Citrus Sinensis ID: 042671

Local Sequence Feature Prediction

Prediction and (Method)Result
Residue Number Marker
Protein Sequence ?
Secondary Structure (PSIPRED) ?
Secondary Structure Prediction (SSPRO) ?
Coil and Loop (DISEMBL) ?
Flexible Loop (DISEMBL) ?
Low Complexity Region (SEG) ?
Disordered region (IsUnstruct) ?
Disordered Region (DISOPRED) ?
Disordered Region (DISEMBL) ?
Disordered Region (DISPRO) ?
Transmembrane Helix (TMHMM) ?
Transmembrane Helix (HMMTOP) ?
Transmembrane Helix (MEMSAT) ?
TM Helix, Signal Peptide (MEMSAT_SVM) ?
TM Helix, Signal Peptide (Phobius) ?
Signal Peptide (SignalP HMM Mode) ?
Signal Peptide (SignalP NN Mode) ?
Coiled Coils (COILS) ?
Positional Conservation ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------
MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVRSVNEAFKLEKNLSTLPYGQYFQ
cHHHHHccccccEEEEEEHHHHHHccccccccccEEEEEccccccccccccHHHHHHHHHcccccccccHHHHccccccccccccccc
cHHHHHccccEEEEEEEcccccccHHHcccEEcccEEEEccccccEEEEcHHHHHHHHHccccccccccccccccccccccccccccc
mldavrnesntrgyftWSFLDLFELLGGyewsyglyyvdrddpglkrypklsAHWYSRFLKGRSVRSVNEAFKLeknlstlpygqyfq
mldavrnesntrgyftWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHwysrflkgrsvrSVNEAfkleknlstlpygqyfq
MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVRSVNEAFKLEKNLSTLPYGQYFQ
***********RGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVRSVNEAFKLEKNLSTL*******
MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRS************************
*********NTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVRSVNEAFKLEKNLSTLPYGQYFQ
MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGR*************************
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiihhhhhhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
iiiiiiiiiiihhhhhhhhhhhhhhhhooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
oooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooooo
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVRSVNEAFKLEKNLSTLPYGQYFQ
no confident homologs detected

Close Homologs for Annotation Transfer

Close Homologs in SWISS-PROT Database Detected by BLAST ?

Original result of BLAST against SWISS-PROT Database

ID ?Alignment graph ?Length ? Definition ? RBH(Q2H) ? RBH(H2Q) ? Q cover ? H cover ? Identity ? E-value ?
Query88 2.2.26 [Sep-21-2011]
Q93ZI4508 Beta-glucosidase 10 OS=Ar yes no 0.897 0.155 0.531 2e-19
Q3ECW8517 Beta-glucosidase 1 OS=Ara no no 0.715 0.121 0.682 2e-18
Q60DX8533 Beta-glucosidase 22 OS=Or yes no 0.704 0.116 0.645 3e-18
Q8RXN9500 Putative beta-glucosidase no no 0.909 0.16 0.543 3e-18
Q9ZUI3512 Beta-glucosidase 4 OS=Ara no no 0.738 0.126 0.646 4e-18
O65458507 Beta-glucosidase 3 OS=Ara no no 0.738 0.128 0.615 1e-17
B3H5Q1521 Beta-glucosidase 11 OS=Ar no no 0.647 0.109 0.684 6e-17
Q67XN2497 Beta-glucosidase 8 OS=Ara no no 0.897 0.158 0.493 8e-17
Q9LZJ1502 Beta-glucosidase 7 OS=Ara no no 0.875 0.153 0.506 1e-16
Q9STP4506 Beta-glucosidase 9 OS=Ara no no 0.909 0.158 0.475 2e-16
>sp|Q93ZI4|BGL10_ARATH Beta-glucosidase 10 OS=Arabidopsis thaliana GN=BGLU10 PE=2 SV=1 Back     alignment and function desciption
 Score = 94.4 bits (233), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/79 (53%), Positives = 57/79 (72%)

Query: 1   MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFL 60
           ML+A++N S+TRGYF WS +DL+ELL GY  S+G+YYV+  DPG KR PKLSA WY+ FL
Sbjct: 425 MLNAIKNGSDTRGYFVWSMIDLYELLSGYTTSFGMYYVNFSDPGRKRTPKLSASWYTGFL 484

Query: 61  KGRSVRSVNEAFKLEKNLS 79
            G    +  +  +L+ N+S
Sbjct: 485 NGTIDVATQDTIQLQSNIS 503

Arabidopsis thaliana (taxid: 3702)
EC: 3EC: .EC: 2EC: .EC: 1EC: .EC: 2EC: 1
>sp|Q3ECW8|BGL01_ARATH Beta-glucosidase 1 OS=Arabidopsis thaliana GN=BGLU1 PE=2 SV=2 Back     alignment and function description
>sp|Q60DX8|BGL22_ORYSJ Beta-glucosidase 22 OS=Oryza sativa subsp. japonica GN=BGLU22 PE=2 SV=1 Back     alignment and function description
>sp|Q8RXN9|BGL05_ARATH Putative beta-glucosidase 5 OS=Arabidopsis thaliana GN=BGLU5 PE=5 SV=2 Back     alignment and function description
>sp|Q9ZUI3|BGL04_ARATH Beta-glucosidase 4 OS=Arabidopsis thaliana GN=BGLU4 PE=2 SV=2 Back     alignment and function description
>sp|O65458|BGL03_ARATH Beta-glucosidase 3 OS=Arabidopsis thaliana GN=BGLU3 PE=3 SV=2 Back     alignment and function description
>sp|B3H5Q1|BGL11_ARATH Beta-glucosidase 11 OS=Arabidopsis thaliana GN=BGLU11 PE=2 SV=2 Back     alignment and function description
>sp|Q67XN2|BGL08_ARATH Beta-glucosidase 8 OS=Arabidopsis thaliana GN=BGLU8 PE=2 SV=1 Back     alignment and function description
>sp|Q9LZJ1|BGL07_ARATH Beta-glucosidase 7 OS=Arabidopsis thaliana GN=BGLU7 PE=2 SV=2 Back     alignment and function description
>sp|Q9STP4|BGL09_ARATH Beta-glucosidase 9 OS=Arabidopsis thaliana GN=BGLU9 PE=2 SV=2 Back     alignment and function description

Close Homologs in the Non-Redundant Database Detected by BLAST ?

Original result of BLAST against Nonredundant Database

GI ?Alignment Graph ?Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
255564148 511 beta-glucosidase, putative [Ricinus comm 1.0 0.172 0.636 2e-26
255564156 501 beta-glucosidase, putative [Ricinus comm 0.909 0.159 0.691 3e-23
297743884 840 unnamed protein product [Vitis vinifera] 0.863 0.090 0.714 4e-23
359479908 512 PREDICTED: LOW QUALITY PROTEIN: beta-glu 0.863 0.148 0.714 4e-23
147852094 2003 hypothetical protein VITISV_040383 [Viti 0.954 0.041 0.635 7e-23
297743881 551 unnamed protein product [Vitis vinifera] 0.909 0.145 0.654 2e-22
255564154 193 beta-glucosidase, putative [Ricinus comm 0.988 0.450 0.636 2e-22
359479906 502 PREDICTED: beta-glucosidase 11-like [Vit 0.909 0.159 0.654 2e-22
359480303 512 PREDICTED: beta-glucosidase 11-like [Vit 0.988 0.169 0.613 3e-22
225437358 527 PREDICTED: beta-glucosidase 11-like isof 0.977 0.163 0.620 4e-22
>gi|255564148|ref|XP_002523071.1| beta-glucosidase, putative [Ricinus communis] gi|223537633|gb|EEF39256.1| beta-glucosidase, putative [Ricinus communis] Back     alignment and taxonomy information
 Score =  123 bits (308), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/88 (63%), Positives = 68/88 (77%)

Query: 1   MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFL 60
           +LDA+RN SNTRGYFTWSFLD+FELLGGYE  +GLYYVD +DP LKR PKLSAHWY++FL
Sbjct: 424 VLDAIRNGSNTRGYFTWSFLDVFELLGGYETCFGLYYVDMNDPELKRSPKLSAHWYAQFL 483

Query: 61  KGRSVRSVNEAFKLEKNLSTLPYGQYFQ 88
           KGR + S +   +L +N+S       FQ
Sbjct: 484 KGRRIVSSDPVIQLPQNVSAFSISHLFQ 511

Source: Ricinus communis

Species: Ricinus communis

Genus: Ricinus

Family: Euphorbiaceae

Order: Malpighiales

Class:

Phylum: Streptophyta

Superkingdom: Eukaryota
>gi|255564156|ref|XP_002523075.1| beta-glucosidase, putative [Ricinus communis] gi|223537637|gb|EEF39260.1| beta-glucosidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|297743884|emb|CBI36854.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|359479908|ref|XP_003632373.1| PREDICTED: LOW QUALITY PROTEIN: beta-glucosidase 11-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|147852094|emb|CAN82274.1| hypothetical protein VITISV_040383 [Vitis vinifera] Back     alignment and taxonomy information
>gi|297743881|emb|CBI36851.3| unnamed protein product [Vitis vinifera] Back     alignment and taxonomy information
>gi|255564154|ref|XP_002523074.1| beta-glucosidase, putative [Ricinus communis] gi|223537636|gb|EEF39259.1| beta-glucosidase, putative [Ricinus communis] Back     alignment and taxonomy information
>gi|359479906|ref|XP_003632372.1| PREDICTED: beta-glucosidase 11-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|359480303|ref|XP_002267595.2| PREDICTED: beta-glucosidase 11-like [Vitis vinifera] Back     alignment and taxonomy information
>gi|225437358|ref|XP_002268147.1| PREDICTED: beta-glucosidase 11-like isoform 1 [Vitis vinifera] Back     alignment and taxonomy information

Prediction of Gene Ontology (GO) Terms

Close Homologs with Gene Ontology terms Detected by BLAST ?

