alignment and domain information
>PLN02529 lysine-specific histone demethylase 1 Back     alignment and domain information
>PLN02328 lysine-specific histone demethylase 1 homolog Back     alignment and domain information
>PLN03000 amine oxidase Back     alignment and domain information
>COG1231 Monoamine oxidase [Amino acid transport and metabolism] Back     alignment and domain information
>TIGR02730 carot_isom carotene isomerase Back     alignment and domain information
>KOG0685 consensus Flavin-containing amine oxidase [Coenzyme transport and metabolism] Back     alignment and domain information
>COG1232 HemY Protoporphyrinogen oxidase [Coenzyme metabolism] Back     alignment and domain information
>PLN02487 zeta-carotene desaturase Back     alignment and domain information
>TIGR00031 UDP-GALP_mutase UDP-galactopyranose mutase Back     alignment and domain information
>COG3349 Uncharacterized conserved protein [Function unknown] Back     alignment and domain information
>PLN02976 amine oxidase Back     alignment and domain information
>PTZ00363 rab-GDP dissociation inhibitor; Provisional Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

No homologous structure with e-value below 0.005

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query66
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 4e-05

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
3kkj_A 336 Amine oxidase, flavin-containing; oxidoreductase, 99.15
3qj4_A 342 Renalase; FAD/NAD(P)-binding rossmann fold superfa 98.84
1yvv_A 336 Amine oxidase, flavin-containing; oxidoreductase, 98.33
2ivd_A 478 PPO, PPOX, protoporphyrinogen oxidase; porphyrin b 98.12
2b9w_A 424 Putative aminooxidase; isomerase, conjugated linol 97.85
2vvm_A 495 Monoamine oxidase N; FAD, peroxisome, flavoprotein 97.8
4gde_A 513 UDP-galactopyranose mutase; flavin adenine dinucle 97.79
2yg5_A 453 Putrescine oxidase; oxidoreductase, flavin; HET: F 97.64
1s3e_A 520 Amine oxidase [flavin-containing] B; human monoami 97.61
1sez_A 504 Protoporphyrinogen oxidase, mitochondrial; FAD-bin 97.58
3i6d_A 470 Protoporphyrinogen oxidase; protein-inhibitor comp 97.45
3lov_A 475 Protoporphyrinogen oxidase; structural genomics, J 97.36
1rsg_A 516 FMS1 protein; FAD binding motif, oxidoreductase; H 97.33
4dgk_A 501 Phytoene dehydrogenase; the FAD/NAD(P)-binding ros 97.32
3k7m_X 431 6-hydroxy-L-nicotine oxidase; enantiomeric substra 97.32
1v0j_A 399 UDP-galactopyranose mutase; flavoprotein, isomeras 97.27
2e1m_A 376 L-glutamate oxidase; L-amino acid oxidase, FAD, L- 97.22
3nrn_A 421 Uncharacterized protein PF1083; alpha-beta protein 97.21
2bi7_A 384 UDP-galactopyranose mutase; FAD, flavoprotein, iso 97.16
1i8t_A 367 UDP-galactopyranose mutase; rossman fold, FAD, con 97.01
2iid_A 498 L-amino-acid oxidase; flavoenzyme, FAD binding dom 96.94
3nks_A 477 Protoporphyrinogen oxidase; FAD containing protein 96.93
4dsg_A 484 UDP-galactopyranose mutase; rossmann fold, flavin 96.82
3ka7_A 425 Oxidoreductase; structural genomics, PSI-2, protei 96.65
3hdq_A 397 UDP-galactopyranose mutase; substrate and inhibito 96.6
1b37_A 472 Protein (polyamine oxidase); flavin-dependent amin 96.58
2jae_A 489 L-amino acid oxidase; oxidoreductase, dimerisation 96.13
1d5t_A 433 Guanine nucleotide dissociation inhibitor; ultra-h 95.42
2z3y_A 662 Lysine-specific histone demethylase 1; chromatin, 95.22
3ayj_A 721 Pro-enzyme of L-phenylalanine oxidase; amino acid 95.19
2xag_A 852 Lysine-specific histone demethylase 1; amine oxida 93.75
2bcg_G 453 Secretory pathway GDP dissociation inhibitor; RABG 93.7
3p1w_A 475 Rabgdi protein; GDI RAB, malaria, structural genom 92.52
4gut_A 776 Lysine-specific histone demethylase 1B; histone de 92.1
>3kkj_A Amine oxidase, flavin-containing; oxidoreductase, PSR10, Q888A4, X-RAY, structure, PSI, protein structure initiative; HET: FAD; 2.50A {Pseudomonas syringae PV} Back     alignment and structure
Probab=99.15  E-value=5.2e-11  Score=72.25  Aligned_cols=58  Identities=29%  Similarity=0.560  Sum_probs=51.7

Q ss_pred             ChhHHHHCCCc---cccccCCCCcccccceeecCCCCeeecccCceeeeCCHHHHHHHHHHHhCCc
Q 042631            1 IADYLRSRGVR---FEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGWLERGL   63 (66)
Q Consensus         1 ~A~~L~~~G~~---fEk~~g~rg~GGRmaTRr~~~~~~~~DhGAqyft~~~~~f~~~v~~~~~~g~   63 (66)
                      +|..|+++|++   |||   ++.+|||++|++..+.  .+|||+|||++.++.|...+..+...+.
