Citrus Sinensis ID: 042649


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120-------130-------140-------150-------160-------170-------180-------190-------20
MEFVGSASTQSCITQKRGRRVYGDDRDFKSKNLTAERRRREKLSNRLLTLRSLVPIITNMNKATIVEDAITYIEKLQMTVKVLSDQLLEMESSSEESERPRNDEINAAEEMKKHGIEEKVEVTNVDGCKLWIRIISKKKRSRITKFLEAMASHGFELSDTNVTTFKGATLISSCLNGVYSYKIEAEQVKELLQEIIKSI
ccccccccccccccccccccccccccccccccHHHHHHHHHHHHHHHHHHHHcccccccccHHHHHHHHHHHHHHHHHHHHHHHHHHHHcccccccccccccccccccHHcccccccccccEEEEEccEEEEEEEEcccccHHHHHHHHHHHcccEEEEEEEEEEcccEEEEEEEEccccccccHHHHHHHHHHHHHHc
***************************************REKLSNRLLTLRSLVPIITNMNKATIVEDAITYIEKLQMTVKVLSD*********************************KVEVTNVDGCKLWIRIISKKKRSRITKFLEAMASHGFELSDTNVTTFKGATLISSCLNGVYSYKIEAEQVKELLQEIIKS*
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MEFVGSASTQSCITQKRGRRVYGDDRDFKSKNLTAERRRREKLSNRLLTLRSLVPIITNMNKATIVEDAITYxxxxxxxxxxxxxxxxxxxxxSEESERPRNDEINAAEEMKKHGIEEKVEVTNVDGCKLWIRIISKKKRSRITKFLEAMASHGFELSDTNVTTFKGATLISSCLNGVYSYKIEAEQVKELLQEIIKSI

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Transcription factor DYSFUNCTIONAL TAPETUM 1 Transcription factor. Involved in the control of tapetum development. Required for male fertility and pollen differentiation, especially during callose deposition.probableO81900

Prediction of Enzyme Commission Number ?

No EC number assigned to the protein, probably not an enzyme!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1HLO, chain A
Confidence level:confident
Coverage over the Query: 24-92
View the alignment between query and template
View the model in PyMOL
Template: 3O1L, chain A
Confidence level:probable
Coverage over the Query: 128-195
View the alignment between query and template
View the model in PyMOL