Original result of BLAST against Gene Ontology (AMIGO)

ID ? Alignment graph ? Length ? Definition ? Q cover ? H cover ? Identity ? E-value ?
Query88
TAIR|locus:2137360508 BGLU10 "beta glucosidase 10" [ 0.897 0.155 0.531 5.2e-19
TAIR|locus:2202710512 BGLU4 "beta glucosidase 4" [Ar 0.909 0.156 0.555 1.9e-18
TAIR|locus:2120653507 BGLU3 "beta glucosidase 2" [Ar 0.909 0.157 0.518 6.4e-18
TAIR|locus:2024685521 BGLU11 "beta glucosidase 11" [ 0.647 0.109 0.684 6.5e-17
TAIR|locus:2081680497 BGLU8 "beta glucosidase 8" [Ar 0.897 0.158 0.493 1.2e-16
TAIR|locus:2081665502 BGLU7 "beta glucosidase 7" [Ar 0.875 0.153 0.506 1.3e-16
TAIR|locus:2137355506 BGLU9 "beta glucosidase 9" [Ar 0.897 0.156 0.481 3.5e-16
UNIPROTKB|Q7XKV4510 BGLU12 "Beta-glucosidase 12" [ 0.670 0.115 0.516 3.6e-12
UNIPROTKB|C7N8L9467 lacG "6-phospho-beta-galactosi 0.693 0.130 0.460 2.9e-11
UNIPROTKB|Q9ZT64513 Q9ZT64 "Beta-glucosidase" [Pin 0.647 0.111 0.534 1.5e-10
TAIR|locus:2137360 BGLU10 "beta glucosidase 10" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
 Score = 235 (87.8 bits), Expect = 5.2e-19, P = 5.2e-19
 Identities = 42/79 (53%), Positives = 57/79 (72%)

Query:     1 MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFL 60
             ML+A++N S+TRGYF WS +DL+ELL GY  S+G+YYV+  DPG KR PKLSA WY+ FL
Sbjct:   425 MLNAIKNGSDTRGYFVWSMIDLYELLSGYTTSFGMYYVNFSDPGRKRTPKLSASWYTGFL 484

Query:    61 KGRSVRSVNEAFKLEKNLS 79
              G    +  +  +L+ N+S
Sbjct:   485 NGTIDVATQDTIQLQSNIS 503
GO:0003824 "catalytic activity" evidence=IEA
GO:0004553 "hydrolase activity, hydrolyzing O-glycosyl compounds" evidence=IEA;ISS
GO:0043169 "cation binding" evidence=IEA
GO:0005773 "vacuole" evidence=IDA
GO:0009610 "response to symbiotic fungus" evidence=RCA
GO:0046283 "anthocyanin-containing compound metabolic process" evidence=IMP
TAIR|locus:2202710 BGLU4 "beta glucosidase 4" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2120653 BGLU3 "beta glucosidase 2" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2024685 BGLU11 "beta glucosidase 11" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081680 BGLU8 "beta glucosidase 8" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2081665 BGLU7 "beta glucosidase 7" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
TAIR|locus:2137355 BGLU9 "beta glucosidase 9" [Arabidopsis thaliana (taxid:3702)] Back     alignment and assigned GO terms
UNIPROTKB|Q7XKV4 BGLU12 "Beta-glucosidase 12" [Oryza sativa Japonica Group (taxid:39947)] Back     alignment and assigned GO terms
UNIPROTKB|C7N8L9 lacG "6-phospho-beta-galactosidase" [Leptotrichia buccalis C-1013-b (taxid:523794)] Back     alignment and assigned GO terms
UNIPROTKB|Q9ZT64 Q9ZT64 "Beta-glucosidase" [Pinus contorta (taxid:3339)] Back     alignment and assigned GO terms

Prediction of Enzyme Commission (EC) Number

EC Number Prediction by Annotation Transfer from SWISS-PROT Entries ?

Original result of BLAST against SWISS-PROT

No confident hit for EC number transfering in SWISSPROT detected by BLAST

EC Number Prediction by Ezypred Server ?

Original result from Ezypred Server

Fail to connect to Ezypred Server

EC Number Prediction by EFICAz Software ?

No EC number assignment, probably not an enzyme!

Prediction of Functionally Associated Proteins

Functionally Associated Proteins Detected by STRING ?

Original result from the STRING server

Your Input:
GSVIVG00027996001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (272 aa)
(Vitis vinifera)
Predicted Functional Partners:
GSVIVG00027998001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (160 aa)
 ••     0.500
GSVIVG00027995001
SubName- Full=Chromosome chr7 scaffold_42, whole genome shotgun sequence; (147 aa)
 ••     0.499
GSVIVG00003798001
SubName- Full=Chromosome chr13 scaffold_149, whole genome shotgun sequence; (132 aa)
 ••     0.496

Conserved Domains and Related Protein Families

Conserved Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against CDD database part I

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
PLN02849503 PLN02849, PLN02849, beta-glucosidase 3e-26
PLN02814504 PLN02814, PLN02814, beta-glucosidase 1e-24
PLN02998497 PLN02998, PLN02998, beta-glucosidase 1e-22
pfam00232454 pfam00232, Glyco_hydro_1, Glycosyl hydrolase famil 2e-15
COG2723460 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glu 2e-14
PRK13511469 PRK13511, PRK13511, 6-phospho-beta-galactosidase; 1e-13
TIGR03356426 TIGR03356, BGL, beta-galactosidase 4e-13
TIGR01233467 TIGR01233, lacG, 6-phospho-beta-galactosidase 2e-09
PRK09852474 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosi 2e-05
PRK09593478 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewe 3e-05
PRK09589476 PRK09589, celA, 6-phospho-beta-glucosidase; Review 8e-05
>gnl|CDD|215455 PLN02849, PLN02849, beta-glucosidase Back     alignment and domain information 
 Score = 99.7 bits (248), Expect = 3e-26
 Identities = 45/64 (70%), Positives = 52/64 (81%)

Query: 1   MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFL 60
           +L AVRN S+TRGYF WSF+DL+ELL GYE+S+GLY V+  DP  KR PKLSAHWYS FL
Sbjct: 421 VLKAVRNGSDTRGYFVWSFMDLYELLKGYEFSFGLYSVNFSDPHRKRSPKLSAHWYSAFL 480

Query: 61  KGRS 64
           KG S
Sbjct: 481 KGNS 484

Length = 503
>gnl|CDD|215435 PLN02814, PLN02814, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215539 PLN02998, PLN02998, beta-glucosidase Back     alignment and domain information
>gnl|CDD|215809 pfam00232, Glyco_hydro_1, Glycosyl hydrolase family 1 Back     alignment and domain information
>gnl|CDD|225343 COG2723, BglB, Beta-glucosidase/6-phospho-beta-glucosidase/beta- galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>gnl|CDD|184102 PRK13511, PRK13511, 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>gnl|CDD|234180 TIGR03356, BGL, beta-galactosidase Back     alignment and domain information
>gnl|CDD|130300 TIGR01233, lacG, 6-phospho-beta-galactosidase Back     alignment and domain information
>gnl|CDD|182112 PRK09852, PRK09852, cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>gnl|CDD|236580 PRK09593, arb, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>gnl|CDD|181973 PRK09589, celA, 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information

Conserved Domains Detected by HHsearch ?