T Consensus        17 aA~~La~~G~~V~v~Ek---~~~~GG~~~~~~~~~~--~~d~g~~~~~~~~~~~~~~~~~~~~~~~   77 (336)
T 3kkj_A           17 AAQALTAAGHQVHLFDK---SRGSGGRMSSKRSDAG--ALDMGAQYFTARDRRFATAVKQWQAQGH   77 (336)
T ss_dssp             HHHHHHHTTCCEEEECS---SSSSCGGGCEEEETTE--EEECSCCCBCCCSHHHHHHHHHHHHHTS
T ss_pred             HHHHHHHCCCCEEEEEC---CCCCCCcccccccCCc--eeecCccccccCcHHHHHHHHHHHhccc
Confidence            37899999998   999   9999999999998765  6999999999999999998888876554
>3qj4_A Renalase; FAD/NAD(P)-binding rossmann fold superfamily, flavin contain oxidoreductase, monoamine oxidase, NAD, extracellular, oxidoreductase; HET: FAD; 2.50A {Homo sapiens} Back     alignment and structure
>2ivd_A PPO, PPOX, protoporphyrinogen oxidase; porphyrin biosynthesis, chlorophyll biosynthesis, oxidoreductase, HAEM biosynthesis, heme biosynthesis; HET: ACJ FAD TWN; 2.3A {Myxococcus xanthus} SCOP: c.3.1.2 d.16.1.5 PDB: 2ive_A* Back     alignment and structure
>2b9w_A Putative aminooxidase; isomerase, conjugated linoleic acid, FAD; HET: FAD 12P; 1.95A {Propionibacterium acnes} PDB: 2b9x_A* 2b9y_A* 2ba9_A* 2bab_A* 2bac_A* Back     alignment and structure
>2vvm_A Monoamine oxidase N; FAD, peroxisome, flavoprotein, oxidoreductase, enantioselectivity, directed evolution variant; HET: FAD; 1.85A {Aspergillus niger} PDB: 2vvl_A* 2vvl_G* Back     alignment and structure
>4gde_A UDP-galactopyranose mutase; flavin adenine dinucleotide binding, nucleotide binding, MUT isomerase; HET: FDA; 2.20A {Aspergillus fumigatus} PDB: 3ute_A* 3utg_A* 3uth_A* 4gdc_A* 4gdd_A* 3utf_A* 3ukh_A* 3ukf_A* 3uka_A* 3ukl_A* 3ukk_A* 3ukq_A* 3ukp_A* Back     alignment and structure
>2yg5_A Putrescine oxidase; oxidoreductase, flavin; HET: FAD; 1.90A {Rhodococcus erythropolis} PDB: 2yg6_A* 2yg3_A* 2yg4_A* 2yg7_A* 3rha_A* Back     alignment and structure
>1s3e_A Amine oxidase [flavin-containing] B; human monoamine oxidase, inhibitor binding, rasagiline, enantioselectivity, oxidoreductase; HET: FAD RHP; 1.60A {Homo sapiens} SCOP: c.3.1.2 d.16.1.5 PDB: 1gos_A* 1oj9_A* 1ojb_A* 1ojc_A* 1ojd_A* 1s2q_A* 1s2y_A* 1oja_A* 1s3b_A* 2bk3_A* 2byb_A* 2c64_A* 2c65_A* 2c66_A* 2c67_A* 2c70_A* 2v5z_A* 2v60_A* 2v61_A* 2vrl_A* ... Back     alignment and structure
>1sez_A Protoporphyrinogen oxidase, mitochondrial; FAD-binding, para-hydroxy-benzoate-hydroxylase fold (PHBH- fold), monotopic membrane-binding domain; HET: FAD OMN TON; 2.90A {Nicotiana tabacum} SCOP: c.3.1.2 d.16.1.5 Back     alignment and structure
>3i6d_A Protoporphyrinogen oxidase; protein-inhibitor complex, cytoplasm, FAD, flavoprotein, oxidoreductase, porphyrin biosynthesis; HET: FAD ACJ; 2.90A {Bacillus subtilis} Back     alignment and structure
>3lov_A Protoporphyrinogen oxidase; structural genomics, JO center for structural genomics, JCSG, protein structure INI PSI-2; HET: FAD; 2.06A {Exiguobacterium sibiricum} Back     alignment and structure
