Citrus Sinensis ID: 042780


Local Sequence Feature Prediction

Prediction and MethodResult
Residue Number Marker
Protein Sequence ?
Secondary Structure (Consensus) ?
Disordered Region (Consensus) ?
Transmembrane Helix (Consensus) ?
Signal Peptide (Consensus) ?
Coiled Coil (COILS) ?
 
--------10--------20--------30--------40--------50--------60--------70--------80--------90-------100-------110-------120--
DNNNGDVLVQYVVLRRDLIDAWPLGSVVTQGCHASVSAIWSHKDDPHTLQYCSPQNINSMHKVTLEVKGETQIVNLSEKLNAGGIAHKLWIEQPENIPTCLATKPYPKSTVSLVFKKLKLCK
ccccccEEEEEEEEEcccccccccHHHHHHHHHHHHHHHHHHcccccHHHHccccccccccEEEEEcccHHHHHHHHHHHHHccccCEEEEEcccccCEEEEEccccccHHHHHHccccccc
****GDVLVQYVVLRRDLIDAWPLGSVVTQGCHASVSAIWSHKDDPHTLQYCSPQNINSMHKVTLEVKGETQIVNLSEKLNAGGIAHKLWIEQPENIPTCLATKPYPKSTVSLVFKKLKLCK
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
xxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxxx
DNNNGDVLVQYVVLRRDLIDAWPLGSVVTQGCHASVSAIWSHKDDPHTLQYCSPQNINSMHKVTLEVKGETQIVNLSEKLNAGGIAHKLWIEQPENIPTCLATKPYPKSTVSLVFKKLKLCK

Function Prediction

Annotation transfered from Closely Related SWISS-PROT Entries ?

Annotation ?Function Description ?Confidence Level ?Reference Protein ?
Putative peptidyl-tRNA hydrolase PTRHD1 probableQ3SZ85
Putative peptidyl-tRNA hydrolase PTRHD1 probableD3Z4S3
Putative peptidyl-tRNA hydrolase PTRHD1 probableQ6GMV3

Prediction of Enzyme Commission Number ?

No confident prediction of EC number!


Spatial Structural Prediction

Structural Models Based on Templates

Template: 1Q7S, chain A
Confidence level:very confident
Coverage over the Query: 6-121
View the alignment between query and template
View the model in PyMOL