Original result of HHsearch against CDD database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query 88
PLN02849503 beta-glucosidase 99.94
PLN02814504 beta-glucosidase 99.94
PF00232455 Glyco_hydro_1: Glycosyl hydrolase family 1; InterP 99.94
PRK09852474 cryptic 6-phospho-beta-glucosidase; Provisional 99.94
TIGR01233467 lacG 6-phospho-beta-galactosidase. This enzyme is 99.93
PLN02998497 beta-glucosidase 99.93
PRK13511469 6-phospho-beta-galactosidase; Provisional 99.93
PRK09589476 celA 6-phospho-beta-glucosidase; Reviewed 99.93
PRK09593478 arb 6-phospho-beta-glucosidase; Reviewed 99.93
PRK15014477 6-phospho-beta-glucosidase BglA; Provisional 99.93
KOG0626524 consensus Beta-glucosidase, lactase phlorizinhydro 99.92
COG2723460 BglB Beta-glucosidase/6-phospho-beta-glucosidase/b 99.89
TIGR03356427 BGL beta-galactosidase. 99.88
COG3693345 XynA Beta-1,4-xylanase [Carbohydrate transport and 90.95
smart00633254 Glyco_10 Glycosyl hydrolase family 10. 88.16
>PLN02849 beta-glucosidase Back     alignment and domain information 
Probab=99.94  E-value=8.2e-28  Score=192.75  Aligned_cols=66  Identities=68%  Similarity=1.186  Sum_probs=61.9

Q ss_pred             ChHHHhcCCceeEEEeeecchhccccCCCceeeeeEEEcCCCCCcceeecchHHHHHHHHhcCCCC
Q 042671            1 MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVR   66 (88)
Q Consensus         1 v~kAi~dGv~v~GY~~WSl~DnfEW~~Gy~~RfGL~~VD~~~~~~~R~pK~Sa~~y~~ii~~~~~~   66 (88)
                      |++||+|||||+|||+|||+|||||..||++||||++||+++.+++|+||+|++||+++|++|+.-
T Consensus       421 l~~Ai~dGv~V~GY~~WSl~DnfEW~~Gy~~RfGLi~VD~~~~~~~R~pK~S~~wy~~ii~~~~~~  486 (503)
T PLN02849        421 VLKAVRNGSDTRGYFVWSFMDLYELLKGYEFSFGLYSVNFSDPHRKRSPKLSAHWYSAFLKGNSTF  486 (503)
T ss_pred             HHHHHHcCCCEEEEeeccchhhhchhccccCccceEEECCCCCCcceecccHHHHHHHHHHhCCCC
Confidence            578999999999999999999999999999999999999987668999999999999999998743

>PLN02814 beta-glucosidase Back     alignment and domain information
>PF00232 Glyco_hydro_1: Glycosyl hydrolase family 1; InterPro: IPR001360 O-Glycosyl hydrolases 3 Back     alignment and domain information
>PRK09852 cryptic 6-phospho-beta-glucosidase; Provisional Back     alignment and domain information
>TIGR01233 lacG 6-phospho-beta-galactosidase Back     alignment and domain information
>PLN02998 beta-glucosidase Back     alignment and domain information
>PRK13511 6-phospho-beta-galactosidase; Provisional Back     alignment and domain information
>PRK09589 celA 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK09593 arb 6-phospho-beta-glucosidase; Reviewed Back     alignment and domain information
>PRK15014 6-phospho-beta-glucosidase BglA; Provisional Back     alignment and domain information
>KOG0626 consensus Beta-glucosidase, lactase phlorizinhydrolase, and related proteins [Carbohydrate transport and metabolism] Back     alignment and domain information
>COG2723 BglB Beta-glucosidase/6-phospho-beta-glucosidase/beta-galactosidase [Carbohydrate transport and metabolism] Back     alignment and domain information
>TIGR03356 BGL beta-galactosidase Back     alignment and domain information
>COG3693 XynA Beta-1,4-xylanase [Carbohydrate transport and metabolism] Back     alignment and domain information
>smart00633 Glyco_10 Glycosyl hydrolase family 10 Back     alignment and domain information

Homologous Structure Templates

Structure Templates Detected by BLAST ?

Original result of BLAST against Protein Data Bank

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
3ptk_A505 The Crystal Structure Of Rice (Oryza Sativa L.) Os4 4e-12
2pbg_A468 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 3e-11
4pbg_A468 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 3e-11
1pbg_A468 The Three-Dimensional Structure Of 6-Phospho-Beta G 3e-11
2jf6_A532 Structure Of Inactive Mutant Of Strictosidine Gluco 1e-09
1cbg_A490 The Crystal Structure Of A Cyanogenic Beta-Glucosid 1e-09
3scr_A481 Crystal Structure Of Rice Bglu1 E386s Mutant Length 2e-08
3scw_A481 Crystal Structure Of Rice Bglu1 E386gY341A MUTANT C 2e-08
3f4v_A481 Semi-Active E176q Mutant Of Rice Bglu1, A Plant Exo 2e-08
3scp_A481 Crystal Structure Of Rice Bglu1 E386a Mutant Length 2e-08
3scn_A481 Crystal Structure Of Rice Bglu1 E386g Mutant Length 2e-08
3scv_A481 Crystal Structure Of Rice Bglu1 E386gS334A MUTANT C 2e-08
2rgl_A481 Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBE 2e-08
3gno_A488 Crystal Structure Of A Rice Os3bglu6 Beta-glucosida 2e-08
3aiu_A564 Crystal Structure Of Beta-Glucosidase In Rye Length 4e-08
2dga_A565 Crystal Structure Of Hexameric Beta-Glucosidase In 4e-08
3ais_A565 Crystal Structure Of A Mutant Beta-Glucosidase In W 4e-08
1v02_E565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-07
1v02_A565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-07
1v03_A565 Crystal Structure Of The Sorghum Bicolor Dhurrinase 1e-07
3vik_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
3vij_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
3ahz_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
3ai0_A487 Crystal Structure Of Beta-Glucosidase From Termite 2e-07
1gnx_A479 B-Glucosidase From Streptomyces Sp Length = 479 2e-07
1h49_A512 Crystal Structure Of The Inactive Double Mutant Of 5e-07
1e1e_A512 Crystal Structure Of A Monocot (Maize Zmglu1) Beta- 5e-07
1e4l_A512 Crystal Structure Of The Inactive Mutant Monocot (M 5e-07
1hxj_A507 Crystal Structure Of The Maize Zm-P60.1 Beta-Glucos 5e-07
1ug6_A431 Structure Of Beta-Glucosidase At Atomic Resolution 3e-06
1np2_A436 Crystal Structure Of Thermostable Beta-Glycosidase 4e-06
4a3y_A540 Crystal Structure Of Raucaffricine Glucosidase From 9e-06
3u57_A513 Structures Of Alkaloid Biosynthetic Glucosidases De 1e-05
4atd_A513 Crystal Structure Of Native Raucaffricine Glucosida 1e-05
3zjk_A431 Crystal Structure Of Ttb-gly F401s Mutant Length = 1e-05
2e9l_A469 Crystal Structure Of Human Cytosolic Neutral Beta-G 1e-05
2jfe_X469 The Crystal Structure Of Human Cytosolic Beta-Gluco 1e-05
2zox_A469 Crystal Structure Of The Covalent Intermediate Of H 1e-05
2e3z_A465 Crystal Structure Of Intracellular Family 1 Beta- G 1e-05
3ahy_A473 Crystal Structure Of Beta-Glucosidase 2 From Fungus 1e-05
4gxp_A467 Chimeric Family 1 Beta-Glucosidase Made With Non-Co 1e-05
3ta9_A458 Beta-Glucosidase A From The Halothermophile H. Oren 4e-05
1od0_A468 Family 1 B-Glucosidase From Thermotoga Maritima Len 6e-05
2o9r_A452 Beta-Glucosidase B Complexed With Thiocellobiose Le 8e-05
2o9p_A454 Beta-Glucosidase B From Paenibacillus Polymyxa Leng 8e-05
2jie_A454 Beta-Glucosidase B From Bacillus Polymyxa Complexed 8e-05
1qox_A449 Beta-Glucosidase From Bacillus Circulans Sp. Alkalo 8e-05
3ahx_A453 Crystal Structure Of Beta-Glucosidase A From Bacter 3e-04
4f79_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 4e-04
4f66_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 4e-04
3cmj_A465 Crystal Structure Of Engineered Beta-Glucosidase Fr 5e-04
3pn8_A480 The Crystal Structure Of 6-Phospho-Beta-Glucosidase 5e-04
4hz6_A444 Crystal Structure Of Bglb Length = 444 5e-04
1uyq_A447 Mutated B-Glucosidase A From Paenibacillus Polymyxa 8e-04
>pdb|3PTK|A Chain A, The Crystal Structure Of Rice (Oryza Sativa L.) Os4bglu12 Length = 505 Back     alignment and structure 
Iteration: 1