>1rsg_A FMS1 protein; FAD binding motif, oxidoreductase; HET: FAD; 1.90A {Saccharomyces cerevisiae} PDB: 1z6l_A* 3bi2_A* 3bi4_A* 3bi5_A* 3bnm_B* 3bnu_B* 3cn8_B* 3cnd_B* 3cnp_B* 3cns_A* 3cnt_B* 1yy5_A* 1xpq_A* Back     alignment and structure
>4dgk_A Phytoene dehydrogenase; the FAD/NAD(P)-binding rossmann fold, oxidoreductase; 2.35A {Pantoea ananatis} Back     alignment and structure
>3k7m_X 6-hydroxy-L-nicotine oxidase; enantiomeric substrates, flavoenzymes, nicotine degradation, oxidoreductase; HET: FAD GP7; 1.95A {Arthrobacter nicotinovorans} PDB: 3k7q_X* 3ng7_X* 3ngc_X* 3nh3_X* 3nho_X* 3nk0_X* 3nk1_X* 3nk2_X* 3nn0_X* 3nn6_X* 3k7t_A* Back     alignment and structure
>1v0j_A UDP-galactopyranose mutase; flavoprotein, isomerase; HET: FAD BCN; 2.25A {Mycobacterium tuberculosis} Back     alignment and structure
>2e1m_A L-glutamate oxidase; L-amino acid oxidase, FAD, L-GOX, flavo oxidoreductase; HET: FAD; 2.80A {Streptomyces SP} Back     alignment and structure
>3nrn_A Uncharacterized protein PF1083; alpha-beta protein, structural genomics, PSI-2, protein STRU initiative; HET: AMP; 2.10A {Pyrococcus furiosus} Back     alignment and structure
>2bi7_A UDP-galactopyranose mutase; FAD, flavoprotein, isomerase, lipopolysaccharide biosynthesi; HET: FAD; 2.0A {Klebsiella pneumoniae} SCOP: c.4.1.3 d.16.1.7 PDB: 2bi8_A* 1wam_A* 3inr_A* 3gf4_A* 3int_A* 3kyb_A* Back     alignment and structure
>1i8t_A UDP-galactopyranose mutase; rossman fold, FAD, contractase, isomerase; HET: FAD; 2.40A {Escherichia coli} SCOP: c.4.1.3 d.16.1.7 Back     alignment and structure
>2iid_A L-amino-acid oxidase; flavoenzyme, FAD binding domain, reaction mechanism, sustrat binding, oxidoreductase; HET: NAG FUC PHE FAD; 1.80A {Calloselasma rhodostoma} SCOP: c.3.1.2 d.16.1.5 PDB: 1f8s_A* 1f8r_A* 1reo_A* 1tdk_A* 1tdn_A* 1tdo_A* 3kve_A* 4e0v_A* Back     alignment and structure
>3nks_A Protoporphyrinogen oxidase; FAD containing protein, PPO, variegate porphyria disease, VP oxidoreductase-oxidoreductase inhibitor complex; HET: ACJ FAD; 1.90A {Homo sapiens} Back     alignment and structure
>4dsg_A UDP-galactopyranose mutase; rossmann fold, flavin adenine dinucleotide, isomerase; HET: FAD UDP; 2.25A {Trypanosoma cruzi} PDB: 4dsh_A* Back     alignment and structure
>3ka7_A Oxidoreductase; structural genomics, PSI-2, protein structure initiative, northeast structural genomics consortium, NESG; HET: FAD; 1.80A {Methanosarcina mazei} Back     alignment and structure
>3hdq_A UDP-galactopyranose mutase; substrate and inhibitor, isomerase; HET: GDU FAD; 2.36A {Deinococcus radiodurans} PDB: 3hdy_A* 3he3_A* 3mj4_A* Back     alignment and structure
>1b37_A Protein (polyamine oxidase); flavin-dependent amine oxidase, oxidoreductase; HET: NAG FCA MAN FAD; 1.90A {Zea mays} SCOP: c.3.1.2 d.16.1.5 PDB: 1b5q_A* 1h81_A* 1h82_A* 1h83_A* 1h84_A* 1h86_A* 3kpf_A* 3ku9_A* 3l1r_A* Back     alignment and structure