 Score = 66.2 bits (160), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 31/60 (51%), Positives = 42/60 (70%), Gaps = 1/60 (1%)
Query: 1   MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFL 60
           +L A+R+ +N +GYF WS LD FE   GY   +G+ +VD +D G KRYPK SAHW+ +FL
Sbjct: 445 LLSAIRDGANVKGYFAWSLLDNFEWSNGYTVRFGINFVDYND-GRKRYPKNSAHWFKKFL 503
>pdb|2PBG|A Chain A, 6-Phospho-Beta-D-Galactosidase Form-B Length = 468 Back     alignment and structure
>pdb|4PBG|A Chain A, 6-Phospho-Beta-Galactosidase Form-Cst Length = 468 Back     alignment and structure
>pdb|1PBG|A Chain A, The Three-Dimensional Structure Of 6-Phospho-Beta Galactosidase From Lactococcus Lactis Length = 468 Back     alignment and structure
>pdb|2JF6|A Chain A, Structure Of Inactive Mutant Of Strictosidine Glucosidase In Complex With Strictosidine Length = 532 Back     alignment and structure
>pdb|1CBG|A Chain A, The Crystal Structure Of A Cyanogenic Beta-Glucosidase From White Clover (Trifolium Repens L.), A Family 1 Glycosyl-Hydrolase Length = 490 Back     alignment and structure
>pdb|3SCR|A Chain A, Crystal Structure Of Rice Bglu1 E386s Mutant Length = 481 Back     alignment and structure
>pdb|3SCW|A Chain A, Crystal Structure Of Rice Bglu1 E386gY341A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|3F4V|A Chain A, Semi-Active E176q Mutant Of Rice Bglu1, A Plant ExoglucanaseBETA- Glucosidase Length = 481 Back     alignment and structure
>pdb|3SCP|A Chain A, Crystal Structure Of Rice Bglu1 E386a Mutant Length = 481 Back     alignment and structure
>pdb|3SCN|A Chain A, Crystal Structure Of Rice Bglu1 E386g Mutant Length = 481 Back     alignment and structure
>pdb|3SCV|A Chain A, Crystal Structure Of Rice Bglu1 E386gS334A MUTANT COMPLEXED WITH Cellotetraose Length = 481 Back     alignment and structure
>pdb|2RGL|A Chain A, Rice Bglu1 Beta-Glucosidase, A Plant ExoglucanaseBETA-Glucosidase Length = 481 Back     alignment and structure
>pdb|3GNO|A Chain A, Crystal Structure Of A Rice Os3bglu6 Beta-glucosidase Length = 488 Back     alignment and structure
>pdb|3AIU|A Chain A, Crystal Structure Of Beta-Glucosidase In Rye Length = 564 Back     alignment and structure
>pdb|2DGA|A Chain A, Crystal Structure Of Hexameric Beta-Glucosidase In Wheat Length = 565 Back     alignment and structure
>pdb|3AIS|A Chain A, Crystal Structure Of A Mutant Beta-Glucosidase In Wheat Complexed With Dimboa-Glc Length = 565 Back     alignment and structure
>pdb|1V02|E Chain E, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V02|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|1V03|A Chain A, Crystal Structure Of The Sorghum Bicolor Dhurrinase 1 Length = 565 Back     alignment and structure
>pdb|3VIK|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Cellobiose Length = 487 Back     alignment and structure
>pdb|3VIJ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Glucose Length = 487 Back     alignment and structure
>pdb|3AHZ|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Tris Length = 487 Back     alignment and structure
>pdb|3AI0|A Chain A, Crystal Structure Of Beta-Glucosidase From Termite Neotermes Koshunensis In Complex With Para-Nitrophenyl-Beta-D-Glucopyranoside Length = 487 Back     alignment and structure
>pdb|1GNX|A Chain A, B-Glucosidase From Streptomyces Sp Length = 479 Back     alignment and structure
>pdb|1H49|A Chain A, Crystal Structure Of The Inactive Double Mutant Of The Maize Beta-Glucosidase Zmglu1-E191d-F198v In Complex With Dimboa-Glucoside Length = 512 Back     alignment and structure
>pdb|1E1E|A Chain A, Crystal Structure Of A Monocot (Maize Zmglu1) Beta-Glucosidase Length = 512 Back     alignment and structure
>pdb|1E4L|A Chain A, Crystal Structure Of The Inactive Mutant Monocot (Maize Zmglu1) Beta-Glucosidase Zm Glu191asp Length = 512 Back     alignment and structure
>pdb|1HXJ|A Chain A, Crystal Structure Of The Maize Zm-P60.1 Beta-Glucosidase Length = 507 Back     alignment and structure
>pdb|1UG6|A Chain A, Structure Of Beta-Glucosidase At Atomic Resolution From Thermus Thermophilus Hb8 Length = 431 Back     alignment and structure
>pdb|1NP2|A Chain A, Crystal Structure Of Thermostable Beta-Glycosidase From Thermophilic Eubacterium Thermus Nonproteolyticus Hg102 Length = 436 Back     alignment and structure
>pdb|4A3Y|A Chain A, Crystal Structure Of Raucaffricine Glucosidase From Ajmaline Biosynthesis Pathway Length = 540 Back     alignment and structure
>pdb|3U57|A Chain A, Structures Of Alkaloid Biosynthetic Glucosidases Decode Substrate Specificity Length = 513 Back     alignment and structure
>pdb|4ATD|A Chain A, Crystal Structure Of Native Raucaffricine Glucosidase Length = 513 Back     alignment and structure
>pdb|3ZJK|A Chain A, Crystal Structure Of Ttb-gly F401s Mutant Length = 431 Back     alignment and structure
>pdb|2E9L|A Chain A, Crystal Structure Of Human Cytosolic Neutral Beta-Glycosylceramidase (Klotho-Related Prote:klrp) Complex With Glucose And Fatty Acids Length = 469 Back     alignment and structure
>pdb|2JFE|X Chain X, The Crystal Structure Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2ZOX|A Chain A, Crystal Structure Of The Covalent Intermediate Of Human Cytosolic Beta-Glucosidase Length = 469 Back     alignment and structure
>pdb|2E3Z|A Chain A, Crystal Structure Of Intracellular Family 1 Beta- Glucosidase Bgl1a From The Basidiomycete Phanerochaete Chrysosporium In Substrate-Free Form Length = 465 Back     alignment and structure
>pdb|3AHY|A Chain A, Crystal Structure Of Beta-Glucosidase 2 From Fungus Trichoderma Reesei In Complex With Tris Length = 473 Back     alignment and structure
>pdb|4GXP|A Chain A, Chimeric Family 1 Beta-Glucosidase Made With Non-Contiguous Schema Length = 467 Back     alignment and structure
>pdb|3TA9|A Chain A, Beta-Glucosidase A From The Halothermophile H. Orenii Length = 458 Back     alignment and structure
>pdb|1OD0|A Chain A, Family 1 B-Glucosidase From Thermotoga Maritima Length = 468 Back     alignment and structure
>pdb|2O9R|A Chain A, Beta-Glucosidase B Complexed With Thiocellobiose Length = 452 Back     alignment and structure
>pdb|2O9P|A Chain A, Beta-Glucosidase B From Paenibacillus Polymyxa Length = 454 Back     alignment and structure
>pdb|2JIE|A Chain A, Beta-Glucosidase B From Bacillus Polymyxa Complexed With 2- F-Glucose Length = 454 Back     alignment and structure
>pdb|1QOX|A Chain A, Beta-Glucosidase From Bacillus Circulans Sp. Alkalophilus Length = 449 Back     alignment and structure
>pdb|3AHX|A Chain A, Crystal Structure Of Beta-Glucosidase A From Bacterium Clostridium Cellulovorans Length = 453 Back     alignment and structure
>pdb|4F79|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase Mutant (E375q) In Complex With Salicin 6-Phosphate Length = 480 Back     alignment and structure
>pdb|4F66|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 In Complex With Beta-D-Glucose-6-Phosphate. Length = 480 Back     alignment and structure
>pdb|3CMJ|A Chain A, Crystal Structure Of Engineered Beta-Glucosidase From Soil Metagenome Length = 465 Back     alignment and structure
>pdb|3PN8|A Chain A, The Crystal Structure Of 6-Phospho-Beta-Glucosidase From Streptococcus Mutans Ua159 Length = 480 Back     alignment and structure
>pdb|4HZ6|A Chain A, Crystal Structure Of Bglb Length = 444 Back     alignment and structure
>pdb|1UYQ|A Chain A, Mutated B-Glucosidase A From Paenibacillus Polymyxa Showing Increased Stability Length = 447 Back     alignment and structure

Structure Templates Detected by RPS-BLAST ?

Original result of RPS-BLAST against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query88
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 1e-28
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 7e-28
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 1e-27
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 1e-27
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 5e-27
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 7e-27
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 7e-27
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 1e-26
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 2e-26
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 4e-26
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 4e-26
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 2e-25
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 4e-25
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 1e-24
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 3e-24
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 3e-23
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 1e-21
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 1e-21
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 1e-21
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 2e-21
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 3e-21
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 3e-21
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 4e-21
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 4e-21
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 5e-21
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 6e-21
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 1e-20
4eam_A489 Lactase, beta-galactosidase; glycoside hydrolase, 3e-20
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 8e-20
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 5e-09
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 7e-09
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 7e-09
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Length = 532 Back     alignment and structure
 Score =  105 bits (265), Expect = 1e-28
 Identities = 31/82 (37%), Positives = 44/82 (53%), Gaps = 2/82 (2%)

Query: 1   MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFL 60
           + DA+ +  N +GYF WSF D FE   GY   YG+ +VD      +RYPK SA WY  F+
Sbjct: 449 VRDAIDDGVNVKGYFVWSFFDNFEWNLGYICRYGIIHVDYKS--FERYPKESAIWYKNFI 506

Query: 61  KGRSVRSVNEAFKLEKNLSTLP 82
            G+S  S  +  + E  +  + 
Sbjct: 507 AGKSTTSPAKRRREEAQVELVK 528
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Length = 565 Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Length = 565 Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Length = 512 Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Length = 490 Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Length = 469 Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Length = 505 Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Length = 487 Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Length = 540 Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Length = 481 Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Length = 464 Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Length = 488 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Length = 501 Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Length = 479 Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Length = 473 Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Length = 465 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Length = 468 Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Length = 458 Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Length = 447 Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Length = 449 Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Length = 481 Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Length = 473 Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Length = 454 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Length = 468 Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Length = 453 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Length = 431 Back     alignment and structure
>4eam_A Lactase, beta-galactosidase; glycoside hydrolase, chemical biology, allosteric activation switchable enzyme, chemical rescue; 1.70A {Sulfolobus solfataricus P2} PDB: 4ean_A 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 1gow_A 1uwi_A Length = 489 Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Length = 423 Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Length = 479 Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} Length = 481 Back     alignment and structure

Structure Templates Detected by HHsearch ?

Original result of HHsearch against PDB70 database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
4ha4_A489 Beta-galactosidase; TIM barrel, beta-glycosidase, 99.95
1uwi_A489 Beta-galactosidase; hydrolase, beta-glycosidase, g 99.95
3vii_A487 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.95
4a3y_A540 Raucaffricine-O-beta-D-glucosidase; hydrolase, alk 99.94
2e9l_A469 Cytosolic beta-glucosidase; novel cytosolic neutra 99.94
3qom_A481 6-phospho-beta-glucosidase; structural genomics, P 99.94
4dde_A480 6-phospho-beta-glucosidase; structural genomics, P 99.94
1qvb_A481 Beta-glycosidase; TIM-barrel, thermostable, hydrol 99.93
4hz8_A444 Beta-glucosidase; BGLB,BGL, hydrolase, glycosid ba 99.93
3ta9_A458 Glycoside hydrolase family 1; TIM barrel, glucosid 99.93
4b3l_A479 Beta-glucosidase; hydrolase, glycosidase, carbohyd 99.93
1wcg_A464 Thioglucosidase, myrosinase; aphid, beta-glucosida 99.93
1pbg_A468 PGAL, 6-phospho-beta-D-galactosidase; hydrolase (g 99.93
2jf7_A532 Strictosidine-O-beta-D-glucosidase; alkaloid, hydr 99.93
3ahx_A453 Beta-glucosidase A; cellulases, glycosyl hydrolase 99.93
3ptm_A505 Beta-glucosidase OS4BGlu12; beta-alpha barrel, gly 99.93
4atd_A513 Raucaffricine-O-beta-D-glucosidase; alkaloid, hydr 99.93
2xhy_A479 BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, 99.93
1gnx_A479 Beta-glucosidase; hydrolase, glycosyltransferase, 99.93
2o9p_A454 Beta-glucosidase B; family 1 glycoside hydrolase; 99.93
3f5l_A481 Beta-glucosidase; beta-alpha-barrels, glycosidase, 99.93
1e4i_A447 Beta-glucosidase; hydrolase, family 1 glycosyl hyd 99.93
1v02_A565 Dhurrinase, dhurrinase-1; beta-glucosidase, dhurri 99.93
3gnp_A488 OS03G0212800 protein; beta-alpha barrel, glycosida 99.93
3apg_A473 Beta-glucosidase; TIM barrel, hydrolase, sugar bin 99.93
1qox_A449 Beta-glucosidase; hydrolase, cellulose degradation 99.93
3fj0_A465 Beta-glucosidase; BGLB,BGL, hydrolase, glycosidase 99.93
2j78_A468 Beta-glucosidase A; family 1, hydrolase, inhibitor 99.92
1cbg_A490 Cyanogenic beta-glucosidase; hydrolase (O-glycosyl 99.92
1ug6_A431 Beta-glycosidase; glucosidase, atomic resolution, 99.92
1v08_A512 Beta-glucosidase; glycoside hydrolase, dimboa-gluc 99.92
2e3z_A465 Beta-glucosidase; TIM barrel, glycoside hydrolase 99.92
3ahy_A473 Beta-glucosidase; cellulases, glycosyl hydrolase, 99.92
2dga_A565 Beta-glucosidase; alpha/beta barrel, hydrolase; 1. 99.92
1vff_A423 Beta-glucosidase; glycosyl hydrolase, membrane-bou 99.92
1e4m_M501 Myrosinase MA1; hydrolase, family 1 glycosyl hydro 99.91
1fob_A334 Beta-1,4-galactanase; B/A barrel, glycosyl hydrola 97.74
3hn3_A613 Beta-G1, beta-glucuronidase; lysosomal enzyme, aci 97.68
1w91_A 503 Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 96.8
1nq6_A302 XYS1; glycoside hydrolase family 10, xylanase, xyl 96.74
3cui_A315 EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine 96.61
1uhv_A 500 Beta-xylosidase; family 39 glycoside hydrolase, xy 96.58
1i1w_A303 Endo-1,4-beta-xylanase; xylan degradation, hydrola 94.29
1n82_A331 Xylanase, intra-cellular xylanase; hydrolase; 1.45 93.76
1ta3_B303 Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), 93.3
1v0l_A313 Endo-1,4-beta-xylanase A; glycoside hydrolase fami 93.2
1xyz_A347 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrola 92.98
1w32_A348 Endo-1,4-beta-xylanase A precursor; mutant, calciu 92.18
3lpf_A605 Beta-glucuronidase; alpha/beta barrel, sugar-bindi 91.59
1ur1_A378 Endoxylanase; hydrolase, family 10, glycoside hydr 90.52
3niy_A341 Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.5 90.36
3u7b_A327 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 90.13
1us2_A530 Xylanase10C, endo-beta-1,4-xylanase; hydrolase, ca 88.96
2dep_A356 Xylanase B, thermostable celloxylanase; glycosidas 88.93
2d1z_A 436 Endo-1,4-beta-D-xylanase; TIM-barrel, retaining en 87.69
4f8x_A335 Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET 87.3
>4ha4_A Beta-galactosidase; TIM barrel, beta-glycosidase, hydrolase; HET: GOL PG6; 1.37A {Acidilobus saccharovorans} PDB: 4ha3_A* 1uws_A* 1uwr_A* 1uwq_A* 1uwt_A* 1uwu_A* 2ceq_A* 2cer_A* 4eam_A 4ean_A Back     alignment and structure
Probab=99.95  E-value=4.6e-29  Score=197.29  Aligned_cols=73  Identities=26%  Similarity=0.413  Sum_probs=67.2