>2jae_A L-amino acid oxidase; oxidoreductase, dimerisation mode, hydride transfer mechanism, GR2-family, flavoenzyme, FAD containing; HET: FAD; 1.25A {Rhodococcus opacus} PDB: 2jb1_A* 2jb2_A* 2jb3_A* Back     alignment and structure
>1d5t_A Guanine nucleotide dissociation inhibitor; ultra-high resolution, hydrolase inhibitor; 1.04A {Bos taurus} SCOP: c.3.1.3 d.16.1.6 PDB: 1lv0_A* 1gnd_A Back     alignment and structure
>2z3y_A Lysine-specific histone demethylase 1; chromatin, nucleosome, transcription, LSD1, alternative splicing, chromatin regulator, coiled coil; HET: F2N; 2.25A {Homo sapiens} SCOP: a.4.1.18 c.3.1.2 d.16.1.5 PDB: 2ejr_A* 2z5u_A* 3abt_A* 3abu_A* 2y48_A* 2v1d_A* 2h94_A* 2iw5_A* 2uxn_A* 2uxx_A* 2hko_A* 2dw4_A* 2x0l_A* 2l3d_A Back     alignment and structure
>3ayj_A Pro-enzyme of L-phenylalanine oxidase; amino acid oxidase, flavoenzyme, L- binding, oxidoreductase; HET: FAD PHE; 1.10A {Pseudomonas} PDB: 2yr4_A* 2yr6_A* 3ayi_A* 2yr5_A* 3ayl_A* Back     alignment and structure
>2xag_A Lysine-specific histone demethylase 1; amine oxidase, chromatin regulator, histone inhibitor binding, methylation, nucleosome core, oxidoreductase; HET: FAD TCF; 3.10A {Homo sapiens} PDB: 2xaf_A* 2xah_A* 2xaj_A* 2xaq_A* 2xas_A* 2com_A Back     alignment and structure
>2bcg_G Secretory pathway GDP dissociation inhibitor; RABGTPase, geranylgeranylation, vesicular transport, protein transport; HET: GDP GER; 1.48A {Saccharomyces cerevisiae} SCOP: c.3.1.3 c.3.1.3 d.16.1.6 PDB: 1ukv_G* 3cpi_G 3cph_G 3cpj_G* Back     alignment and structure
>3p1w_A Rabgdi protein; GDI RAB, malaria, structural genomics consortium, SGC, trans PF10_0345, protein transport; 1.85A {Plasmodium falciparum 3D7} Back     alignment and structure
>4gut_A Lysine-specific histone demethylase 1B; histone demethylase; HET: FAD PGE; 2.00A {Homo sapiens} PDB: 4gur_A* 4gus_A* 4guu_A* 4fwe_A* 4fwf_A* 4fwj_A* 4gu1_A* Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

No hit with e-value below 0.005

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query66
d1seza1 373 Protoporphyrinogen oxidase {Tobacco (Nicotiana tab 98.85
d2dw4a2 449 Lysine-specific histone demethylase 1, LSD1 {Human 98.68
d2ivda1 347 Protoporphyrinogen oxidase {Myxococcus xanthus [Ta 98.64
d1b5qa1 347 Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} 98.61
d2iida1 370 L-aminoacid oxidase {Malayan pit viper (Calloselas 98.57
d2v5za1 383 Monoamine oxidase B {Human (Homo sapiens) [TaxId: 98.48
d1i8ta1 298 UDP-galactopyranose mutase, N-terminal domain {Esc 97.6
d2bi7a1 314 UDP-galactopyranose mutase, N-terminal domain {Kle 97.29
d2bcgg1 297 Guanine nucleotide dissociation inhibitor, GDI {Ba 96.47
d1d5ta1 336 Guanine nucleotide dissociation inhibitor, GDI {Co 95.05