Q ss_pred             ChHHHhcCCceeEEEeeecchhccccCCCceeeeeEEEcCCCCCcceeecchHHHHHHHHhcCCCCcccchhhhc
Q 042671            1 MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVRSVNEAFKLE   75 (88)
Q Consensus         1 v~kAi~dGv~v~GY~~WSl~DnfEW~~Gy~~RfGL~~VD~~~~~~~R~pK~Sa~~y~~ii~~~~~~~~~~~~~~~   75 (88)
                      |++||+|||||+|||+|||||||||+.||++||||++||++  +++|+||+|++||+++|++|+++.+.+.+.-.
T Consensus       406 ~~~Ai~dGv~v~GY~~WSl~DnfEW~~Gy~~RfGliyVD~~--t~~R~~K~S~~wy~~vi~~ng~~~e~~~~~~~  478 (489)
T 4ha4_A          406 VHRALQDGVNVIGYLHWSLADNYEWASGFSKRFGLLMVDYS--TKRLHWRPSAFIYREIAKSRAITDEIEHLNSV  478 (489)
T ss_dssp             HHHHHHTTCCEEEEEESCSBCCCCGGGGGGSCCCSEEECTT--TCCEEECHHHHHHHHHHHHTEECTTTGGGSSC
T ss_pred             HHHHHHCCCCEEEEeecCchhhhchhhccccccceEEEeCC--CCCeeeccHHHHHHHHHHhCCCCchhhhccCC
Confidence            57899999999999999999999999999999999999997  58999999999999999999999876665433
>1uwi_A Beta-galactosidase; hydrolase, beta-glycosidase, glycosidase; 2.55A {Sulfolobus solfataricus} SCOP: c.1.8.4 PDB: 1gow_A Back     alignment and structure
>3vii_A Beta-glucosidase; cellulases, glycosyl hydrolase, hydrolase; HET: BTB; 0.97A {Neotermes koshunensis} PDB: 3ahz_A* 3vif_A* 3vih_A 3vig_A* 3vim_A* 3ai0_A* 3vin_A* 3vio_A* 3vip_A* 3vij_A* 3vik_A* 3vil_A* Back     alignment and structure
>4a3y_A Raucaffricine-O-beta-D-glucosidase; hydrolase, alkaloid; 2.15A {Rauvolfia serpentina} PDB: 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>2e9l_A Cytosolic beta-glucosidase; novel cytosolic neutral beta-glycosylceramidase, hydrolase; HET: BGC PLM OLA; 1.60A {Homo sapiens} PDB: 2e9m_A* 2zox_A* 2jfe_X* Back     alignment and structure
>3qom_A 6-phospho-beta-glucosidase; structural genomics, PSI-biology, midwest center for structu genomics, MCSG, glycoside hydrolase, hydrolase; HET: BGC; 1.50A {Lactobacillus plantarum} SCOP: c.1.8.0 PDB: 4gze_A Back     alignment and structure
>1qvb_A Beta-glycosidase; TIM-barrel, thermostable, hydrolase; 2.40A {Thermosphaera aggregans} SCOP: c.1.8.4 Back     alignment and structure
>4hz8_A Beta-glucosidase; BGLB,BGL, hydrolase, glycosid barrel, carbohydrate/sugar binding; HET: BGC; 1.14A {Uncultured bacterium} PDB: 4hz7_A* 4hz6_A* 3fj0_A* 3cmj_A 3fiz_A* 3fiy_A* Back     alignment and structure
>3ta9_A Glycoside hydrolase family 1; TIM barrel, glucosidase; 3.00A {Halothermothrix orenii} Back     alignment and structure
>4b3l_A Beta-glucosidase; hydrolase, glycosidase, carbohydrate-active enzyme; 2.51A {Streptococcus pyogenes} PDB: 4b3k_A Back     alignment and structure
>1wcg_A Thioglucosidase, myrosinase; aphid, beta-glucosidase, insect, beta-barrel, hydrolase, glycosidase; 1.10A {Brevicoryne brassicae} SCOP: c.1.8.4 Back     alignment and structure
>1pbg_A PGAL, 6-phospho-beta-D-galactosidase; hydrolase (glycosyl hydrolase); 2.30A {Lactococcus lactis} SCOP: c.1.8.4 PDB: 3pbg_A 2pbg_A 4pbg_A* Back     alignment and structure
>2jf7_A Strictosidine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.48A {Rauvolfia serpentina} PDB: 2jf6_A Back     alignment and structure
>3ahx_A Beta-glucosidase A; cellulases, glycosyl hydrolase, manganese enhancement, hydro; HET: 7PE; 1.90A {Clostridium cellulovorans} Back     alignment and structure
>3ptm_A Beta-glucosidase OS4BGlu12; beta-alpha barrel, glycosidase, hydrolase; HET: G2F; 2.40A {Oryza sativa} PDB: 3ptk_A* 3ptq_A* Back     alignment and structure
>4atd_A Raucaffricine-O-beta-D-glucosidase; alkaloid, hydrolase; 2.10A {Rauvolfia serpentina} PDB: 4a3y_A 3u5u_A 3u57_A 3u5y_A* Back     alignment and structure
>2xhy_A BGLA, 6-phospho-beta-glucosidase BGLA; hydrolase, glycosidase; 2.30A {Escherichia coli} Back     alignment and structure
>1gnx_A Beta-glucosidase; hydrolase, glycosyltransferase, family 1 of glycosyl hydrolase; HET: SUC; 1.68A {Streptomyces SP} SCOP: c.1.8.4 PDB: 1gon_A Back     alignment and structure
>2o9p_A Beta-glucosidase B; family 1 glycoside hydrolase; 2.10A {Paenibacillus polymyxa} PDB: 2o9t_A* 2z1s_A* 2jie_A* 2o9r_A* Back     alignment and structure
>3f5l_A Beta-glucosidase; beta-alpha-barrels, glycosidase, hydrolase; HET: LB2 MES; 1.37A {Oryza sativa japonica group} PDB: 3aht_A* 3ahv_A* 3f5i_A* 3f5j_A* 3f5k_A* 3f4v_A* 2rgm_A* 2rgl_A* 3scr_A* 3scs_A* 3scp_A* 3scq_A* 3scu_A* 3scn_A* 3sco_A* 3sct_A* 3scv_A* 3scw_A* Back     alignment and structure
>1e4i_A Beta-glucosidase; hydrolase, family 1 glycosyl hydrolase, covalent enzyme-GLYC intermediate, alpha/beta barrel; HET: G2F NFG; 2.00A {Bacillus polymyxa} SCOP: c.1.8.4 PDB: 1tr1_A 1bgg_A* 1bga_A 1uyq_A* Back     alignment and structure
>1v02_A Dhurrinase, dhurrinase-1; beta-glucosidase, dhurrin hydrolysis, PEST defense, family GH1, hydrolase; 1.9A {Sorghum bicolor} SCOP: c.1.8.4 PDB: 1v02_E 1v03_A* Back     alignment and structure
>3gnp_A OS03G0212800 protein; beta-alpha barrel, glycosidase, hydrolase; HET: SOG; 1.80A {Oryza sativa subsp} PDB: 3gno_A* 3gnr_A* Back     alignment and structure
>3apg_A Beta-glucosidase; TIM barrel, hydrolase, sugar binding, hydrolysis; 2.35A {Pyrococcus furiosus} Back     alignment and structure
>1qox_A Beta-glucosidase; hydrolase, cellulose degradation; 2.7A {Bacillus circulans} SCOP: c.1.8.4 Back     alignment and structure
>2j78_A Beta-glucosidase A; family 1, hydrolase, inhibitor, glycosidase, polysaccharide degradation, transition state mimic, carbohydrate metabolism; HET: GOX; 1.65A {Thermotoga maritima} SCOP: c.1.8.4 PDB: 1oif_A* 1oim_A* 1oin_A* 1od0_A* 1w3j_A* 1uz1_A* 2cbv_A* 2ces_A* 2cet_A* 2j75_A* 2j77_A* 2cbu_A* 2j79_A* 2j7b_A* 2j7c_A* 2j7d_A* 2j7e_A* 2j7f_A* 2j7g_A* 2j7h_A* ... Back     alignment and structure
>1cbg_A Cyanogenic beta-glucosidase; hydrolase (O-glycosyl); 2.15A {Trifolium repens} SCOP: c.1.8.4 Back     alignment and structure
>1ug6_A Beta-glycosidase; glucosidase, atomic resolution, riken structural genomics/PR initiative, RSGI, structural genomics, hydrolase; 0.99A {Thermus thermophilus} SCOP: c.1.8.4 PDB: 1np2_A Back     alignment and structure
>1v08_A Beta-glucosidase; glycoside hydrolase, dimboa-glucoside, inhibitor, PEST defense, family GH1, hydrolase, chloroplast, transit peptide, 3D-structure; HET: NTZ; 1.9A {Zea mays} SCOP: c.1.8.4 PDB: 1e4l_A* 1e4n_A* 1e56_A* 1e55_A* 1e1e_A 1e1f_A* 1h49_A* 1hxj_A Back     alignment and structure
>2e3z_A Beta-glucosidase; TIM barrel, glycoside hydrolase family 1, CLAN GH-A, structural genomics, NPPSFA; 1.50A {Phanerochaete chrysosporium} PDB: 2e40_A* Back     alignment and structure
>3ahy_A Beta-glucosidase; cellulases, glycosyl hydrolase, manganese enhancement, hydro; 1.63A {Trichoderma reesei} Back     alignment and structure
>2dga_A Beta-glucosidase; alpha/beta barrel, hydrolase; 1.80A {Triticum aestivum} PDB: 3aiq_A* 3air_A* 3ais_A* 3aiu_A 3aiv_A* 3aiw_A* Back     alignment and structure
>1vff_A Beta-glucosidase; glycosyl hydrolase, membrane-bound enzyme, thermostability, TIM barrel, alkylglucosides; 2.50A {Pyrococcus horikoshii} SCOP: c.1.8.4 Back     alignment and structure
>1e4m_M Myrosinase MA1; hydrolase, family 1 glycosyl hydrolase, glucosinolate, TIM B; HET: NAG FUC BMA MAN; 1.2A {Sinapis alba} SCOP: c.1.8.4 PDB: 1e6q_M* 1e6s_M* 1e6x_M* 1e70_M* 1e71_M* 1e72_M* 1e73_M* 1w9b_M* 1w9d_M* 2wxd_M* 1dwa_M* 1dwf_M* 1dwg_M* 1dwh_M* 1dwi_M* 1dwj_M* 1myr_A* Back     alignment and structure
>1fob_A Beta-1,4-galactanase; B/A barrel, glycosyl hydrolase, family 53, CLAN GH-A; 1.80A {Aspergillus aculeatus} SCOP: c.1.8.3 PDB: 1fhl_A Back     alignment and structure
>3hn3_A Beta-G1, beta-glucuronidase; lysosomal enzyme, acid hydrolase, glycosidase, disease mutat glycoprotein, hydrolase, lysosome, mucopolysaccharidosis; HET: NDG NAG BMA MAN GUP; 1.70A {Homo sapiens} PDB: 1bhg_A* Back     alignment and structure
>1w91_A Beta-xylosidase; MAD, seMet, tetramer, hydrolase; 2.2A {Geobacillus stearothermophilus} SCOP: b.71.1.2 c.1.8.3 PDB: 2bs9_A 2bfg_A* Back     alignment and structure
>1nq6_A XYS1; glycoside hydrolase family 10, xylanase, xylan degradation,, hydrolase; 1.78A {Streptomyces halstedii} SCOP: c.1.8.3 Back     alignment and structure
>3cui_A EXO-beta-1,4-glucanase; CEX, xylanase, isofagomine inhibitor, TIM barrel, cellulose degradation, glycosidase, hydrolase; HET: X4S; 1.50A {Cellulomonas fimi} PDB: 3cug_A* 3cuh_A* 3cuf_A* 3cuj_A* 1fh9_A* 1fh7_A 1fh8_A 1exp_A* 1fhd_A* 1j01_A* 2exo_A 2xyl_A 2his_A* Back     alignment and structure
>1uhv_A Beta-xylosidase; family 39 glycoside hydrolase, xylan, xylose, covalent glycosyl-enzyme intermediate; 2.10A {Thermoanaerobacterium saccharolyticum} SCOP: b.71.1.2 c.1.8.3 PDB: 1px8_A Back     alignment and structure
>1i1w_A Endo-1,4-beta-xylanase; xylan degradation, hydrolase, glycosidase, enzyme, ultra HIG resolution, cryo temperature, 1; HET: PCA; 0.89A {Thermoascus aurantiacus} SCOP: c.1.8.3 PDB: 1i1x_A* 2bnj_A* 1gok_A 1gom_A 1goo_A 1goq_A* 1gor_A* 1k6a_A 3o2l_A 3nyd_A* 1tux_A 1b31_A 1b30_A 1b3v_A* 1b3w_A* 1b3x_A* 1b3y_A* 1b3z_A* 1bg4_A Back     alignment and structure
>1n82_A Xylanase, intra-cellular xylanase; hydrolase; 1.45A {Geobacillus stearothermophilus} SCOP: c.1.8.3 PDB: 3mua_A* 2q8x_A* 3msd_A* 3msg_A* 3mui_A* 3ms8_A Back     alignment and structure
>1ta3_B Endo-1,4-beta-xylanase; beta alpha barrel (XIP-I), beta alpha barrel (xylanase), HYD inhibitor-hydrolase complex; HET: NAG; 1.70A {Emericella nidulans} SCOP: c.1.8.3 Back     alignment and structure
>1v0l_A Endo-1,4-beta-xylanase A; glycoside hydrolase family 10, xylan degradation, isofagomine, hydrolase; 0.98A {Streptomyces lividans} SCOP: c.1.8.3 PDB: 1e0x_A 1e0w_A* 1od8_A 1v0k_A 1v0m_A 1v0n_A 1e0v_A* 1xas_A 2g3i_A 2g3j_A* 2g4f_A 1v6y_A Back     alignment and structure
>1xyz_A 1,4-beta-D-xylan-xylanohydrolase; glycosyl hydrolase, xylanase, family F/10 of glycosyl hydrolases, glycosyltransferase; 1.40A {Clostridium thermocellum} SCOP: c.1.8.3 Back     alignment and structure
>1w32_A Endo-1,4-beta-xylanase A precursor; mutant, calcium ION, thermostable, glycosyle hydrolase, family 10, error prone PCR, hydrolase; 1.2A {Cellvibrio japonicus} SCOP: c.1.8.3 PDB: 1w2p_A 1w2v_A 1w3h_A 1clx_A 1e5n_A* 1xys_A Back     alignment and structure
>3lpf_A Beta-glucuronidase; alpha/beta barrel, sugar-binding domain, beta-sandwich domai glycosyl hydrolase, glycosida hydrolase; HET: Z77; 2.26A {Escherichia coli} PDB: 3k46_A* 3k4d_A* 3lpg_A* 3k4a_A Back     alignment and structure
>1ur1_A Endoxylanase; hydrolase, family 10, glycoside hydrolase, hemicellulose, xylan degradation; HET: XYS AHR; 1.43A {Cellvibrio mixtus} SCOP: c.1.8.3 PDB: 1uqy_A* 1uqz_A* 1ur2_A* 2cnc_A* Back     alignment and structure
>3niy_A Endo-1,4-beta-xylanase; TIM-barrel, hydrolase; 1.58A {Thermotoga petrophila rku-1} SCOP: c.1.8.3 PDB: 3nj3_A* 1vbr_A* 1vbu_A Back     alignment and structure
>3u7b_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA MAN; 1.94A {Fusarium oxysporum} Back     alignment and structure
>1us2_A Xylanase10C, endo-beta-1,4-xylanase; hydrolase, carbohydrate binding module, xylan degradation; HET: XYP; 1.85A {Cellvibrio japonicus} SCOP: b.18.1.11 c.1.8.3 PDB: 1us3_A Back     alignment and structure
>2dep_A Xylanase B, thermostable celloxylanase; glycosidase, xylan degradation, family 10, structural genomics, NPPSFA; 1.80A {Clostridium stercorarium} Back     alignment and structure
>2d1z_A Endo-1,4-beta-D-xylanase; TIM-barrel, retaining enzyme, catalytic-site mutant, chemica hydrolase; 1.60A {Streptomyces olivaceoviridis} PDB: 2d20_A* 2d22_A 2d23_A 2d24_A* 1xyf_A 1isw_A* 1isx_A* 1isy_A* 1isv_A* 1it0_A* 1v6u_A* 1v6v_A* 1v6w_A* 1v6x_A* 1isz_A Back     alignment and structure
>4f8x_A Endo-1,4-beta-xylanase; TIM barrel, hydrolase; HET: NAG BMA; 1.47A {Penicillium canescens} Back     alignment and structure

Homologous Structure Domains

Structure Domains Detected by RPS-BLAST ?

Original result of RPS-BLAST against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? E-value ?
Query 88
d1pbga_468 c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL 6e-21
d1cbga_490 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 6e-21
d1wcga1462 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid ( 9e-21
d1e4ia_447 c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa 2e-20
d1vffa1423 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyr 2e-20
d1ug6a_426 c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophi 2e-20
d1v02a_484 c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) { 2e-20
d1uwsa_489 c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus 2e-20
d1gnxa_464 c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. 2e-20
d1qoxa_449 c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulan 2e-20
d1qvba_481 c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermospha 5e-20
d2j78a1443 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga m 1e-19
d1e4mm_499 c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) { 1e-19
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Length = 468 Back     information, alignment and structure

class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: 6-phospho-beta-D-galactosidase, PGAL
species: Lactococcus lactis [TaxId: 1358]

 Score = 83.0 bits (204), Expect = 6e-21
 Identities = 29/65 (44%), Positives = 42/65 (64%), Gaps = 2/65 (3%)

Query: 1   MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFL 60
           + DA+ + +N +GYF WS +D+F    GYE  YGL+YVD D    +RYPK SAHWY +  
Sbjct: 405 LSDAIADGANVKGYFIWSLMDVFSWSNGYEKRYGLFYVDFDT--QERYPKKSAHWYKKLA 462

Query: 61  KGRSV 65
           + + +
Sbjct: 463 ETQVI 467
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Length = 490 Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Length = 462 Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Length = 447 Back     information, alignment and structure
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Length = 423 Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Length = 426 Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Length = 484 Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Length = 489 Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Length = 464 Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Length = 449 Back     information, alignment and structure
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Length = 481 Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Length = 443 Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Length = 499 Back     information, alignment and structure

Homologous Domains Detected by HHsearch ?