d2cyua139 E3-binding domain of dihydrolipoamide succinyltran 83.78
d1w4xa1 298 Phenylacetone monooxygenase {Thermobifida fusca [T 82.98
>d1seza1 c.3.1.2 (A:13-329,A:442-497) Protoporphyrinogen oxidase {Tobacco (Nicotiana tabacum) [TaxId: 4097]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: FAD/NAD(P)-binding domain
superfamily: FAD/NAD(P)-binding domain
family: FAD-linked reductases, N-terminal domain
domain: Protoporphyrinogen oxidase
species: Tobacco (Nicotiana tabacum) [TaxId: 4097]

Probab=98.85  E-value=1.1e-09  Score=66.73  Aligned_cols=52  Identities=27%  Similarity=0.399  Sum_probs=46.9

Q ss_pred             hhHHHHCCCc---cccccCCCCcccccceeecCCCCeeecccCceeeeCCHHHHHHHHHH
Q 042631            2 ADYLRSRGVR---FEDIWGNHGLGGRMRSRMIRPQPQIFGHAAQFITVNNSRFCLLINGW   58 (66)
Q Consensus         2 A~~L~~~G~~---fEk~~g~rg~GGRmaTRr~~~~~~~~DhGAqyft~~~~~f~~~v~~~   58 (66)
                      |..|+++|++   |||   +..+||||.|.+.++.  .+|+|+++|+..++.+.++++++
T Consensus        17 A~~La~~G~~V~vlE~---~~~~GG~~~t~~~~g~--~~d~G~~~~~~~~~~~~~~~~~~   71 (373)
T d1seza1          17 AYKLKIHGLNVTVFEA---EGKAGGKLRSVSQDGL--IWDEGANTMTESEGDVTFLIDSL   71 (373)
T ss_dssp             HHHHHTTSCEEEEECS---SSSSCSSCCEEEETTE--EEESSCCCBCCCSHHHHHHHHHT
T ss_pred             HHHHHhCCCCEEEEeC---CCCCcCceEEeccCCE--EEecCceEEeCCCHHHHHHHHHh
Confidence            7889999998   999   9999999999988764  79999999999999998888764
>d2dw4a2 c.3.1.2 (A:274-654,A:764-831) Lysine-specific histone demethylase 1, LSD1 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d2ivda1 c.3.1.2 (A:10-306,A:415-464) Protoporphyrinogen oxidase {Myxococcus xanthus [TaxId: 34]} Back     information, alignment and structure
>d1b5qa1 c.3.1.2 (A:5-293,A:406-463) Polyamine oxidase {Maize (Zea mays) [TaxId: 4577]} Back     information, alignment and structure
>d2iida1 c.3.1.2 (A:4-319,A:433-486) L-aminoacid oxidase {Malayan pit viper (Calloselasma rhodostoma) [TaxId: 8717]} Back     information, alignment and structure
>d2v5za1 c.3.1.2 (A:6-289,A:402-500) Monoamine oxidase B {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1i8ta1 c.4.1.3 (A:1-244,A:314-367) UDP-galactopyranose mutase, N-terminal domain {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d2bi7a1 c.4.1.3 (A:2-247,A:317-384) UDP-galactopyranose mutase, N-terminal domain {Klebsiella pneumoniae [TaxId: 573]} Back     information, alignment and structure
>d2bcgg1 c.3.1.3 (G:5-301) Guanine nucleotide dissociation inhibitor, GDI {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]} Back     information, alignment and structure
>d2cyua1 a.9.1.1 (A:2-40) E3-binding domain of dihydrolipoamide succinyltransferase {Escherichia coli [TaxId: 562]} Back     information, alignment and structure
>d1w4xa1 c.3.1.5 (A:10-154,A:390-542) Phenylacetone monooxygenase {Thermobifida fusca [TaxId: 2021]} Back     information, alignment and structure