Original result of HHsearch against SCOP70(version1.75) database

ID ?Alignment Graph ?Length ? Definition ? Probability ?
Query88
d1qvba_481 beta-Glycosidase {Archaeon Thermosphaera aggregans 99.96
d1vffa1423 Beta-glucosidase A {Archaeon Pyrococcus horikoshii 99.95
d1e4ia_447 Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406 99.95
d1qoxa_449 Beta-glucosidase A {Bacillus circulans, subsp. alk 99.95
d1gnxa_464 Beta-glucosidase A {Streptomyces sp. [TaxId: 1931] 99.95
d2j78a1443 Beta-glucosidase A {Thermotoga maritima [TaxId: 23 99.95
d1pbga_468 6-phospho-beta-D-galactosidase, PGAL {Lactococcus 99.95
d1wcga1462 Thioglucosidase {Cabbage aphid (Brevicoryne brassi 99.95
d1uwsa_489 beta-Glycosidase {Archaeon Sulfolobus solfataricus 99.94
d1cbga_490 Plant beta-glucosidase (myrosinase) {Creeping whit 99.94
d1ug6a_426 Beta-glucosidase A {Thermus thermophilus [TaxId: 2 99.93
d1e4mm_499 Plant beta-glucosidase (myrosinase) {White mustard 99.93
d1v02a_484 Plant beta-glucosidase (myrosinase) {Sorghum bicol 99.93
d1kwga2393 A4 beta-galactosidase {Thermus thermophilus [TaxId 97.95
d1xyza_320 Xylanase {Clostridium thermocellum, XynZ [TaxId: 1 96.17
d1vbua1324 Xylanase {Thermotoga maritima [TaxId: 2336]} 95.9
d1bhga3304 beta-Glucuronidase, domain 3 {Human (Homo sapiens) 94.18
d1n82a_330 Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId 93.72
d1v0la_302 Xylanase A, catalytic core {Streptomyces lividans 93.66
d1nq6a_302 Xylanase A, catalytic core {Streptomyces halstedii 93.63
d1i1wa_303 Xylanase A, catalytic core {Thermoascus aurantiacu 92.57
d1us3a2364 Xylanase 10c {Cellvibrio japonicus [TaxId: 155077] 91.64
d1uhva2346 Beta-D-xylosidase, catalytic domain {Thermoanaerob 91.43
d1ur1a_350 Xylanase {Cellvibrio mixtus [TaxId: 39650]} 90.13
d1ta3b_301 Xylanase A, catalytic core {Emericella nidulans (A 88.48
d2je8a5348 Five-domain beta-mannosidase, domain 3 {Bacteroide 87.93
d1w32a_346 Xylanase A, catalytic core {Pseudomonas fluorescen 87.8
d1fh9a_312 Xylanase A, catalytic core {Cellulomonas fimi [Tax 87.08
d1rh9a1370 Beta-mannanase {Tomato (Lycopersicon esculentum) [ 83.89
>d1qvba_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Thermosphaera aggregans [TaxId: 54254]} Back     information, alignment and structure
class: Alpha and beta proteins (a/b)
fold: TIM beta/alpha-barrel
superfamily: (Trans)glycosidases
family: Family 1 of glycosyl hydrolase
domain: beta-Glycosidase
species: Archaeon Thermosphaera aggregans [TaxId: 54254]

Probab=99.96  E-value=5.2e-30  Score=199.58  Aligned_cols=73  Identities=25%  Similarity=0.419  Sum_probs=68.9

Q ss_pred             ChHHHhcCCceeEEEeeecchhccccCCCceeeeeEEEcCCCCCcceeecchHHHHHHHHhcCCCCcccchhhhc
Q 042671            1 MLDAVRNESNTRGYFTWSFLDLFELLGGYEWSYGLYYVDRDDPGLKRYPKLSAHWYSRFLKGRSVRSVNEAFKLE   75 (88)
Q Consensus         1 v~kAi~dGv~v~GY~~WSl~DnfEW~~Gy~~RfGL~~VD~~~~~~~R~pK~Sa~~y~~ii~~~~~~~~~~~~~~~   75 (88)
                      |++||+|||||+|||+|||+|||||..||++||||++||++  +++|+||+|++||++||++|++|.+.+.+++-
T Consensus       408 ~~~Ai~dGv~V~GY~~WSl~Dn~EW~~Gy~~RfGL~~VD~~--t~~R~pK~Sa~~yk~ii~~n~~p~~~~~~~~~  480 (481)
T d1qvba_         408 VWKAANEGIPVKGYLHWSLTDNYEWAQGFRQKFGLVMVDFK--TKKRYLRPSALVFREIATHNGIPDELQHLTLI  480 (481)
T ss_dssp             HHHHHHTTCCEEEEEEECSBCCCCGGGTTSSCCCSEEEETT--TTEEEECHHHHHHHHHHHHTBCCGGGGGGGSC
T ss_pred             HHHHHHCCCCEEEEeeccchhhhChhhcccccCceEEEcCC--CCCcccccHHHHHHHHHHhCCCCchhhhcccc
Confidence            47899999999999999999999999999999999999997  58999999999999999999999988888764
>d1vffa1 c.1.8.4 (A:1-423) Beta-glucosidase A {Archaeon Pyrococcus horikoshii [TaxId: 53953]} Back     information, alignment and structure
>d1e4ia_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus polymyxa [TaxId: 1406]} Back     information, alignment and structure
>d1qoxa_ c.1.8.4 (A:) Beta-glucosidase A {Bacillus circulans, subsp. alkalophilus [TaxId: 1397]} Back     information, alignment and structure
>d1gnxa_ c.1.8.4 (A:) Beta-glucosidase A {Streptomyces sp. [TaxId: 1931]} Back     information, alignment and structure
>d2j78a1 c.1.8.4 (A:3-445) Beta-glucosidase A {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1pbga_ c.1.8.4 (A:) 6-phospho-beta-D-galactosidase, PGAL {Lactococcus lactis [TaxId: 1358]} Back     information, alignment and structure
>d1wcga1 c.1.8.4 (A:3-464) Thioglucosidase {Cabbage aphid (Brevicoryne brassicae) [TaxId: 69196]} Back     information, alignment and structure
>d1uwsa_ c.1.8.4 (A:) beta-Glycosidase {Archaeon Sulfolobus solfataricus [TaxId: 2287]} Back     information, alignment and structure
>d1cbga_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Creeping white clover (Trifolium repens) [TaxId: 3899]} Back     information, alignment and structure
>d1ug6a_ c.1.8.4 (A:) Beta-glucosidase A {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1e4mm_ c.1.8.4 (M:) Plant beta-glucosidase (myrosinase) {White mustard (Sinapis alba) [TaxId: 3728]} Back     information, alignment and structure
>d1v02a_ c.1.8.4 (A:) Plant beta-glucosidase (myrosinase) {Sorghum bicolor [TaxId: 4558]} Back     information, alignment and structure
>d1kwga2 c.1.8.1 (A:1-393) A4 beta-galactosidase {Thermus thermophilus [TaxId: 274]} Back     information, alignment and structure
>d1xyza_ c.1.8.3 (A:) Xylanase {Clostridium thermocellum, XynZ [TaxId: 1515]} Back     information, alignment and structure
>d1vbua1 c.1.8.3 (A:517-840) Xylanase {Thermotoga maritima [TaxId: 2336]} Back     information, alignment and structure
>d1bhga3 c.1.8.3 (A:329-632) beta-Glucuronidase, domain 3 {Human (Homo sapiens) [TaxId: 9606]} Back     information, alignment and structure
>d1n82a_ c.1.8.3 (A:) Xylanase {Bacillus stearothermophilus, Ixt6 [TaxId: 1422]} Back     information, alignment and structure
>d1v0la_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces lividans [TaxId: 1916]} Back     information, alignment and structure
>d1nq6a_ c.1.8.3 (A:) Xylanase A, catalytic core {Streptomyces halstedii [TaxId: 1944]} Back     information, alignment and structure
>d1i1wa_ c.1.8.3 (A:) Xylanase A, catalytic core {Thermoascus aurantiacus [TaxId: 5087]} Back     information, alignment and structure
>d1us3a2 c.1.8.3 (A:243-606) Xylanase 10c {Cellvibrio japonicus [TaxId: 155077]} Back     information, alignment and structure
>d1uhva2 c.1.8.3 (A:14-359) Beta-D-xylosidase, catalytic domain {Thermoanaerobacterium saccharolyticum [TaxId: 28896]} Back     information, alignment and structure
>d1ur1a_ c.1.8.3 (A:) Xylanase {Cellvibrio mixtus [TaxId: 39650]} Back     information, alignment and structure
>d1ta3b_ c.1.8.3 (B:) Xylanase A, catalytic core {Emericella nidulans (Aspergillus nidulans) [TaxId: 162425]} Back     information, alignment and structure
>d2je8a5 c.1.8.3 (A:331-678) Five-domain beta-mannosidase, domain 3 {Bacteroides thetaiotaomicron [TaxId: 818]} Back     information, alignment and structure
>d1w32a_ c.1.8.3 (A:) Xylanase A, catalytic core {Pseudomonas fluorescens [TaxId: 294]} Back     information, alignment and structure
>d1fh9a_ c.1.8.3 (A:) Xylanase A, catalytic core {Cellulomonas fimi [TaxId: 1708]} Back     information, alignment and structure
>d1rh9a1 c.1.8.3 (A:30-399) Beta-mannanase {Tomato (Lycopersicon esculentum) [TaxId: 4081]} Back     information, alignment and structure